Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30034296
Uniprot Best hitAnkyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3 (E=4.26225e-57)
Length (bp)2615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30034296) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30034296) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30034296) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30034296) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034296

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034296SMESG000017258.1 Contig32585newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034296SMESG000017258.1 Contig32585uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30034296SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 218.009 bits (554), Expect = 8.481e-58
Identity = 119/440 (27.05%), Postives = 212/440 (48.18%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+  +  +     K+ + P+H     GH ++VK+L++ N +       G  P+H+A   GHV     L++     +A   KK   P+H A   G V + E+L+ ++ +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++ +  +P+ +A
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLT---PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 2 Score: 209.92 bits (533), Expect = 3.799e-55
Identity = 125/489 (25.56%), Postives = 235/489 (48.06%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  +  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K  VNA  ++D  P+  A+  G+  +VK+L+    + +        PLH A   GH E V  L +       +T++ ++P+ +A
Sbjct:   63 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVA 543          

HSP 3 Score: 194.512 bits (493), Expect = 3.090e-50
Identity = 118/437 (27.00%), Postives = 213/437 (48.74%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE + ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q    + A  +++ +P+
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPL 474          

HSP 4 Score: 183.341 bits (464), Expect = 1.067e-46
Identity = 107/403 (26.55%), Postives = 184/403 (45.66%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK        + +Q PLH A   GH + VK+L+E+N N N       +P++ A + GHVE    L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     VE+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    +   P+  A   GYI +  +L
Sbjct:  391 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN--GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 5 Score: 173.326 bits (438), Expect = 1.867e-43
Identity = 113/437 (25.86%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H A ++G  ++V  L+  +I  E    + N   LH+A   G  + V+ L+    N+NA  +   +P+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V  LI+      T  K     +H+A  N     A +L+  D N D+ +  G     P+H A    ++ + ++L+++  ++    +    P+H+A  +G+  +VR+L+DR   IE     +   P+H A + GH  I  +L+D    I+A  ++   PIH A +  H +  +LL+    +I+    L++  P+H A   GH  +AK+L+D+    N+   N + P+  A ++ ++ ++++L+     IDA       PLH A   GH  IVK L Q G        +  +P+ +A
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTA-LHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKT-KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID-DITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA 444          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 218.009 bits (554), Expect = 8.875e-58
Identity = 119/440 (27.05%), Postives = 212/440 (48.18%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+  +  +     K+ + P+H     GH ++VK+L++ N +       G  P+H+A   GHV     L++     +A   KK   P+H A   G V + E+L+ ++ +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++ +  +P+ +A
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLT---PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 2 Score: 209.92 bits (533), Expect = 3.766e-55
Identity = 125/489 (25.56%), Postives = 235/489 (48.06%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  +  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K  VNA  ++D  P+  A+  G+  +VK+L+    + +        PLH A   GH E V  L +       +T++ ++P+ +A
Sbjct:   63 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVA 543          

HSP 3 Score: 194.512 bits (493), Expect = 3.470e-50
Identity = 118/437 (27.00%), Postives = 213/437 (48.74%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE + ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q    + A  +++ +P+
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPL 474          

HSP 4 Score: 183.341 bits (464), Expect = 1.136e-46
Identity = 107/403 (26.55%), Postives = 184/403 (45.66%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK        + +Q PLH A   GH + VK+L+E+N N N       +P++ A + GHVE    L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     VE+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    +   P+  A   GYI +  +L
Sbjct:  391 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN--GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 5 Score: 173.326 bits (438), Expect = 1.787e-43
Identity = 113/437 (25.86%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H A ++G  ++V  L+  +I  E    + N   LH+A   G  + V+ L+    N+NA  +   +P+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V  LI+      T  K     +H+A  N     A +L+  D N D+ +  G     P+H A    ++ + ++L+++  ++    +    P+H+A  +G+  +VR+L+DR   IE     +   P+H A + GH  I  +L+D    I+A  ++   PIH A +  H +  +LL+    +I+    L++  P+H A   GH  +AK+L+D+    N+   N + P+  A ++ ++ ++++L+     IDA       PLH A   GH  IVK L Q G        +  +P+ +A
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTA-LHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKT-KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID-DITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA 444          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 217.624 bits (553), Expect = 1.069e-57
Identity = 119/440 (27.05%), Postives = 212/440 (48.18%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+  +  +     K+ + P+H     GH ++VK+L++ N +       G  P+H+A   GHV     L++     +A   KK   P+H A   G V + E+L+ ++ +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++ +  +P+ +A
Sbjct:  375 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLT---PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 807          

HSP 2 Score: 209.534 bits (532), Expect = 4.572e-55
Identity = 125/489 (25.56%), Postives = 235/489 (48.06%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  +  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K  VNA  ++D  P+  A+  G+  +VK+L+    + +        PLH A   GH E V  L +       +T++ ++P+ +A
Sbjct:   96 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVA 576          

HSP 3 Score: 194.126 bits (492), Expect = 4.168e-50
Identity = 118/437 (27.00%), Postives = 213/437 (48.74%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE + ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q    + A  +++ +P+
Sbjct:   82 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPL 507          

HSP 4 Score: 183.341 bits (464), Expect = 1.151e-46
Identity = 107/403 (26.55%), Postives = 184/403 (45.66%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK        + +Q PLH A   GH + VK+L+E+N N N       +P++ A + GHVE    L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     VE+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    +   P+  A   GYI +  +L
Sbjct:  424 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN--GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 819          

HSP 5 Score: 173.326 bits (438), Expect = 2.122e-43
Identity = 113/437 (25.86%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H A ++G  ++V  L+  +I  E    + N   LH+A   G  + V+ L+    N+NA  +   +P+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V  LI+      T  K     +H+A  N     A +L+  D N D+ +  G     P+H A    ++ + ++L+++  ++    +    P+H+A  +G+  +VR+L+DR   IE     +   P+H A + GH  I  +L+D    I+A  ++   PIH A +  H +  +LL+    +I+    L++  P+H A   GH  +AK+L+D+    N+   N + P+  A ++ ++ ++++L+     IDA       PLH A   GH  IVK L Q G        +  +P+ +A
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTA-LHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKT-KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID-DITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 209.149 bits (531), Expect = 6.467e-55
Identity = 108/438 (24.66%), Postives = 221/438 (50.46%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    H+++VK+L+++  +     E    P+  A ++G  + V +L++N        G+     LH+A  +    +  +L++++ N +   +   +P++ A   G+V +A LL+++   +  F  +N   P+H+    G+ ++VK+L+D    I+   +DG  P+H A  +GH  + ++L++    + A   K+    +H A   G VE++  L+     ++A   E   P+H+A   G  EIV++L+      +A    N Y P+H + + G   +  +L++         +  + P+H A + G  ++AKLL+ R+   ++ AG N   P+H A    ++ +A LL+++    +A  +N + P+  A+++  ++I   L+N   + +   +    PLH A + GHT++V LL   G +I   T+   + + LA
Sbjct:  113 LYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD-FTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLA 541          

HSP 2 Score: 194.126 bits (492), Expect = 4.589e-50
Identity = 111/466 (23.82%), Postives = 223/466 (47.85%), Query Frame = 2
Query:  161 RSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID--NKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDI--EAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +S A  L N ++ D   +    PL H+A  +G++ +   L++    ++        P+H A ++G   +VKLL+D   +ID +   G     PLH A   GH   V++L+E    + A  +   + ++ A + G VE+ + L+     +     + ++ P+H+    G  +IV++L+      +    +G  P+H++   G V +A +L++      + A KK   P+H A   G +++ ++L+ +    ++  +    P+H+A    ++++  +L+++     A    N Y P+H A K     I   L++   +     +    P+H A + GH ++  LL+D+  +I     +GL +   +H A +    ++A +L     D +A  +  + P+I A   G +++V  L+ Q  +++A  +  + PLH A ++GHT I+ +L Q G    A T    + + +A
Sbjct:  185 KSAALLLQNDHNADVQSKSGFTPL-HIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL---TPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARA-REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGA-AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHAT-AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS---LHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 640          

HSP 3 Score: 182.956 bits (463), Expect = 1.583e-46
Identity = 102/446 (22.87%), Postives = 214/446 (47.98%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A      +    L+  DHN D++ +  +   P+H A   G   +  LL++    +DF    G     PLH+A   G+ + VK+L++    I+A      +P++ A + GH ++ +LL+++   + +   K     +HM    G  ++V+ L+     ++   ++ + P+H+A   G   I ++L+      +A A      P+H +   G V++  VL+          ++ + P+H+A + G  ++ ++L+ R+   ++  G N   P+H A  + +  +  +L+++     A  ++ + P+H A ++    IA  L++   + +I    G+    P+H A + GH D+  LL+D+  +++   ++    +  A++   + +  IL     D DA  +  + PL  AC  G+ ++V  L + G ++ A T+  Y+P+  A
Sbjct:  173 PALHIAARKDDTKSAALLLQNDHNADVQSKSGFT--PLHIAAHYGNVNVATLLLNRGAAVDFTARNGI---TPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL-LARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA-ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA-GKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQA 607          

HSP 4 Score: 168.318 bits (425), Expect = 6.404e-42
Identity = 103/466 (22.10%), Postives = 212/466 (45.49%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI-------------------------------DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+ V   +   +DI   ++     +H A ++G   +V+ L+      +    + N   LH+A   G  + VK+L++   NINA  +   +P+Y A +  H+++ K L++   + Q    ++   P+ +   +GH   V +L+                               D N D+++  K G  P+H+A   G+V +A +L++    ++ +A +    P+H A   G+  ++++L+ +   I+A+  +   P+H A   G  ++V +L++R   + A         +H A + G   +VR L+     ++A   +   P+H A   G   I +LL+      +A A  N + P+H +   G  D+A +L++     +   +  + P+  A++ G +++ K+L+ ++   D+  +    PLH A    + ++  LL + G    A  +  Y+P+ +A
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTA-LHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN-QSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQS--KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETA-LHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA-ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIA 475          

HSP 5 Score: 157.147 bits (396), Expect = 2.502e-38
Identity = 100/434 (23.04%), Postives = 185/434 (42.63%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA---------------------------GAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L N+    ++  R     +H+A   G+  +VK L+D    I+ +      P+H A   G  ++V+LL++      +   +  +  LH+A   G  + V+ L+ +   ++A     ++P++ A + G  EI +LL+            N   P+H+   EG  D+  +L++         K G  P+H+A + G + +AK+L+      + SAGK    P+H A    + ++  +L+ K  +  A  +  + P+H+A +K   +I   L++   +    V      P+H A + GH  +V +L+D+  +I    +     +H A +    N+A +L     D +A                           GA +N      + P+H A ++GH  I  +L+      NA   N    +  A   GYI +V  L
Sbjct:  223 LLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPL-LARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA-ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAAD-SAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-IVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 652          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 206.453 bits (524), Expect = 4.576e-54
Identity = 115/440 (26.14%), Postives = 220/440 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+E+V  L+    +++   +     +H A   GQAE+VK+L+ N  +      Q    PL++A  E H + VK L+++  + +   E   +P+  A ++GH ++  LL++         GK +   +H+   +       +L+  D N D+E+  K G  P+H+A   G++ +A +L++    ++ +A +    P+H A   G+  ++++L+ +   I+A+  +   P+H     G +++V ML+DR   I +    N   P+H A +  H   V++L+     ++    D    +H A   GH  +AK+L+D+K +  A A LN + P+H AC++    + +LL+     + A  E+   PI  A+  G++ IV  L++     +  +      LH A   G  E+V+ L Q G  +EA  +++ +P+ ++
Sbjct:   72 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKAAALLLQNDNNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKA-LNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHIS 500          

HSP 2 Score: 204.912 bits (520), Expect = 1.481e-53
Identity = 111/485 (22.89%), Postives = 220/485 (45.36%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID-------------NKIDFEIFGGQWN--------QCP-----------LHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            L N+    ++  R D   +H+A   G+  +VK L+D    I+ +      P+H     G  ++V++L+D             + +     G   N          P           LH+A   GH    K+L++   N NA      +P++ ACK+  +++ +LL+     IQ    ++   PIH+  F GH +IV  L+       T +  G+  +H+A  +G   + + L+     +EA A K  + P+H +   G  +I++ L+ +  +  A     + P+HL+  +G +++   L+D    + +      + P+H A K+G   +  +L+ +    +A  +    P+H A    ++ +A LL+D+     A A  N + P+H A ++   DIA  L++   D NA        +  A++ G++++V +L+ +  +++  ++    PLH A +     + ++L   G  ++A T+  Y+P+
Sbjct:  248 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV-TESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA-KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 728          

HSP 3 Score: 201.83 bits (512), Expect = 1.545e-52
Identity = 111/471 (23.57%), Postives = 212/471 (45.01%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRP---------------------------------IHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H     GH ++V+ L+D    I  + +    P+H A +      V+LL+ + +  +     +    LH+A   GH    K+L++   N NA      +P++ ACK+  +++ +LL+     IQ    ++   PIH+  F GH +IV  L+       T +  G+  +H+A  +G   + + L+     +EA A K  + P+H +   G  +I++ L+ +  +  A     + P+HL+  +G +++   L+D    + +      + P+H A K+G   +  +L+ +    +A  +    P+H A    ++ +A LL+D+     A A  N + P                                 +H A + GH D+  LL+ R  +VN   ++   P+  A++   + + ++L+NQ   +DA  +  + PLH  C  G+ +IV  L Q    + A T+  Y+P+  A
Sbjct:  299 LHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVT-ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA-KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQA 764          

HSP 4 Score: 199.904 bits (507), Expect = 5.165e-52
Identity = 104/428 (24.30%), Postives = 203/428 (47.43%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALT 1516
            +H+A   GH ++ K L+D   +   +      P+H AC+K + ++++LL+ +    +    +    P+H+A + GH + V  L+    + N  +    + ++ A + G  E+ + L+     ++    K+ + P+H+    G ADIV+ L+ +          G  P+HL+   GH  +A  L+D    +  +  KK   P+H A   G +E+  +L+ K+ + +A  +    P+H+A    ++++  +L+D+     A    N Y P+H A K     I   L++   D  A        +H A + GH ++  LL+ R  ++   +  +   P+H A +    ++A++LV++   V+A  +  + P+      G I+IV  L+     ++A  +  + PLH A ++GHT I+ +L Q       LT
Sbjct:  365 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVT-ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEA-KAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITT-KKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAA-KNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNL-SNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELT 787          

HSP 5 Score: 199.904 bits (507), Expect = 5.698e-52
Identity = 117/476 (24.58%), Postives = 219/476 (46.01%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNC--------------------------NINACDEVNRS---PIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +K    +H+A   G  E+VK L+ +  ++  + +    P++ A ++   E+VK L+DN    +    +    PL +A  +GH   V +L+E++                           N N  D  ++S   P++ A   G++ +A LL+++   +  F  +N   P+H+    G+A++VK+L+D    I+   +DG  P+H    +GH  + ++L+D    I  S  K    P+H A  G H+  +++L+  N  ++    +    +H+A   G  ++ ++L+D+K +  A   +N + P+H ACK     ++ +L+     I+A  E    PIH A   GH NI   L+       A     N R    +H A   G  ++ + LV     V A  ++D  P+  ++  G  +IV+ L+ Q    +A     + PLH +   GH ++   L   G  +   T++ ++P+ +A
Sbjct:   99 KKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS-QSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD-FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAK-ALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG----ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVA 566          

HSP 6 Score: 178.718 bits (452), Expect = 3.472e-45
Identity = 101/402 (25.12%), Postives = 194/402 (48.26%), Query Frame = 2
Query:  341 ACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G  E     I N +D  I   Q     LHLA  EGH + V  L++   N++A  +   + ++ A   G  E+ K+L+    ++     +N   P++M   E H ++VK L+D         +DG  P+ +A + GH  +  +L++ +     + GK     +H A      +   +L+  + N + E +  + P+H+A   G+  +  +L++R   ++     N+  P+H A K G+  +V++L+DR   I+A   D   P+H     GH  + ++L+DR   I +    N   P+H A +  H +  +LL+     V+    +    +  A+  G+ ++ K+L+++K + +A     + PLH AC++   ++++LL + G  I+A+T    +P+ +A
Sbjct:   42 AARAGHLEKALDYIKNGVDINICN-QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEND-----TKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD-FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTK-NGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA 434          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 203.756 bits (517), Expect = 1.422e-53
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--DQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D + D   R      P+H AC+K + ++V+LL+  +   E    +    PLH+A + G  + V  L++   N +       +P++ A +    ++ ++LI    + D Q    +  + P+H+    G+ DIV +L+    +     +D   P+H+A + G   +A IL+D N D +    KK   P+H A   G++E++ +L+ +   ++ E +    P+H+A    + ++  +L++     +A    N Y P+H A K     I   L+  K D  A     + P+H + + GH+ I+ LLI+   D+ A A  N    +H   +  H  +A++L +   ++N+     + P+  A   G + +VK L+    D+    R  + PLH A ++GH   V+ L + G      T    +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAA-AKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 202.216 bits (513), Expect = 4.237e-53
Identity = 123/452 (27.21%), Postives = 209/452 (46.24%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI--DNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            Y  R +   +H+A  +G   +   L+     I+ R +    P+H A   G  ++V LL+     I  +   G     PLH+A    H D  + L+     ++       +P++ A   GHV +AKLL+D+  D       N   P+H+ C +    +V++L+     IE   + G  P+H+A   G + I   L+    N D+E   G+    P+H A      +++ VLI     ++A+  E   P+H+A   G+ +IV +L+    +  A    +NY P+H A K G   +  +L+D   D     +  + P+H A + G+  + +LL++R    DIE   G N   P+H A    +  +A LL++      A  +N + P+  A+++  +EI   L+  K D +A  R  + PLH + + GH EI  LL + G D+ A      + M L
Sbjct:  255 YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG---LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL 695          

HSP 3 Score: 201.83 bits (512), Expect = 5.691e-53
Identity = 114/444 (25.68%), Postives = 214/444 (48.20%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKID--FEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR--KCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H++  + L+ H   ++        P+H A   G   + KLL+D   D       G     PLH+AC +     V++L++    I A  E   +P++ A   G + I   L+ Q    D++   G+    P+H+       D+V++LI     ++   ++ + P+H+A   G+  I  +L+    +  A+  + +  P+H A   G  E+  +L+  N +     ++ + P+HLA + G+ E+VR+L++R    DIE   G N   P+H A  + ++ +  +L++     +A  ++ + P+H A ++    IA  L+  K D  A +    + P+H + + GHK+I+ LL++   DV A   N    +   ++  ++ + +IL N   +I++     + PLH AC  G   +VK L + G D+   TR  Y+P+  A
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF---TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS-RAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 4 Score: 194.512 bits (493), Expect = 1.270e-50
Identity = 121/471 (25.69%), Postives = 214/471 (45.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYI---------------------------------EIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH E+V+ LI     ++         +H A   GQ+ IV +L++N  +  +        PL++A  E H++ VK L++   N     E   +P+  A ++GH  +  +L++         GK +   +H+   +       +L+    + +   K G  P+H+A   GH  + ++L++   ++   A + +  P+H A   G   +  +L+S+   I++  ++   P+H A   G  ++V +L+ +   I A    N   P+H A +  H    R L+  +  ++    D   P+H A   GH  +AKLL+DR  D  + A LN + P+H AC++    + +LL+  +  + A  E+   P+  A+  G I                                 ++V++LI     +DA  R    PLH A   G+T+IV LL QAG +  A TR+ YSP+ +A
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGF-TPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA-RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIA 531          

HSP 5 Score: 189.119 bits (479), Expect = 6.579e-49
Identity = 117/449 (26.06%), Postives = 212/449 (47.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+  +HN D+  +  +   P+H A   G   + +LL++   +   +  + N  PLH+A   G  +   +L+     I++  +   +P++ A + GH ++  LL+ Q   I     KN   P+HM     H D  + L+     ++    D   P+H+A   GHV +AK+L+D + D  + A      P+H AC    ++++E+L+     IEA  E    P+H+A   G   IV  L+ +    D+E   G     P+H A +     +VR+L+     ++A   +   P+H A   G+ +I  LL      ++AGA  N     N+ P+H A + G +++A +L+D   D     +  + P+  AS+ G +E+V++L+ +   +D   + Q  PLH A    + ++  LL + G   +A  +  Y+P+ +A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFT--PLHIAAHYGHENVGQLLLEKGANVN-YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL------LQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 181.03 bits (458), Expect = 2.781e-46
Identity = 99/386 (25.65%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+    + ++       P+H A    Q ++V++LI N  K+D +    +  Q PLH+A   G+ D V +L+++  N NA    N SP++ A K G  E+A +L+D   D  +   K    P+H+    G+ ++V++L++    ++   K+   P+H+A    +  +A +L++     +A+A K    P+H A     +EI   L+    +  A+    + P+HL+ ++G KEI  +LI+   D+ A    N    +H   +  H  + ++L +   +I +     + P+H AC  G  N+ K L++   D+       ++ P+H A ++GH +  + L++     N        P+  A   GY+ +V+ L
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT-PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV-GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 129.413 bits (324), Expect = 3.657e-30
Identity = 81/365 (22.19%), Postives = 160/365 (43.84%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEAC------------VGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G +E    L+    DI      N  + +H+   EGH+++V+ LI     ++   + G   +H+A   G   I  IL++   N ++++  G     P++ A    H E+++ L+    N     E+ + P+ +A ++G   +V +L++                +K D  A                + + P+H A  +GH  + ++L+++  ++      N  P+H A + G  N+A LL+ R   I++    +   P+H A   GH  +  LLV +   ++A  +N   P+  A++  +++  + L+  +  +D        PLH A   GH  + KLL     D  +     ++P+ +A
Sbjct:   40 AARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 8 Score: 105.916 bits (263), Expect = 7.646e-23
Identity = 64/263 (24.33%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGK--NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR---RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            L +K    +HLA  +G+LE+V+ L++    ++I  + +  P+H A      ++  LL++N    +    +    PLH+A  +   +    L++   + NA      +P++ + + GH EI+ LLI+   D+   G K  N    +H+   E H  + ++L +   +I +    G  P+H+AC  G + + K L++   D+    G+K+R    P+H A   GH   +  L+    +   +      P+ +A   G   +V  L
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 203.756 bits (517), Expect = 1.422e-53
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--DQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D + D   R      P+H AC+K + ++V+LL+  +   E    +    PLH+A + G  + V  L++   N +       +P++ A +    ++ ++LI    + D Q    +  + P+H+    G+ DIV +L+    +     +D   P+H+A + G   +A IL+D N D +    KK   P+H A   G++E++ +L+ +   ++ E +    P+H+A    + ++  +L++     +A    N Y P+H A K     I   L+  K D  A     + P+H + + GH+ I+ LLI+   D+ A A  N    +H   +  H  +A++L +   ++N+     + P+  A   G + +VK L+    D+    R  + PLH A ++GH   V+ L + G      T    +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAA-AKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 202.216 bits (513), Expect = 4.237e-53
Identity = 123/452 (27.21%), Postives = 209/452 (46.24%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI--DNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            Y  R +   +H+A  +G   +   L+     I+ R +    P+H A   G  ++V LL+     I  +   G     PLH+A    H D  + L+     ++       +P++ A   GHV +AKLL+D+  D       N   P+H+ C +    +V++L+     IE   + G  P+H+A   G + I   L+    N D+E   G+    P+H A      +++ VLI     ++A+  E   P+H+A   G+ +IV +L+    +  A    +NY P+H A K G   +  +L+D   D     +  + P+H A + G+  + +LL++R    DIE   G N   P+H A    +  +A LL++      A  +N + P+  A+++  +EI   L+  K D +A  R  + PLH + + GH EI  LL + G D+ A      + M L
Sbjct:  255 YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG---LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL 695          

HSP 3 Score: 201.83 bits (512), Expect = 5.691e-53
Identity = 114/444 (25.68%), Postives = 214/444 (48.20%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKID--FEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR--KCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H++  + L+ H   ++        P+H A   G   + KLL+D   D       G     PLH+AC +     V++L++    I A  E   +P++ A   G + I   L+ Q    D++   G+    P+H+       D+V++LI     ++   ++ + P+H+A   G+  I  +L+    +  A+  + +  P+H A   G  E+  +L+  N +     ++ + P+HLA + G+ E+VR+L++R    DIE   G N   P+H A  + ++ +  +L++     +A  ++ + P+H A ++    IA  L+  K D  A +    + P+H + + GHK+I+ LL++   DV A   N    +   ++  ++ + +IL N   +I++     + PLH AC  G   +VK L + G D+   TR  Y+P+  A
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF---TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS-RAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 4 Score: 194.512 bits (493), Expect = 1.270e-50
Identity = 121/471 (25.69%), Postives = 214/471 (45.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYI---------------------------------EIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH E+V+ LI     ++         +H A   GQ+ IV +L++N  +  +        PL++A  E H++ VK L++   N     E   +P+  A ++GH  +  +L++         GK +   +H+   +       +L+    + +   K G  P+H+A   GH  + ++L++   ++   A + +  P+H A   G   +  +L+S+   I++  ++   P+H A   G  ++V +L+ +   I A    N   P+H A +  H    R L+  +  ++    D   P+H A   GH  +AKLL+DR  D  + A LN + P+H AC++    + +LL+  +  + A  E+   P+  A+  G I                                 ++V++LI     +DA  R    PLH A   G+T+IV LL QAG +  A TR+ YSP+ +A
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGF-TPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA-RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIA 531          

HSP 5 Score: 189.119 bits (479), Expect = 6.579e-49
Identity = 117/449 (26.06%), Postives = 212/449 (47.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+  +HN D+  +  +   P+H A   G   + +LL++   +   +  + N  PLH+A   G  +   +L+     I++  +   +P++ A + GH ++  LL+ Q   I     KN   P+HM     H D  + L+     ++    D   P+H+A   GHV +AK+L+D + D  + A      P+H AC    ++++E+L+     IEA  E    P+H+A   G   IV  L+ +    D+E   G     P+H A +     +VR+L+     ++A   +   P+H A   G+ +I  LL      ++AGA  N     N+ P+H A + G +++A +L+D   D     +  + P+  AS+ G +E+V++L+ +   +D   + Q  PLH A    + ++  LL + G   +A  +  Y+P+ +A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFT--PLHIAAHYGHENVGQLLLEKGANVN-YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL------LQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 181.03 bits (458), Expect = 2.781e-46
Identity = 99/386 (25.65%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+    + ++       P+H A    Q ++V++LI N  K+D +    +  Q PLH+A   G+ D V +L+++  N NA    N SP++ A K G  E+A +L+D   D  +   K    P+H+    G+ ++V++L++    ++   K+   P+H+A    +  +A +L++     +A+A K    P+H A     +EI   L+    +  A+    + P+HL+ ++G KEI  +LI+   D+ A    N    +H   +  H  + ++L +   +I +     + P+H AC  G  N+ K L++   D+       ++ P+H A ++GH +  + L++     N        P+  A   GY+ +V+ L
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT-PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV-GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 129.413 bits (324), Expect = 3.657e-30
Identity = 81/365 (22.19%), Postives = 160/365 (43.84%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEAC------------VGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G +E    L+    DI      N  + +H+   EGH+++V+ LI     ++   + G   +H+A   G   I  IL++   N ++++  G     P++ A    H E+++ L+    N     E+ + P+ +A ++G   +V +L++                +K D  A                + + P+H A  +GH  + ++L+++  ++      N  P+H A + G  N+A LL+ R   I++    +   P+H A   GH  +  LLV +   ++A  +N   P+  A++  +++  + L+  +  +D        PLH A   GH  + KLL     D  +     ++P+ +A
Sbjct:   40 AARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 8 Score: 105.916 bits (263), Expect = 7.646e-23
Identity = 64/263 (24.33%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGK--NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR---RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            L +K    +HLA  +G+LE+V+ L++    ++I  + +  P+H A      ++  LL++N    +    +    PLH+A  +   +    L++   + NA      +P++ + + GH EI+ LLI+   D+   G K  N    +H+   E H  + ++L +   +I +    G  P+H+AC  G + + K L++   D+    G+K+R    P+H A   GH   +  L+    +   +      P+ +A   G   +V  L
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 203.371 bits (516), Expect = 1.487e-53
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--DQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D + D   R      P+H AC+K + ++V+LL+  +   E    +    PLH+A + G  + V  L++   N +       +P++ A +    ++ ++LI    + D Q    +  + P+H+    G+ DIV +L+    +     +D   P+H+A + G   +A IL+D N D +    KK   P+H A   G++E++ +L+ +   ++ E +    P+H+A    + ++  +L++     +A    N Y P+H A K     I   L+  K D  A     + P+H + + GH+ I+ LLI+   D+ A A  N    +H   +  H  +A++L +   ++N+     + P+  A   G + +VK L+    D+    R  + PLH A ++GH   V+ L + G      T    +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAA-AKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 201.83 bits (512), Expect = 4.758e-53
Identity = 123/452 (27.21%), Postives = 209/452 (46.24%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI--DNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            Y  R +   +H+A  +G   +   L+     I+ R +    P+H A   G  ++V LL+     I  +   G     PLH+A    H D  + L+     ++       +P++ A   GHV +AKLL+D+  D       N   P+H+ C +    +V++L+     IE   + G  P+H+A   G + I   L+    N D+E   G+    P+H A      +++ VLI     ++A+  E   P+H+A   G+ +IV +L+    +  A    +NY P+H A K G   +  +L+D   D     +  + P+H A + G+  + +LL++R    DIE   G N   P+H A    +  +A LL++      A  +N + P+  A+++  +EI   L+  K D +A  R  + PLH + + GH EI  LL + G D+ A      + M L
Sbjct:  255 YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG---LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL 695          

HSP 3 Score: 201.83 bits (512), Expect = 5.898e-53
Identity = 114/444 (25.68%), Postives = 214/444 (48.20%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKID--FEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR--KCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H++  + L+ H   ++        P+H A   G   + KLL+D   D       G     PLH+AC +     V++L++    I A  E   +P++ A   G + I   L+ Q    D++   G+    P+H+       D+V++LI     ++   ++ + P+H+A   G+  I  +L+    +  A+  + +  P+H A   G  E+  +L+  N +     ++ + P+HLA + G+ E+VR+L++R    DIE   G N   P+H A  + ++ +  +L++     +A  ++ + P+H A ++    IA  L+  K D  A +    + P+H + + GHK+I+ LL++   DV A   N    +   ++  ++ + +IL N   +I++     + PLH AC  G   +VK L + G D+   TR  Y+P+  A
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF---TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG-FTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 4 Score: 194.512 bits (493), Expect = 1.305e-50
Identity = 121/471 (25.69%), Postives = 214/471 (45.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYI---------------------------------EIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH E+V+ LI     ++         +H A   GQ+ IV +L++N  +  +        PL++A  E H++ VK L++   N     E   +P+  A ++GH  +  +L++         GK +   +H+   +       +L+    + +   K G  P+H+A   GH  + ++L++   ++   A + +  P+H A   G   +  +L+S+   I++  ++   P+H A   G  ++V +L+ +   I A    N   P+H A +  H    R L+  +  ++    D   P+H A   GH  +AKLL+DR  D  + A LN + P+H AC++    + +LL+  +  + A  E+   P+  A+  G I                                 ++V++LI     +DA  R    PLH A   G+T+IV LL QAG +  A TR+ YSP+ +A
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGF-TPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA-RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIA 531          

HSP 5 Score: 189.119 bits (479), Expect = 6.075e-49
Identity = 117/449 (26.06%), Postives = 212/449 (47.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+  +HN D+  +  +   P+H A   G   + +LL++   +   +  + N  PLH+A   G  +   +L+     I++  +   +P++ A + GH ++  LL+ Q   I     KN   P+HM     H D  + L+     ++    D   P+H+A   GHV +AK+L+D + D  + A      P+H AC    ++++E+L+     IEA  E    P+H+A   G   IV  L+ +    D+E   G     P+H A +     +VR+L+     ++A   +   P+H A   G+ +I  LL      ++AGA  N     N+ P+H A + G +++A +L+D   D     +  + P+  AS+ G +E+V++L+ +   +D   + Q  PLH A    + ++  LL + G   +A  +  Y+P+ +A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFT--PLHIAAHYGHENVGQLLLEKGANVN-YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL------LQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 180.644 bits (457), Expect = 3.012e-46
Identity = 99/386 (25.65%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+    + ++       P+H A    Q ++V++LI N  K+D +    +  Q PLH+A   G+ D V +L+++  N NA    N SP++ A K G  E+A +L+D   D  +   K    P+H+    G+ ++V++L++    ++   K+   P+H+A    +  +A +L++     +A+A K    P+H A     +EI   L+    +  A+    + P+HL+ ++G KEI  +LI+   D+ A    N    +H   +  H  + ++L +   +I +     + P+H AC  G  N+ K L++   D+       ++ P+H A ++GH +  + L++     N        P+  A   GY+ +V+ L
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT-PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV-GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 129.413 bits (324), Expect = 3.482e-30
Identity = 81/365 (22.19%), Postives = 161/365 (44.11%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEACVGM------------NNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G +E    L+    DI      N  + +H+   EGH+++V+ LI     ++   + G   +H+A   G   I  IL++   N ++++  G     P++ A    H E+++ L+    N     E+ + P+ +A ++G   +V +L++                +K D  A   +            + + P+H A  +GH  + ++L+++  ++      N  P+H A + G  N+A LL+ R   I++    +   P+H A   GH  +  LLV +   ++A  +N   P+  A++  +++  + L+  +  +D        PLH A   GH  + KLL     D  +     ++P+ +A
Sbjct:   40 AARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 8 Score: 105.531 bits (262), Expect = 8.724e-23
Identity = 64/263 (24.33%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGK--NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR---RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            L +K    +HLA  +G+LE+V+ L++    ++I  + +  P+H A      ++  LL++N    +    +    PLH+A  +   +    L++   + NA      +P++ + + GH EI+ LLI+   D+   G K  N    +H+   E H  + ++L +   +I +    G  P+H+AC  G + + K L++   D+    G+K+R    P+H A   GH   +  L+    +   +      P+ +A   G   +V  L
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 203.371 bits (516), Expect = 1.487e-53
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--DQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D + D   R      P+H AC+K + ++V+LL+  +   E    +    PLH+A + G  + V  L++   N +       +P++ A +    ++ ++LI    + D Q    +  + P+H+    G+ DIV +L+    +     +D   P+H+A + G   +A IL+D N D +    KK   P+H A   G++E++ +L+ +   ++ E +    P+H+A    + ++  +L++     +A    N Y P+H A K     I   L+  K D  A     + P+H + + GH+ I+ LLI+   D+ A A  N    +H   +  H  +A++L +   ++N+     + P+  A   G + +VK L+    D+    R  + PLH A ++GH   V+ L + G      T    +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAA-AKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 201.83 bits (512), Expect = 4.758e-53
Identity = 123/452 (27.21%), Postives = 209/452 (46.24%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI--DNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            Y  R +   +H+A  +G   +   L+     I+ R +    P+H A   G  ++V LL+     I  +   G     PLH+A    H D  + L+     ++       +P++ A   GHV +AKLL+D+  D       N   P+H+ C +    +V++L+     IE   + G  P+H+A   G + I   L+    N D+E   G+    P+H A      +++ VLI     ++A+  E   P+H+A   G+ +IV +L+    +  A    +NY P+H A K G   +  +L+D   D     +  + P+H A + G+  + +LL++R    DIE   G N   P+H A    +  +A LL++      A  +N + P+  A+++  +EI   L+  K D +A  R  + PLH + + GH EI  LL + G D+ A      + M L
Sbjct:  255 YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG---LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL 695          

HSP 3 Score: 201.83 bits (512), Expect = 5.898e-53
Identity = 114/444 (25.68%), Postives = 214/444 (48.20%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKID--FEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR--KCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H++  + L+ H   ++        P+H A   G   + KLL+D   D       G     PLH+AC +     V++L++    I A  E   +P++ A   G + I   L+ Q    D++   G+    P+H+       D+V++LI     ++   ++ + P+H+A   G+  I  +L+    +  A+  + +  P+H A   G  E+  +L+  N +     ++ + P+HLA + G+ E+VR+L++R    DIE   G N   P+H A  + ++ +  +L++     +A  ++ + P+H A ++    IA  L+  K D  A +    + P+H + + GHK+I+ LL++   DV A   N    +   ++  ++ + +IL N   +I++     + PLH AC  G   +VK L + G D+   TR  Y+P+  A
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF---TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG-FTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 4 Score: 194.512 bits (493), Expect = 1.305e-50
Identity = 121/471 (25.69%), Postives = 214/471 (45.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYI---------------------------------EIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH E+V+ LI     ++         +H A   GQ+ IV +L++N  +  +        PL++A  E H++ VK L++   N     E   +P+  A ++GH  +  +L++         GK +   +H+   +       +L+    + +   K G  P+H+A   GH  + ++L++   ++   A + +  P+H A   G   +  +L+S+   I++  ++   P+H A   G  ++V +L+ +   I A    N   P+H A +  H    R L+  +  ++    D   P+H A   GH  +AKLL+DR  D  + A LN + P+H AC++    + +LL+  +  + A  E+   P+  A+  G I                                 ++V++LI     +DA  R    PLH A   G+T+IV LL QAG +  A TR+ YSP+ +A
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGF-TPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA-RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIA 531          

HSP 5 Score: 189.119 bits (479), Expect = 6.075e-49
Identity = 117/449 (26.06%), Postives = 212/449 (47.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+  +HN D+  +  +   P+H A   G   + +LL++   +   +  + N  PLH+A   G  +   +L+     I++  +   +P++ A + GH ++  LL+ Q   I     KN   P+HM     H D  + L+     ++    D   P+H+A   GHV +AK+L+D + D  + A      P+H AC    ++++E+L+     IEA  E    P+H+A   G   IV  L+ +    D+E   G     P+H A +     +VR+L+     ++A   +   P+H A   G+ +I  LL      ++AGA  N     N+ P+H A + G +++A +L+D   D     +  + P+  AS+ G +E+V++L+ +   +D   + Q  PLH A    + ++  LL + G   +A  +  Y+P+ +A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFT--PLHIAAHYGHENVGQLLLEKGANVN-YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL------LQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 180.644 bits (457), Expect = 3.012e-46
Identity = 99/386 (25.65%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+    + ++       P+H A    Q ++V++LI N  K+D +    +  Q PLH+A   G+ D V +L+++  N NA    N SP++ A K G  E+A +L+D   D  +   K    P+H+    G+ ++V++L++    ++   K+   P+H+A    +  +A +L++     +A+A K    P+H A     +EI   L+    +  A+    + P+HL+ ++G KEI  +LI+   D+ A    N    +H   +  H  + ++L +   +I +     + P+H AC  G  N+ K L++   D+       ++ P+H A ++GH +  + L++     N        P+  A   GY+ +V+ L
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT-PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV-GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 129.413 bits (324), Expect = 3.482e-30
Identity = 81/365 (22.19%), Postives = 161/365 (44.11%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEACVGM------------NNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G +E    L+    DI      N  + +H+   EGH+++V+ LI     ++   + G   +H+A   G   I  IL++   N ++++  G     P++ A    H E+++ L+    N     E+ + P+ +A ++G   +V +L++                +K D  A   +            + + P+H A  +GH  + ++L+++  ++      N  P+H A + G  N+A LL+ R   I++    +   P+H A   GH  +  LLV +   ++A  +N   P+  A++  +++  + L+  +  +D        PLH A   GH  + KLL     D  +     ++P+ +A
Sbjct:   40 AARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 8 Score: 105.531 bits (262), Expect = 8.724e-23
Identity = 64/263 (24.33%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGK--NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR---RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            L +K    +HLA  +G+LE+V+ L++    ++I  + +  P+H A      ++  LL++N    +    +    PLH+A  +   +    L++   + NA      +P++ + + GH EI+ LLI+   D+   G K  N    +H+   E H  + ++L +   +I +    G  P+H+AC  G + + K L++   D+    G+K+R    P+H A   GH   +  L+    +   +      P+ +A   G   +V  L
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 202.986 bits (515), Expect = 1.980e-53
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--DQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D + D   R      P+H AC+K + ++V+LL+  +   E    +    PLH+A + G  + V  L++   N +       +P++ A +    ++ ++LI    + D Q    +  + P+H+    G+ DIV +L+    +     +D   P+H+A + G   +A IL+D N D +    KK   P+H A   G++E++ +L+ +   ++ E +    P+H+A    + ++  +L++     +A    N Y P+H A K     I   L+  K D  A     + P+H + + GH+ I+ LLI+   D+ A A  N    +H   +  H  +A++L +   ++N+     + P+  A   G + +VK L+    D+    R  + PLH A ++GH   V+ L + G      T    +P+ +A
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT-ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAA-AKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 201.83 bits (512), Expect = 5.442e-53
Identity = 123/452 (27.21%), Postives = 209/452 (46.24%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI--DNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            Y  R +   +H+A  +G   +   L+     I+ R +    P+H A   G  ++V LL+     I  +   G     PLH+A    H D  + L+     ++       +P++ A   GHV +AKLL+D+  D       N   P+H+ C +    +V++L+     IE   + G  P+H+A   G + I   L+    N D+E   G+    P+H A      +++ VLI     ++A+  E   P+H+A   G+ +IV +L+    +  A    +NY P+H A K G   +  +L+D   D     +  + P+H A + G+  + +LL++R    DIE   G N   P+H A    +  +A LL++      A  +N + P+  A+++  +EI   L+  K D +A  R  + PLH + + GH EI  LL + G D+ A      + M L
Sbjct:  255 YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNG---LAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR-ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHL 695          

HSP 3 Score: 201.445 bits (511), Expect = 7.375e-53
Identity = 114/444 (25.68%), Postives = 214/444 (48.20%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKID--FEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR--KCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H++  + L+ H   ++        P+H A   G   + KLL+D   D       G     PLH+AC +     V++L++    I A  E   +P++ A   G + I   L+ Q    D++   G+    P+H+       D+V++LI     ++   ++ + P+H+A   G+  I  +L+    +  A+  + +  P+H A   G  E+  +L+  N +     ++ + P+HLA + G+ E+VR+L++R    DIE   G N   P+H A  + ++ +  +L++     +A  ++ + P+H A ++    IA  L+  K D  A +    + P+H + + GHK+I+ LL++   DV A   N    +   ++  ++ + +IL N   +I++     + PLH AC  G   +VK L + G D+   TR  Y+P+  A
Sbjct:  330 LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGF---TPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT-RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE---GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS-RAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQA 762          

HSP 4 Score: 194.126 bits (492), Expect = 1.572e-50
Identity = 121/471 (25.69%), Postives = 214/471 (45.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYI---------------------------------EIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH E+V+ LI     ++         +H A   GQ+ IV +L++N  +  +        PL++A  E H++ VK L++   N     E   +P+  A ++GH  +  +L++         GK +   +H+   +       +L+    + +   K G  P+H+A   GH  + ++L++   ++   A + +  P+H A   G   +  +L+S+   I++  ++   P+H A   G  ++V +L+ +   I A    N   P+H A +  H    R L+  +  ++    D   P+H A   GH  +AKLL+DR  D  + A LN + P+H AC++    + +LL+  +  + A  E+   P+  A+  G I                                 ++V++LI     +DA  R    PLH A   G+T+IV LL QAG +  A TR+ YSP+ +A
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGF-TPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSK-----GKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA-RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIA 531          

HSP 5 Score: 188.734 bits (478), Expect = 9.296e-49
Identity = 117/449 (26.06%), Postives = 212/449 (47.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+  +HN D+  +  +   P+H A   G   + +LL++   +   +  + N  PLH+A   G  +   +L+     I++  +   +P++ A + GH ++  LL+ Q   I     KN   P+HM     H D  + L+     ++    D   P+H+A   GHV +AK+L+D + D  + A      P+H AC    ++++E+L+     IEA  E    P+H+A   G   IV  L+ +    D+E   G     P+H A +     +VR+L+     ++A   +   P+H A   G+ +I  LL      ++AGA  N     N+ P+H A + G +++A +L+D   D     +  + P+  AS+ G +E+V++L+ +   +D   + Q  PLH A    + ++  LL + G   +A  +  Y+P+ +A
Sbjct:  196 PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFT--PLHIAAHYGHENVGQLLLEKGANVN-YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISA-KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET---PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL------LQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 6 Score: 180.644 bits (457), Expect = 3.435e-46
Identity = 99/386 (25.65%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+    + ++       P+H A    Q ++V++LI N  K+D +    +  Q PLH+A   G+ D V +L+++  N NA    N SP++ A K G  E+A +L+D   D  +   K    P+H+    G+ ++V++L++    ++   K+   P+H+A    +  +A +L++     +A+A K    P+H A     +EI   L+    +  A+    + P+HL+ ++G KEI  +LI+   D+ A    N    +H   +  H  + ++L +   +I +     + P+H AC  G  N+ K L++   D+       ++ P+H A ++GH +  + L++     N        P+  A   GY+ +V+ L
Sbjct:  429 LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ---ARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFT-PLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV-GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 129.413 bits (324), Expect = 4.481e-30
Identity = 81/365 (22.19%), Postives = 160/365 (43.84%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEAC------------VGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G +E    L+    DI      N  + +H+   EGH+++V+ LI     ++   + G   +H+A   G   I  IL++   N ++++  G     P++ A    H E+++ L+    N     E+ + P+ +A ++G   +V +L++                +K D  A                + + P+H A  +GH  + ++L+++  ++      N  P+H A + G  N+A LL+ R   I++    +   P+H A   GH  +  LLV +   ++A  +N   P+  A++  +++  + L+  +  +D        PLH A   GH  + KLL     D  +     ++P+ +A
Sbjct:   40 AARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT---PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTK-DLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIA 399          

HSP 8 Score: 105.531 bits (262), Expect = 1.000e-22
Identity = 64/263 (24.33%), Postives = 122/263 (46.39%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGK--NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR---RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            L +K    +HLA  +G+LE+V+ L++    ++I  + +  P+H A      ++  LL++N    +    +    PLH+A  +   +    L++   + NA      +P++ + + GH EI+ LLI+   D+   G K  N    +H+   E H  + ++L +   +I +    G  P+H+AC  G + + K L++   D+    G+K+R    P+H A   GH   +  L+    +   +      P+ +A   G   +V  L
Sbjct:  553 LTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA-AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV---GAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 207.608 bits (527), Expect = 1.688e-57
Identity = 121/438 (27.63%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+ +V  L+     ++   +     +H A   GQ E+VKLL+++     +   Q    PL++A  E H   V++L+ +  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+D + + +   K G  P+H+A   G+  IA +LI    D+  SA K +  P+H A   G   ++ +L+ K  NIEA+  +   P+H A   G +++V ML++R   I A    N   P+H A +  H    R+L+  +  ++    D    +H A   GH  +AKLL+DR  D  A A LN + P+H AC++    + +LL+     ++A  E+   P+  A+  G + IV  L+      D        PLH A     T+I+++L + G  ++A  RE+ +P+ +A
Sbjct:   48 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR-----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA-KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 2 Score: 178.333 bits (451), Expect = 2.437e-47
Identity = 104/403 (25.81%), Postives = 190/403 (47.15%), Query Frame = 2
Query:  341 ACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRP-IHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G  E V   + N ID            LHLA  +GH   V  L+     +++  +   + ++ A   G  E+ KLL++    + V   +N   P++M   E H  +V++L+    +     +DG  P+ +A + GH  +  +L+      E+    K R P +H A     V+   +L+  + N +   +  + P+H+A   G++ I  +LI +  D+      +N  P+H A KWG   +V +L+++  +IEA   D   P+H A   GH  +  +L++R   I A    N   P+H A +  H D A++L+  +  V+    +    +  A+  G++ + K+L+++  D +A     + PLH AC++   ++V+LL + G  I A T    +P+ +A
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNA-LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL------ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTK-NGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 410          

HSP 3 Score: 132.494 bits (332), Expect = 6.119e-32
Identity = 88/360 (24.44%), Postives = 153/360 (42.50%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLID--HNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIH---------------------------------LACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD 1201
            P +H+A     ++    L+D  HN D+  +  +   P+H A   G   I  LLI    D   +  + N  PLH+A   G  + V +L+E   NI A      +P++ A + GH ++  +L+++   I     KN   P+HM     H D  ++L+     ++    D    +H+A   GHV +AK+L+D N D  A A      P+H AC    ++++E+L+    +I A  E    P+H                                 LA      +I+R+L+     ++A        P+H A + G+  IV +L+     ++A  +D +  +H A + G   +  L+  +  D
Sbjct:  174 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT--PLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISA-KTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKITD 527          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 206.453 bits (524), Expect = 4.231e-56
Identity = 121/438 (27.63%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+ +V  L+     ++   +     +H A   GQ E+VKLL+++     +   Q    PL++A  E H   V++L+ +  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+D + + +   K G  P+H+A   G+  IA +LI    D+  SA K +  P+H A   G   ++ +L+ K  NIEA+  +   P+H A   G +++V ML++R   I A    N   P+H A +  H    R+L+  +  ++    D    +H A   GH  +AKLL+DR  D  A A LN + P+H AC++    + +LL+     ++A  E+   P+  A+  G + IV  L+      D        PLH A     T+I+++L + G  ++A  RE+ +P+ +A
Sbjct:  198 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR-----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA-KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 626          

HSP 2 Score: 177.563 bits (449), Expect = 2.911e-46
Identity = 104/403 (25.81%), Postives = 190/403 (47.15%), Query Frame = 2
Query:  341 ACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRP-IHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G  E V   + N ID            LHLA  +GH   V  L+     +++  +   + ++ A   G  E+ KLL++    + V   +N   P++M   E H  +V++L+    +     +DG  P+ +A + GH  +  +L+      E+    K R P +H A     V+   +L+  + N +   +  + P+H+A   G++ I  +LI +  D+      +N  P+H A KWG   +V +L+++  +IEA   D   P+H A   GH  +  +L++R   I A    N   P+H A +  H D A++L+  +  V+    +    +  A+  G++ + K+L+++  D +A     + PLH AC++   ++V+LL + G  I A T    +P+ +A
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNA-LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL------ESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTK-NGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 560          

HSP 3 Score: 170.629 bits (431), Expect = 7.730e-44
Identity = 114/437 (26.09%), Postives = 209/437 (47.83%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE V   + +N+DI   +      +H A + G   +V  L+      +    + N   LH+A   G ++ VK+L+E N ++N   +   +P+Y A +  H  + +LL+    + Q    ++   P+ +   +GH  +V +L++     +T  K     +H+A +   V  A +L+D   N D+ + +G     P+H A   G+  I  +LI K  ++    + +  P+H+A + G   +V +L+++  +IEA    +   P+H A + GH  +V ML++R   I A  ++   P+H A +  H + A++L+  +  ++    ++    +H A   GH  +AKLL+DR  D NA   N + P+  A ++  +++V++L+     I A       PLH A   G   IV  L Q     +  T    +P+ LA
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTA-LHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT---PLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE-VTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA 593          

HSP 4 Score: 130.568 bits (327), Expect = 5.903e-31
Identity = 88/360 (24.44%), Postives = 153/360 (42.50%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLID--HNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIH---------------------------------LACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD 1201
            P +H+A     ++    L+D  HN D+  +  +   P+H A   G   I  LLI    D   +  + N  PLH+A   G  + V +L+E   NI A      +P++ A + GH ++  +L+++   I     KN   P+HM     H D  ++L+     ++    D    +H+A   GHV +AK+L+D N D  A A      P+H AC    ++++E+L+    +I A  E    P+H                                 LA      +I+R+L+     ++A        P+H A + G+  IV +L+     ++A  +D +  +H A + G   +  L+  +  D
Sbjct:  324 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT--PLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISA-KTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR-AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKITD 677          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 208.379 bits (529), Expect = 3.072e-55
Identity = 121/438 (27.63%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+ +V  L+     ++   +     +H A   GQ E+VKLL+++     +   Q    PL++A  E H   V++L+ +  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+D + + +   K G  P+H+A   G+  IA +LI    D+  SA K +  P+H A   G   ++ +L+ K  NIEA+  +   P+H A   G +++V ML++R   I A    N   P+H A +  H    R+L+  +  ++    D    +H A   GH  +AKLL+DR  D  A A LN + P+H AC++    + +LL+     ++A  E+   P+  A+  G + IV  L+      D        PLH A     T+I+++L + G  ++A  RE+ +P+ +A
Sbjct:   48 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR-----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA-KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 2 Score: 200.29 bits (508), Expect = 1.134e-52
Identity = 120/487 (24.64%), Postives = 220/487 (45.17%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNC-----------------------------NINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            EL  +  + +   +K    +H+A   G  E+VK L++HN  + ++ +    P++ A ++    +V+LL+ N  + +    +    PL +A  +GH   V +L+ES+                              N +   +   +P++ A   G+  IA LLI +  D+  +  K+   P+H+    G  ++V +L+++  +IE   +DG  P+H A  +GH  +  +L++    I A   K    P+H A  G HV+   +L+     ++    +    +H+A   G   + ++L+DR  D  A   +N + P+H ACK     +V +L+     I A  E    P+H A   G  NI   L+  D   D+    G     P+H A      DI ++L+     V+A       P+  AS  G ++IV +L+     +DA  +  +  LH A + G  E+  +L + G  ++A T++ ++P+ L
Sbjct:   62 ELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANAR-ALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRG---ETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHL 541          

HSP 3 Score: 198.364 bits (503), Expect = 4.989e-52
Identity = 104/438 (23.74%), Postives = 214/438 (48.86%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D N D   R      P+H AC+K + ++V+LL+ +         +    PLH+A + G  + V  L++ + + +       +P++ A +    +I ++L+     +     + ++ P+H+    G+ DIV +L+     ++   KD    +H+A + G   +A +LI+    ++A A KK   P+H     GH+++ ++L+ K  +++A+ +    P+H+AC   ++++  +L+++     A    N + P+H A +     I   L++      A  +  + P+H + + GH  I+ LLI+ K  +   A  N   P+H   +  + ++A++L     +++   +  + P+  AS  G   +V+ L+    ++DA     + PLH   ++GH  IV LL +   +  A T    +P+ +A
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT-AKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAK-NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 4 Score: 197.978 bits (502), Expect = 6.707e-52
Identity = 115/444 (25.90%), Postives = 212/444 (47.75%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLID--HNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A     ++    L+D  HN D+  +  +   P+H A   G   I  LLI    D   +  + N  PLH+A   G  + V +L+E   NI A      +P++ A + GH ++  +L+++   I     KN   P+HM     H D  ++L+     ++    D    +H+A   GHV +AK+L+D N D  A A      P+H AC    ++++E+L+    +I A  E    P+H+A   G   IV  L+  D   D+    G     P+H A +     I+R+L+     ++A   +   P+H A   G+ +I  LL+     ++A    + +  +H A + G  ++A +L++    ++A  +  + P+   ++ G+I++ ++L+ ++ D+DA  +    PLH AC   + ++  LL + G    A  +  ++P+ +A
Sbjct:  174 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT--PLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISA-KTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET---PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK-DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 608          

HSP 5 Score: 193.356 bits (490), Expect = 2.201e-50
Identity = 104/438 (23.74%), Postives = 219/438 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H A   GH ++V  L++    I  + +    P+H A +    +  ++L+ ++   +     +    LH+A   GH    K+L++ N + NA      +P++ ACK+  +++ +LL+     I     ++   P+H+  F G  +IV  L+  +   +     G+ P+HLA       I +IL+     ++A A ++ + P+H A   G+V+I+ +L+     ++A  ++ +  +H+A ++G  E+  +LI+    ++A      + P+H   K+GH  + ++L+ ++ D++A  ++   P+H AC   ++ +A LL+++     A A  N   P+H A  +   DIA  L++     NA  +  + P+  +S+ G+ EI  +LI  K  ++   +    P+H   +  +  + ++L + G +I+  T+  Y+P+ +A
Sbjct:  275 LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY-LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT-KKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAK-NGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 6 Score: 173.711 bits (439), Expect = 4.578e-44
Identity = 97/385 (25.19%), Postives = 187/385 (48.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRK-CDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+ H+   ++       P+H A    Q +I+++L+ N    +    +  Q PLH+A   G+ D V +L++    ++A  +   + ++ A K G  E+A +LI+    +     K    P+H+    GH  + ++L+ +  D++   K+G  P+H+AC   +  +A +L++      A+A K    P+H A     ++I   L+       AE +  + P+HL+ ++G  EI  +LI+ K  +      N   P+H  C    NV V  ++++   +I+   +  + P+H A   G  N+ + L+    +++A   +  + P+H   ++GH  I  LL++ K + NA   N   P+  A + GYI ++  L
Sbjct:  407 LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATA-KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHP-AKNGLTPMHL-CAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 145.206 bits (365), Expect = 4.879e-35
Identity = 82/331 (24.77%), Postives = 156/331 (47.13%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNI 1171
            L N   +D     +  PL H+A   G+++IV  L+ H   ++   +     +H A ++GQ E+  +LI+N    +    +    PLHL    GH    ++L++   +++A  +   +P++ AC   + ++A LL+++         KN   P+H+   +   DI   L++         K G  P+HL+ + GH  I+ +LI+    +   A K    P+H      +V + E+L     NI+   +  + P+H+A   G   +VR L+    +++A   +  Y P+H   + GH  IV +L++ K +  A   +   P+H A + G+ ++
Sbjct:  456 LRNGAQVDARAREQQTPL-HIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT-AKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPA-KNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSI-GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 8 Score: 139.428 bits (350), Expect = 3.134e-33
Identity = 74/290 (25.52%), Postives = 152/290 (52.41%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +  N DI T + +G   +HLA ++GH+ +   L+     ++ SA KK    +H A + G  E++++L+  N ++  + +  + P+++A ++    +VR+L+    + ++    + + P+  A + GH+ +V +L++   D    +      +H A ++     A LL+D     D+ + +G   + P+H A   G+++IA LL+ +  DVN   +++  P+  A++ G   +V +L+ +  +I+A  R    PLH A   GH ++V +L + G  I A T+   +P+ +A
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVD-SATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLE--SDTRGKVR--LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSG---FTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMA 311          

HSP 9 Score: 132.109 bits (331), Expect = 5.424e-31
Identity = 78/363 (21.49%), Postives = 163/363 (44.90%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEACVGM------------NNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G++E     +    DI      N  + +H+   +GH  +V  L+     +++  K G   +H+A   G   + K+L++ N  +   + +    P++ A    H  ++ +L+S   N     E+ + P+ +A ++G  ++V +L++                +K D++A   +            + + P+H A  +G+  I  +L+ +  D+    + N  P+H A + G  N+  LL+++  +IEA    +   P+H A   GH+ +  +L++R   ++A  +N   P+  A++  +++  +IL+  +  +D         LH A   GH  + KLL     D  A     ++P+ +A
Sbjct:   18 AARAGNLERVLEHLKNNIDINT-SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 377          

HSP 10 Score: 72.4034 bits (176), Expect = 1.532e-12
Identity = 41/195 (21.03%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAG 817
            +H+A     ++I   L+++        +    P+H + ++G AEI  LLI++K        +    P+HL   E + +  +IL ++  NI+   +   +P++ A   G   + + L+    ++          P+H    +GH  IV +L++   +      +G+ P+H+A + G++++   L  +  + E +A 
Sbjct:  605 LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYT-PLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA 797          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 207.608 bits (527), Expect = 6.422e-55
Identity = 121/438 (27.63%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+ +V  L+     ++   +     +H A   GQ E+VKLL+++     +   Q    PL++A  E H   V++L+ +  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+D + + +   K G  P+H+A   G+  IA +LI    D+  SA K +  P+H A   G   ++ +L+ K  NIEA+  +   P+H A   G +++V ML++R   I A    N   P+H A +  H    R+L+  +  ++    D    +H A   GH  +AKLL+DR  D  A A LN + P+H AC++    + +LL+     ++A  E+   P+  A+  G + IV  L+      D        PLH A     T+I+++L + G  ++A  RE+ +P+ +A
Sbjct:  198 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR-----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA-KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 626          

HSP 2 Score: 199.134 bits (505), Expect = 3.447e-52
Identity = 120/487 (24.64%), Postives = 220/487 (45.17%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNC-----------------------------NINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            EL  +  + +   +K    +H+A   G  E+VK L++HN  + ++ +    P++ A ++    +V+LL+ N  + +    +    PL +A  +GH   V +L+ES+                              N +   +   +P++ A   G+  IA LLI +  D+  +  K+   P+H+    G  ++V +L+++  +IE   +DG  P+H A  +GH  +  +L++    I A   K    P+H A  G HV+   +L+     ++    +    +H+A   G   + ++L+DR  D  A   +N + P+H ACK     +V +L+     I A  E    P+H A   G  NI   L+  D   D+    G     P+H A      DI ++L+     V+A       P+  AS  G ++IV +L+     +DA  +  +  LH A + G  E+  +L + G  ++A T++ ++P+ L
Sbjct:  212 ELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANAR-ALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRG---ETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHL 691          

HSP 3 Score: 197.978 bits (502), Expect = 8.204e-52
Identity = 104/438 (23.74%), Postives = 214/438 (48.86%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D N D   R      P+H AC+K + ++V+LL+ +         +    PLH+A + G  + V  L++ + + +       +P++ A +    +I ++L+     +     + ++ P+H+    G+ DIV +L+     ++   KD    +H+A + G   +A +LI+    ++A A KK   P+H     GH+++ ++L+ K  +++A+ +    P+H+AC   ++++  +L+++     A    N + P+H A +     I   L++      A  +  + P+H + + GH  I+ LLI+ K  +   A  N   P+H   +  + ++A++L     +++   +  + P+  AS  G   +V+ L+    ++DA     + PLH   ++GH  IV LL +   +  A T    +P+ +A
Sbjct:  491 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATA-KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAK-NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 923          

HSP 4 Score: 197.208 bits (500), Expect = 1.378e-51
Identity = 115/444 (25.90%), Postives = 212/444 (47.75%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLID--HNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A     ++    L+D  HN D+  +  +   P+H A   G   I  LLI    D   +  + N  PLH+A   G  + V +L+E   NI A      +P++ A + GH ++  +L+++   I     KN   P+HM     H D  ++L+     ++    D    +H+A   GHV +AK+L+D N D  A A      P+H AC    ++++E+L+    +I A  E    P+H+A   G   IV  L+  D   D+    G     P+H A +     I+R+L+     ++A   +   P+H A   G+ +I  LL+     ++A    + +  +H A + G  ++A +L++    ++A  +  + P+   ++ G+I++ ++L+ ++ D+DA  +    PLH AC   + ++  LL + G    A  +  ++P+ +A
Sbjct:  324 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT--PLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISA-KTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET---PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK-DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 758          

HSP 5 Score: 192.971 bits (489), Expect = 3.840e-50
Identity = 104/438 (23.74%), Postives = 219/438 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H A   GH ++V  L++    I  + +    P+H A +    +  ++L+ ++   +     +    LH+A   GH    K+L++ N + NA      +P++ ACK+  +++ +LL+     I     ++   P+H+  F G  +IV  L+  +   +     G+ P+HLA       I +IL+     ++A A ++ + P+H A   G+V+I+ +L+     ++A  ++ +  +H+A ++G  E+  +LI+    ++A      + P+H   K+GH  + ++L+ ++ D++A  ++   P+H AC   ++ +A LL+++     A A  N   P+H A  +   DIA  L++     NA  +  + P+  +S+ G+ EI  +LI  K  ++   +    P+H   +  +  + ++L + G +I+  T+  Y+P+ +A
Sbjct:  425 LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTA-LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT-ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT-KKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAK-NGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 857          

HSP 6 Score: 173.326 bits (438), Expect = 6.609e-44
Identity = 97/385 (25.19%), Postives = 187/385 (48.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRK-CDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+ H+   ++       P+H A    Q +I+++L+ N    +    +  Q PLH+A   G+ D V +L++    ++A  +   + ++ A K G  E+A +LI+    +     K    P+H+    GH  + ++L+ +  D++   K+G  P+H+AC   +  +A +L++      A+A K    P+H A     ++I   L+       AE +  + P+HL+ ++G  EI  +LI+ K  +      N   P+H  C    NV V  ++++   +I+   +  + P+H A   G  N+ + L+    +++A   +  + P+H   ++GH  I  LL++ K + NA   N   P+  A + GYI ++  L
Sbjct:  557 LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATA-KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPA-KNGLTPMHL-CAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 935          

HSP 7 Score: 144.436 bits (363), Expect = 9.207e-35
Identity = 82/331 (24.77%), Postives = 156/331 (47.13%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNI 1171
            L N   +D     +  PL H+A   G+++IV  L+ H   ++   +     +H A ++GQ E+  +LI+N    +    +    PLHL    GH    ++L++   +++A  +   +P++ AC   + ++A LL+++         KN   P+H+   +   DI   L++         K G  P+HL+ + GH  I+ +LI+    +   A K    P+H      +V + E+L     NI+   +  + P+H+A   G   +VR L+    +++A   +  Y P+H   + GH  IV +L++ K +  A   +   P+H A + G+ ++
Sbjct:  606 LRNGAQVDARAREQQTPL-HIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHAT-AKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPA-KNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSI-GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 931          

HSP 8 Score: 139.428 bits (350), Expect = 3.314e-33
Identity = 74/290 (25.52%), Postives = 152/290 (52.41%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +  N DI T + +G   +HLA ++GH+ +   L+     ++ SA KK    +H A + G  E++++L+  N ++  + +  + P+++A ++    +VR+L+    + ++    + + P+  A + GH+ +V +L++   D    +      +H A ++     A LL+D     D+ + +G   + P+H A   G+++IA LL+ +  DVN   +++  P+  A++ G   +V +L+ +  +I+A  R    PLH A   GH ++V +L + G  I A T+   +P+ +A
Sbjct:  181 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVD-SATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLE--SDTRGKVR--LPALHIAAKKDDVKAATLLLDNDHNPDVTSKSG---FTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMA 461          

HSP 9 Score: 134.806 bits (338), Expect = 7.891e-32
Identity = 87/397 (21.91%), Postives = 170/397 (42.82%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADI---------------------------------VKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNC-----------------------------NIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G++E     +    DI      N  + +H+   +GH  +                                 VK+L++ N  +    ++G  P+++A +  H A+ ++L+  N   ++ A +    P+  A   GH +++ VL+  +                              N +   +  + P+H+A   G++ I  +LI +  D+      +N  P+H A KWG   +V +L+++  +IEA   D   P+H A   GH  +  +L++R   I A    N   P+H A +  H D A++L+  +  V+    +    +  A+  G++ + K+L+++  D +A     + PLH AC++   ++V+LL + G  I A T    +P+ +A
Sbjct:  168 AARAGNLERVLEHLKNNIDINT-SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYS-AKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTK-NGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVA 560          

HSP 10 Score: 72.0182 bits (175), Expect = 2.020e-12
Identity = 41/195 (21.03%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAG 817
            +H+A     ++I   L+++        +    P+H + ++G AEI  LLI++K        +    P+HL   E + +  +IL ++  NI+   +   +P++ A   G   + + L+    ++          P+H    +GH  IV +L++   +      +G+ P+H+A + G++++   L  +  + E +A 
Sbjct:  755 LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYT-PLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA 947          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 192.2 bits (487), Expect = 9.398e-50
Identity = 121/438 (27.63%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+ +V  L+     ++   +     +H A   GQ E+VKLL+++     +   Q    PL++A  E H   V++L+ +  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+D + + +   K G  P+H+A   G+  IA +LI    D+  SA K +  P+H A   G   ++ +L+ K  NIEA+  +   P+H A   G +++V ML++R   I A    N   P+H A +  H    R+L+  +  ++    D    +H A   GH  +AKLL+DR  D  A A LN + P+H AC++    + +LL+     ++A  E+   P+  A+  G + IV  L+      D        PLH A     T+I+++L + G  ++A  RE+ +P+ +A
Sbjct:   48 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR-----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSA-KHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA 476          

HSP 2 Score: 182.57 bits (462), Expect = 1.275e-46
Identity = 112/442 (25.34%), Postives = 212/442 (47.96%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A     ++    L+D++ + ++  +    P+H A   G   I  LLI    D   +  + N  PLH+A   G  + V +L+E   NI A      +P++ A + GH ++  +L+++   I     KN   P+HM     H D  ++L+     ++    D    +H+A   GHV +AK+L+D N D  A A      P+H AC    ++++E+L+    +I A  E    P+H+A   G   IV  L+  D   D+    G     P+H A +     I+R+L+     ++A   +   P+H A   G+ +I  LL+     ++A    + +  +H A + G  ++A +L++    ++A  +  + P+   ++ G+I++ ++L+ ++ D+DA  +    PLH AC   + ++  LL + G    A  +  ++P+ +A
Sbjct:  174 PALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISA-KTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET---PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK-DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIA 608          

HSP 3 Score: 181.8 bits (460), Expect = 2.000e-46
Identity = 120/487 (24.64%), Postives = 220/487 (45.17%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNC-----------------------------NINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            EL  +  + +   +K    +H+A   G  E+VK L++HN  + ++ +    P++ A ++    +V+LL+ N  + +    +    PL +A  +GH   V +L+ES+                              N +   +   +P++ A   G+  IA LLI +  D+  +  K+   P+H+    G  ++V +L+++  +IE   +DG  P+H A  +GH  +  +L++    I A   K    P+H A  G HV+   +L+     ++    +    +H+A   G   + ++L+DR  D  A   +N + P+H ACK     +V +L+     I A  E    P+H A   G  NI   L+  D   D+    G     P+H A      DI ++L+     V+A       P+  AS  G ++IV +L+     +DA  +  +  LH A + G  E+  +L + G  ++A T++ ++P+ L
Sbjct:   62 ELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN-YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKT-KNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANA-RALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET---PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHL 541          

HSP 4 Score: 181.415 bits (459), Expect = 2.345e-46
Identity = 104/438 (23.74%), Postives = 214/438 (48.86%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH+ + K L+D N D   R      P+H AC+K + ++V+LL+ +         +    PLH+A + G  + V  L++ + + +       +P++ A +    +I ++L+     +     + ++ P+H+    G+ DIV +L+     ++   KD    +H+A + G   +A +LI+    ++A A KK   P+H     GH+++ ++L+ K  +++A+ +    P+H+AC   ++++  +L+++     A    N + P+H A +     I   L++      A  +  + P+H + + GH  I+ LLI+ K  +   A  N   P+H   +  + ++A++L     +++   +  + P+  AS  G   +V+ L+    ++DA     + PLH   ++GH  IV LL +   +  A T    +P+ +A
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISA-TTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDA-RAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHA-TAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAK-NGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 5 Score: 176.792 bits (447), Expect = 7.298e-45
Identity = 104/438 (23.74%), Postives = 219/438 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H A   GH ++V  L++    I  + +    P+H A +    +  ++L+ ++   +     +    LH+A   GH    K+L++ N + NA      +P++ ACK+  +++ +LL+     I     ++   P+H+  F G  +IV  L+  +   +     G+ P+HLA       I +IL+     ++A A ++ + P+H A   G+V+I+ +L+     ++A  ++ +  +H+A ++G  E+  +LI+    ++A      + P+H   K+GH  + ++L+ ++ D++A  ++   P+H AC   ++ +A LL+++     A A  N   P+H A  +   DIA  L++     NA  +  + P+  +S+ G+ EI  +LI  K  ++   +    P+H   +  +  + ++L + G +I+  T+  Y+P+ +A
Sbjct:  275 LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDY-LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISA-TTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA-REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAAT-KKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAK-NGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA 707          

HSP 6 Score: 158.688 bits (400), Expect = 3.636e-39
Identity = 97/385 (25.19%), Postives = 187/385 (48.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRK-CDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+A   G + IV +L+ H+   ++       P+H A    Q +I+++L+ N    +    +  Q PLH+A   G+ D V +L++    ++A  +   + ++ A K G  E+A +LI+    +     K    P+H+    GH  + ++L+ +  D++   K+G  P+H+AC   +  +A +L++      A+A K    P+H A     ++I   L+       AE +  + P+HL+ ++G  EI  +LI+ K  +      N   P+H  C    NV V  ++++   +I+   +  + P+H A   G  N+ + L+    +++A   +  + P+H   ++GH  I  LL++ K + NA   N   P+  A + GYI ++  L
Sbjct:  407 LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE-QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATA-KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNH-PAKNGLTPMHL-CAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 132.109 bits (331), Expect = 8.404e-31
Identity = 78/319 (24.45%), Postives = 153/319 (47.96%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNI 1171
            R+ +  +H+A   G+++IV  L+ H   ++   +     +H A ++GQ E+  +LI+N    +    +    PLHL    GH    ++L++   +++A  +   +P++ AC   + ++A LL+++         KN   P+H+   +   DI   L++         K G  P+HL+ + GH  I+ +LI+    +   A K    P+H      +V + E+L     NI+   +  + P+H+A   G   +VR L+    +++A   +  Y P+H   + GH  IV +L++ K +  A   +   P+H A + G+ ++
Sbjct:  467 REQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDA-ATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHA-TAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPA-KNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSI-GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV 781          

HSP 8 Score: 126.716 bits (317), Expect = 3.886e-29
Identity = 73/290 (25.17%), Postives = 151/290 (52.07%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +  N DI T + +G   +HLA ++GH+ +   L+     ++ SA KK    +H A + G  E++++L+  N ++  + +  + P+++A ++    +VR+L+    + ++    + + P+  A + GH+ +V +L++     +  +      +H A ++     A LL+D     D+ + +G     P+H A   G+++IA LL+ +  DVN   +++  P+  A++ G   +V +L+ +  +I+A  R    PLH A   GH ++V +L + G  I A T+   +P+ +A
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVD-SATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGAN-QSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLP----ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFT---PLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMA 311          

HSP 9 Score: 120.168 bits (300), Expect = 4.054e-27
Identity = 78/363 (21.49%), Postives = 162/363 (44.63%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIEAC------------VGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A + G++E     +    DI      N  + +H+   +GH  +V  L+     +++  K G   +H+A   G   + K+L++ N  +   + +    P++ A    H  ++ +L+S   N     E+ + P+ +A ++G  ++V +L++                +K D++A                + + P+H A  +G+  I  +L+ +  D+    + N  P+H A + G  N+  LL+++  +IEA    +   P+H A   GH+ +  +L++R   ++A  +N   P+  A++  +++  +IL+  +  +D         LH A   GH  + KLL     D  A     ++P+ +A
Sbjct:   18 AARAGNLERVLEHLKNNIDINT-SNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT-RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA 377          

HSP 10 Score: 65.855 bits (159), Expect = 1.650e-10
Identity = 41/195 (21.03%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAG 817
            +H+A     ++I   L+++        +    P+H + ++G AEI  LLI++K        +    P+HL   E + +  +IL ++  NI+   +   +P++ A   G   + + L+    ++          P+H    +GH  IV +L++   +      +G+ P+H+A + G++++   L  +  + E +A 
Sbjct:  605 LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDA-ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA 797          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 228.024 bits (580), Expect = 1.488e-61
Identity = 120/438 (27.40%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  +VK L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   + ++    G  P+H+A   GH    +IL+D N   +    KK   P+H AC  G V+++E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y  +H A K     +   L+    +  +       P+H A + G  ++  LLI ++ ++  G   N   P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+  +++  R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  283 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 715          

HSP 2 Score: 222.246 bits (565), Expect = 1.130e-59
Identity = 121/440 (27.50%), Postives = 221/440 (50.23%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFG--GQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VK+L++H  +  +  E    P+  A ++G   +V LLI+       +G  G+     LH+A       T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV + +IL+D    ++A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   +V++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + D+       PLH A   GH +  ++L         +T++ ++P+ +A
Sbjct:   56 LYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANAR-ALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVA 484          

HSP 3 Score: 211.075 bits (536), Expect = 5.035e-56
Identity = 122/477 (25.58%), Postives = 224/477 (46.96%), Query Frame = 2
Query:  218 KDE--PLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD---------------------------IEAGAGLNN-----WRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            KDE  PL H A   GH+ +V+ L+D    ++ + +    PIH A +    + V+ L+    + +      +  PLH+A   GH   VK+L++     NA      +P++ ACK+ H+    LL+     ++    ++   P+H+  F GH +IVK L+         +   + P+H+A   GH  +A+ L+  N  ++A A K  + P+H A   GH E++++L+    N ++       P+H+A  +G  +  R+L+D     +  +    + P+H ACK+G   +V +L++R  +  A  ++   P+H A    + ++ KLL+ +                              ++ GA  N+       P+H A + G  D+  LL+ ++ +VN   +N   P+   ++ G++ I  +L+ Q   + A  R  + PLH AC  G+ ++VK L Q    + + TR  Y+P+  A
Sbjct:  211 KDELTPL-HCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLD-HLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKA-KDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQA 682          

HSP 4 Score: 197.978 bits (502), Expect = 8.705e-52
Identity = 112/440 (25.45%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A           L+ ++ + ++  +    P+H A       + +LL++   +   F  +    PLH+A   G+   V++L++    I+A  +   +P++ A + GHV + ++L+DQ   +Q    KN   PIHM     H D V+ L+  N +I+    D   P+H+A   GH  + K+L+D      A A      P+H AC   H+  +++L+  + ++EA  E    P+H+A   G   IV+ L+ R     A   +    P+H A + GH  + + L+     ++A  +D+  P+H A   GH+ + KLL++ K + ++ A      P+H A   GH    ++L+D         +  + P+  A + G +++V++L+ +  + +A  +    PLH A    + ++VKLL   G    +  R  Y+ + +A
Sbjct:  116 PALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQA-KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS-NVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIA 550          

HSP 5 Score: 197.208 bits (500), Expect = 1.831e-51
Identity = 107/409 (26.16%), Postives = 193/409 (47.19%), Query Frame = 2
Query:  158 IRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +RS    L +   L+   E    PL H+A   GHL IVK L+         +     P+H A   G  E+ + L+ N    +    + +Q PLH A   GHK+ VK+L+E   N ++      +P++ A + GH +  ++L+D+    Q    K    P+H+ C  G  D+V++L++   +     K+G  P+H+A  + ++ + K+L+       ++A +     +H A     +E+   L+    N  +E  +   P+HLA ++G  ++V +LI ++ ++      N   P+H   + GH  I  ML+ +   + A     + P+H AC  G+  + K L+ ++  + +   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI ++ +L
Sbjct:  325 MRSMDLLLKHSASLEAVTESGLTPL-HVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-RNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLG-YTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 6 Score: 182.57 bits (462), Expect = 8.224e-47
Identity = 109/418 (26.08%), Postives = 196/418 (46.89%), Query Frame = 2
Query:  377 LIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI-------------------------------DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            L+ N ID E    + N   LH+A   G +  V  LI    N+NA  +   SP+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V +LI                               D N D+    K G  P+H+A    ++++A++L++   ++  +  K    P+H A   G+V ++ +L+ +   I+A+ ++   P+H A   G   +V +L+D+   ++A    N   PIH A +  H   VR L+    +I+    D+  P+H A   GH  + K+L+D+     A A LN + P+H AC++ H     LL+     + A  E+   P+  A+  G++ IVK L+ +    +A +     PLH A   GH E+ + L Q    ++A  +++ +P+
Sbjct:    5 LLHNGIDLETTTKKGNTA-LHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTP-KNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPL 415          

HSP 7 Score: 124.79 bits (312), Expect = 1.546e-28
Identity = 77/321 (23.99%), Postives = 148/321 (46.11%), Query Frame = 2
Query:  668 IVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID----------------RKCDIE-ACVGMNN-----------YRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +V  L+    D+ET  K G   +H+A   G   +   LI+   ++ A + +K   P++ A    H+E+++ L+    N     E+ + P+ +A ++G + +V +LI+                R  D   A V + N           + P+H A  + +  + ++L++R  ++    ++   P+H A  RG+  + +LL+DR   I+A    +   P+H A   GH  + ++L+D+   + A  +N   PI  A++  +++ V+ L+    +ID        PLH A   GH  +VK+L   G    A     ++P+ +A
Sbjct:    1 MVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQS-QKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK-DELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIA 319          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 226.483 bits (576), Expect = 8.196e-61
Identity = 120/438 (27.40%), Postives = 213/438 (48.63%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  +VK L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   + ++    G  P+H+A   GH    +IL+D N   +    KK   P+H AC  G V+++E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y  +H A K     +   L+    +  +       P+H A + G  ++  LLI ++ ++  G   N   P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+  +++  R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  345 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 777          

HSP 2 Score: 221.476 bits (563), Expect = 3.415e-59
Identity = 120/438 (27.40%), Postives = 219/438 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VK+L++H  +  +  E    P+  A ++G   +V LLI+         G+     LH+A       T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV + +IL+D    ++A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   +V++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + D+       PLH A   GH +  ++L         +T++ ++P+ +A
Sbjct:  118 LYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANAR-ALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVA 546          

HSP 3 Score: 209.92 bits (533), Expect = 1.773e-55
Identity = 116/442 (26.24%), Postives = 217/442 (49.10%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    H++ V+ L+ +N +I+        P+H A   G   +VK+L+D   K +     G     PLH+AC + H  ++ +L++ + ++ A  E   +P++ A   GH+ I K L+ QR             P+HM    GH ++ + L+  N  ++   KD + P+H A   GH  + K+L++   N D   +AG     P+H A   GH +   +L+ +N       ++ + P+H+AC+ G  ++V +L++R  +  A  G N   P+H A    +  +V++L+ +     +   + +  +H A ++    +A  L+    +  + + L    P+H A + G  D+  LL+ ++ +VN   +N   P+   ++ G++ I  +L+ Q   + A  R  + PLH AC  G+ ++VK L Q    + + TR  Y+P+  A
Sbjct:  312 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF---TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL-QRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHT---PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAA-GKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSES-LQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQA 744          

HSP 4 Score: 207.994 bits (528), Expect = 8.616e-55
Identity = 116/473 (24.52%), Postives = 225/473 (47.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDW---------------------------------RPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   G++ +V+ L+D    I+ + + +  P+H A   G   +V++L+D     +    +    P+H+A    H D V+ L++ N  I+     + +P++ A   GH  + K+L+D+  + + +   G     P+H+ C + H   + +L+  +  +E   + G  P+H+A   GH+ I K L+       AS   K   P+H A   GH E+ + L+  N  ++A+ ++   P+H A   G KE+V++L++ K + ++      + P+H A + GH    R+L+D         +  + P+H AC+ G  ++ +LL++R  +  A AG N   P+H A    + D+ KLLV +    ++   N +                                  P+  AS+ G  ++V +LI+++ +++  ++    PLH   + GH  I  +L + G  + A +R  Y+P+ +A
Sbjct:  246 LHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQA-KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS-NVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSAT-TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 711          

HSP 5 Score: 198.749 bits (504), Expect = 7.842e-52
Identity = 120/466 (25.75%), Postives = 219/466 (47.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--------------------DQRCDIQVFG--------GKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ + +D+E   +     +H A   GQ ++V  LI+   +      Q    PL++A  E H + VK L+E   N +   E   +P+  A ++GH  +  LLI                    D R    +           K    P+H+     +  + ++L++   ++    K+G  P+H+A   G+V + ++L+D    I+A   K    P+H A   GHV ++E+L+ +   ++A+ +    PIH+A +    + VR L+    +I+  + +++  P+H A   GH+ +V++L+D+     A   + + P+H AC++ H     LL+     +EA    +   P+H A   GH +I K L+ R    NA       P+  A+  G+ E+ + L+     +DA  +    PLH A   GH E+VKLL +   + ++ T   ++P+ +A
Sbjct:   52 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNA-QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKT-KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDD-ITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA 513          

HSP 6 Score: 196.052 bits (497), Expect = 6.855e-51
Identity = 107/409 (26.16%), Postives = 193/409 (47.19%), Query Frame = 2
Query:  158 IRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +RS    L +   L+   E    PL H+A   GHL IVK L+         +     P+H A   G  E+ + L+ N    +    + +Q PLH A   GHK+ VK+L+E   N ++      +P++ A + GH +  ++L+D+    Q    K    P+H+ C  G  D+V++L++   +     K+G  P+H+A  + ++ + K+L+       ++A +     +H A     +E+   L+    N  +E  +   P+HLA ++G  ++V +LI ++ ++      N   P+H   + GH  I  ML+ +   + A     + P+H AC  G+  + K L+ ++  + +   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI ++ +L
Sbjct:  387 MRSMDLLLKHSASLEAVTESGLTPL-HVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-RNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLG-YTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 7 Score: 167.162 bits (422), Expect = 8.925e-42
Identity = 106/435 (24.37%), Postives = 196/435 (45.06%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE     I + +DI I ++     +H A ++G  ++V  L+ N ID E    + N   LH+A   G +  V  LI    N+NA  +   SP+Y A +                                  E H ++VK L++   +     +DG  P+ +A + GH  +  +LI+       + GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N   P+H A + G+ ++VR+L+DR   I+A  +D   P+H A   GH  + ++L+D+   ++A    N   PIH A +  H D  + L+    +++    +   P+  A+  G+  +VK+L+++    +A     + PLH AC++ H   + LL +    +EA+T    +P+ +A
Sbjct:   22 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA-LHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQ----------------------------------ENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINY-----GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTK-NGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVA 414          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 225.328 bits (573), Expect = 2.023e-60
Identity = 120/438 (27.40%), Postives = 212/438 (48.40%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  +VK L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   + ++    G  P+H+A   GH    +IL+D N   +    KK   P+H AC  G V++ E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y  +H A K     +   L+    +  +       P+H A + G  ++  LLI ++ ++  G   N   P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+  +++  R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  310 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHS-TARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 742          

HSP 2 Score: 208.379 bits (529), Expect = 7.181e-55
Identity = 115/442 (26.02%), Postives = 216/442 (48.87%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    H++ V+ L+ +N +I+        P+H A   G   +VK+L+D   K +     G     PLH+AC + H  ++ +L++ + ++ A  E   +P++ A   GH+ I K L+ QR             P+HM    GH ++ + L+  N  ++   KD + P+H A   GH  + K+L++   N D   +AG     P+H A   GH +   +L+ +N       ++ + P+H+AC+ G  ++  +L++R  +  A  G N   P+H A    +  +V++L+ +     +   + +  +H A ++    +A  L+    +  + + L    P+H A + G  D+  LL+ ++ +VN   +N   P+   ++ G++ I  +L+ Q   + A  R  + PLH AC  G+ ++VK L Q    + + TR  Y+P+  A
Sbjct:  277 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF---TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL-QRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHT---PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAA-GKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSES-LQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQA 709          

HSP 3 Score: 186.422 bits (472), Expect = 7.801e-48
Identity = 108/448 (24.11%), Postives = 206/448 (45.98%), Query Frame = 2
Query:  329 PIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ-------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDW---------------------------------RPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P+H A       + +LL++   +        +         P+H+A    H D V+ L++ N  I+     + +P++ A   GH  + K+L+D+  + + +   G     P+H+ C + H   + +L+  +  +E   + G  P+H+A   GH+ I K L+       AS   K   P+H A   GH E+ + L+  N  ++A+ ++   P+H A   G KE+V++L++ K + ++      + P+H A + GH    R+L+D         +  + P+H AC+ G  ++A+LL++R  +  A AG N   P+H A    + D+ KLLV +    ++   N +                                  P+  AS+ G  ++V +LI+++ +++  ++    PLH   + GH  I  +L + G  + A +R  Y+P+ +A
Sbjct:  235 PLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS-NVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSAT-TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 676          

HSP 4 Score: 181.415 bits (459), Expect = 2.618e-46
Identity = 121/476 (25.42%), Postives = 217/476 (45.59%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLI--DENCDI--ETC-------------------------DKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR-------RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ + +D+E   +     +H A   GQ ++V  LI+   +      Q    PL++A  E H + VK L+E   N +   E   +P+  A ++GH  +  LLI+       +G K K R P +H+           +L+  D N D+  + C                          + G  P+H+A    ++++A++L++   ++  +    S         PIH A  G H++ +  L+  N  I+    +   P+H+A   G   +V++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + D+       PLH A   GH +  ++L         +T++ ++P+ +A
Sbjct:   46 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNA-QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA-RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVA 511          

HSP 5 Score: 178.718 bits (452), Expect = 2.085e-45
Identity = 96/366 (26.23%), Postives = 185/366 (50.55%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ +FL+ +N  ++ + +  + P+H A   G  E+VKLL+++K + +         PLH+A  EGH  T +IL++ N       +   +P++ ACK G V++A+LL+++  +     GKN   P+H+     + D+VK+L+ +     +  ++G   +H+A +   + +A  L+    +   S   +   P+H A   G  +++ +LISK  N+   ++    P+HL  ++G   I  ML+ +   + A   M  Y P+H AC +G+  +V+ L+ ++  + +     + P+H A ++GH +I  LL+ +   +      N   P+  A   G+    D+ KL+ +    +
Sbjct:  404 KVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD-SATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANAN-SESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRM-GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL-KHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSM 764          

HSP 6 Score: 167.933 bits (424), Expect = 6.433e-42
Identity = 117/471 (24.84%), Postives = 212/471 (45.01%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASA--------------------------GKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEES--------WRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE     I + +DI I ++     +H A ++G  ++V  L+ N ID E    + N   LH+A   G +  V  LI    N+NA  +   SP+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V +LI+      T  K     +H+A  N     A +L+  D N D+ +                             +    P+H A    ++ + ++L+++  N+    + S          PIH+A +    + VR L+    +I+  + +++  P+H A   GH+ +V++L+D+     A   + + P+H AC++ H     LL+     +EA    +   P+H A   GH +I K L+ R    NA       P+  A+  G+ E+ + L+     +DA  +    PLH A   GH E+VKLL +   + ++ T   ++P+ +A
Sbjct:   16 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA-LHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDD-ITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA 478          

HSP 7 Score: 135.961 bits (341), Expect = 6.592e-32
Identity = 74/323 (22.91%), Postives = 149/323 (46.13%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+VK L++H  + +        P+H A  +G A+  ++L+D     +    +    PLH+AC  G  D  ++L+E   N NA  +   +P++ A    ++++ KLL+ +         +N    +H+   +   ++   L+    +  +    G  P+HLA + G   +  +LI    ++     K    P+H     GHV I ++L+ +  ++ A     + P+H+AC  G+ ++V+ L+ ++  + +   +  Y P+H A + GH  IV +L+           +   P+  A   G+ ++  +L
Sbjct:  436 KDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNL-GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRL-GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 754          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 224.942 bits (572), Expect = 2.323e-60
Identity = 120/438 (27.40%), Postives = 212/438 (48.40%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  +VK L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   + ++    G  P+H+A   GH    +IL+D N   +    KK   P+H AC  G V++ E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y  +H A K     +   L+    +  +       P+H A + G  ++  LLI ++ ++  G   N   P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+  +++  R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  315 LHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 747          

HSP 2 Score: 207.994 bits (528), Expect = 7.732e-55
Identity = 115/442 (26.02%), Postives = 216/442 (48.87%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    H++ V+ L+ +N +I+        P+H A   G   +VK+L+D   K +     G     PLH+AC + H  ++ +L++ + ++ A  E   +P++ A   GH+ I K L+ QR             P+HM    GH ++ + L+  N  ++   KD + P+H A   GH  + K+L++   N D   +AG     P+H A   GH +   +L+ +N       ++ + P+H+AC+ G  ++  +L++R  +  A  G N   P+H A    +  +V++L+ +     +   + +  +H A ++    +A  L+    +  + + L    P+H A + G  D+  LL+ ++ +VN   +N   P+   ++ G++ I  +L+ Q   + A  R  + PLH AC  G+ ++VK L Q    + + TR  Y+P+  A
Sbjct:  282 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGF---TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL-QRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHT---PLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAA-GKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSES-LQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQA 714          

HSP 3 Score: 186.422 bits (472), Expect = 8.617e-48
Identity = 108/448 (24.11%), Postives = 206/448 (45.98%), Query Frame = 2
Query:  329 PIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ-------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDW---------------------------------RPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P+H A       + +LL++   +        +         P+H+A    H D V+ L++ N  I+     + +P++ A   GH  + K+L+D+  + + +   G     P+H+ C + H   + +L+  +  +E   + G  P+H+A   GH+ I K L+       AS   K   P+H A   GH E+ + L+  N  ++A+ ++   P+H A   G KE+V++L++ K + ++      + P+H A + GH    R+L+D         +  + P+H AC+ G  ++A+LL++R  +  A AG N   P+H A    + D+ KLLV +    ++   N +                                  P+  AS+ G  ++V +LI+++ +++  ++    PLH   + GH  I  +L + G  + A +R  Y+P+ +A
Sbjct:  240 PLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS-NVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSAT-TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVA 681          

HSP 4 Score: 181.415 bits (459), Expect = 2.942e-46
Identity = 121/476 (25.42%), Postives = 217/476 (45.59%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLI--DENCDI--ETC-------------------------DKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR-------RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ + +D+E   +     +H A   GQ ++V  LI+   +      Q    PL++A  E H + VK L+E   N +   E   +P+  A ++GH  +  LLI+       +G K K R P +H+           +L+  D N D+  + C                          + G  P+H+A    ++++A++L++   ++  +    S         PIH A  G H++ +  L+  N  I+    +   P+H+A   G   +V++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + D+       PLH A   GH +  ++L         +T++ ++P+ +A
Sbjct:   51 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNA-QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA-RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVA 516          

HSP 5 Score: 178.718 bits (452), Expect = 2.241e-45
Identity = 96/366 (26.23%), Postives = 185/366 (50.55%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ +FL+ +N  ++ + +  + P+H A   G  E+VKLL+++K + +         PLH+A  EGH  T +IL++ N       +   +P++ ACK G V++A+LL+++  +     GKN   P+H+     + D+VK+L+ +     +  ++G   +H+A +   + +A  L+    +   S   +   P+H A   G  +++ +LISK  N+   ++    P+HL  ++G   I  ML+ +   + A   M  Y P+H AC +G+  +V+ L+ ++  + +     + P+H A ++GH +I  LL+ +   +      N   P+  A   G+    D+ KL+ +    +
Sbjct:  409 KVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPD-SATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANAN-SESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRM-GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL-KHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSM 769          

HSP 6 Score: 167.548 bits (423), Expect = 8.023e-42
Identity = 117/471 (24.84%), Postives = 212/471 (45.01%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASA--------------------------GKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEES--------WRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE     I + +DI I ++     +H A ++G  ++V  L+ N ID E    + N   LH+A   G +  V  LI    N+NA  +   SP+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V +LI+      T  K     +H+A  N     A +L+  D N D+ +                             +    P+H A    ++ + ++L+++  N+    + S          PIH+A +    + VR L+    +I+  + +++  P+H A   GH+ +V++L+D+     A   + + P+H AC++ H     LL+     +EA    +   P+H A   GH +I K L+ R    NA       P+  A+  G+ E+ + L+     +DA  +    PLH A   GH E+VKLL +   + ++ T   ++P+ +A
Sbjct:   21 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA-LHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDD-ITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIA 483          

HSP 7 Score: 135.576 bits (340), Expect = 6.952e-32
Identity = 74/323 (22.91%), Postives = 149/323 (46.13%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+VK L++H  + +        P+H A  +G A+  ++L+D     +    +    PLH+AC  G  D  ++L+E   N NA  +   +P++ A    ++++ KLL+ +         +N    +H+   +   ++   L+    +  +    G  P+HLA + G   +  +LI    ++     K    P+H     GHV I ++L+ +  ++ A     + P+H+AC  G+ ++V+ L+ ++  + +   +  Y P+H A + GH  IV +L+           +   P+  A   G+ ++  +L
Sbjct:  441 KDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNL-GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRL-GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 759          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 224.557 bits (571), Expect = 4.450e-60
Identity = 122/438 (27.85%), Postives = 221/438 (50.46%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VKFL+D+  +  I  E    P+  A ++G   +V LLI++        G+     LH+A       T  +L++++ N +   +   +P++ A    ++ +A+LL+++  D+  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV I +IL+D    I+A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   + ++L+D+         +N + P+H ACK  H  ++ +L+     +EA  E    P+H +   GH NI K+L+ +     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  AS  G+ E+VK+L+  K + ++       PLH A   GHT+   +L      +  +T++ ++P+ +A
Sbjct:  115 LYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKT-KNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPN-TRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNA-SNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVA 543          

HSP 2 Score: 221.861 bits (564), Expect = 3.140e-59
Identity = 120/440 (27.27%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    ++ LL+ +    E    +    PLH++ + GH + VKIL++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   +  +    G  P+H+A   GH   A IL+D+N  +     KK   P+H A   G V++  +L+ +  N  A  +    P+H+A    + ++V +L+ +     +    N Y P+H A K     +   L+       A       P+H A + G  ++  LLI ++ ++  G  +GL    P+H   + GH  IA +LV     V A     + P+  A   G I++VK L+ Q+ +++   R  + PLH A ++GHT+IV LL + G     +T    S + +A
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVT-ESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDA-KAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQL-TKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAA-RNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLT---PLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIA 774          

HSP 3 Score: 181.8 bits (460), Expect = 2.599e-46
Identity = 99/402 (24.63%), Postives = 181/402 (45.02%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L +   L+   E    PL H++   GHL IVK L+         +     P+H A   G  E+ + L+ N    +    + +Q PLH A   GH + VK+L+E   N N+      +P++ A + GH + A +L+D    +     K    P+H+    G  D+  +L++   +     K G  P+H+A  + ++ +  +L+        SA +    P+H A      E+   L+    +  AE  +   P+HLA ++G  ++V +LI ++ ++      +   P+H   + GH  I  +L+     + A     + P+H AC  G+  + K L+ ++ ++     ++ + P+H A ++GH DI  LL+      N    N    +  A   GYI ++ +L
Sbjct:  391 LKHSASLEAVTESGLTPL-HVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDA-KAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMT-KKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPH-SAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLG-NKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMS-YTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 4 Score: 179.489 bits (454), Expect = 1.176e-45
Identity = 112/437 (25.63%), Postives = 213/437 (48.74%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE     I + +DI   ++     +H A ++G  ++V  L+ + I  E    + N   LH+A   G +  V  L+    N+NA  +   +P+Y A +  H+E+ K L+D   + Q    ++   P+ +   +GH ++V +LI+      T  K     +H+A  N     A +L+  D N D+ +  G     P+H A    ++ + ++L+++  ++    +    P+H+A  +G+  +VR+L+DR   I+A    +   P+H A + GH  I+ +L+D+   I+A  ++   PIH A +  H +  + L+    +I+    L++  P+H A   GH  +AK+L+D+    N    N + P+  A ++ ++ ++ +L+     ++A       PLH +   GH  IVK+L Q G    A   +  +P+ +A
Sbjct:   19 AARSGNLEKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTA-LHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGAN-QTIPTEDGFTPLAVALQQGHENVVALLINHG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKT-KDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEID-DITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMA 444          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 214.927 bits (546), Expect = 7.553e-57
Identity = 116/438 (26.48%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+ +    +    +    PLH+A + GH   VK L++   + N       +P++ A +  H ++A  LI  +  +     K+ + P+H     GH ++V++L++     +     G  P+HL    GH   A++L+D N     S  KK   P+H A   G ++I E+L+ +  +  +  +    P+H+A       IVR+L+++      C   N Y P+H A K       R L+       A       P+H A + GH ++  LL+ ++ ++  G   ++  P+H A + GH +IA++LV     V A     + P+  A   G I++VK L+  + +++A  +  + PLH A ++GHT+IV LL + G      +    +P+ +A
Sbjct:  375 LHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVT-ESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARA-KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD-NQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLG-NKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIA 807          

HSP 2 Score: 213.772 bits (543), Expect = 1.962e-56
Identity = 118/444 (26.58%), Postives = 221/444 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +   I+        P+H A   G   + KLL+D   K +     G     PLH+AC + H   +++L++S  +I+A  E   +P++ A   GH+ I K L+ +     VF  K +  P+HM     H D+   LI     +    KD + P+H A  +GH  + ++L++   + D   +AG     P+H    GGH +  E+L+       +  ++ + P+H+A + G  +I  +L++R+    +  G     P+H A    H  IVR+L+++         + + P+H A ++   + A+ L+     C+ ++  G+    P+H A + GH D+  LL+ ++ +V+   ++   P+  AS+ G++ I ++L++    + A  R  + PLH AC  G+ ++VK L Q   ++ A+T+  ++P+  A
Sbjct:  342 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF---TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVET-PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSA-GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA 774          

HSP 3 Score: 207.994 bits (528), Expect = 1.205e-54
Identity = 122/491 (24.85%), Postives = 232/491 (47.25%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  ++V+ L++H  ++  + +    P++ A ++    +VK L++N  + +    +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  +N    +H+    G+  +V++L+D    I+ C KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+    +I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ +      GA  N +      P+H A    H D+A  L+  K  VNA  ++D  P+  A+  G+ E+V++L+      D        PLH     GHT+  +LL        ++T++ ++P+ +A
Sbjct:   96 ELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKT-KNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNA-RALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK------GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVA 576          

HSP 4 Score: 179.489 bits (454), Expect = 1.600e-45
Identity = 104/420 (24.76%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID--RKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA---------------------------GAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC   H+ +++ L+     I+   E    P+H A   G   IVK L+       +F  +  + PLH+A    H D    LI++   +NA  + +++P++ A + GH E+ +LL++     D     G     P+H+    GH    ++L+D      +  K G  P+H+A + G + IA++L++       SAGK    P+H A    H+ I+ +L++K  +        + P+H+A ++   +  R L+     C+ ++  G+    P+H A + GH  +V +L+ ++ ++    + +  P+H A + GH NIA++L+     + A                            A +N      + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  408 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 5 Score: 174.481 bits (441), Expect = 6.884e-44
Identity = 97/366 (26.50%), Postives = 184/366 (50.27%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI-DRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVD 1291
            K E  +H+A    H ++  FLI +   +  R +  + P+H A   G  E+V+LL++N    D     G     PLHL    GH  T ++L+++     +  +   +P++ A K G ++IA+LL+++        GK    P+H+  +  H +IV++L+++        ++G  P+H+A +   V  A+ L+     C+ ++  G     P+H A   GH +++ +L+SK  N+   ++ S  P+HLA ++G   I  +L+     + A   M  + P+H AC +G+  +V+ L+  + ++ A  +  + P+H A ++GH +I  LL+ +  C  +  A +N   P+  A   G+    D+  L+ D
Sbjct:  469 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRM-GFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQ--ASMNGITPLAIAKRLGYISVTDVLSLVTD 824          

HSP 6 Score: 162.54 bits (410), Expect = 4.286e-40
Identity = 102/435 (23.45%), Postives = 195/435 (44.83%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H + ++G  ++V  L+   I  E    + N   LH+A   G +D V+ L+    N+N+  +   +P+Y A +                                  E H  +VK L++   +     +DG  P+ +A + GH  +   LI          GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N    +H A + G+ ++VR+L+DR   I+AC +D   P+H A   GH  I+++L+D    I+A    N   PIH A +  H D  +LL+  +  ++    +   P+  A+  G+  + K+L+++    +A     + PLH AC++ H  +++LL ++G  I+A+T    +P+ +A
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTA-LHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQ----------------------------------ENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK-NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVA 444          

HSP 7 Score: 140.969 bits (354), Expect = 2.451e-33
Identity = 79/324 (24.38%), Postives = 153/324 (47.22%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLM-DRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+V+ L+++    +        P+H     G  +  +LL+DN+        +    PLH+A   G     ++L+E   + N+  +   +P++ A    H+ I +LL+++         +N   P+HM   +   D  + L+            G  P+HLA + GH  +  +L+    ++     K S  P+H A   GH+ I EVL+S + ++ AE    + P+H+AC  G+ ++V+ L+  + ++ A   +  + P+H A + GH  IV +L+ +  C  +A + +   P+  A   G+ ++  +L
Sbjct:  501 KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKK-GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCT-ARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL-GFTPLHQAAQQGHTDIVTLLLKNGACPNQASM-NGITPLAIAKRLGYISVTDVL 819          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 214.542 bits (545), Expect = 8.461e-57
Identity = 116/438 (26.48%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+ +    +    +    PLH+A + GH   VK L++   + N       +P++ A +  H ++A  LI  +  +     K+ + P+H     GH ++V++L++     +     G  P+HL    GH   A++L+D N     S  KK   P+H A   G ++I E+L+ +  +  +  +    P+H+A       IVR+L+++      C   N Y P+H A K       R L+       A       P+H A + GH ++  LL+ ++ ++  G   ++  P+H A + GH +IA++LV     V A     + P+  A   G I++VK L+  + +++A  +  + PLH A ++GHT+IV LL + G      +    +P+ +A
Sbjct:  375 LHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVT-ESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARA-KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD-NQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLG-NKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIA 807          

HSP 2 Score: 213.386 bits (542), Expect = 2.178e-56
Identity = 118/444 (26.58%), Postives = 221/444 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +   I+        P+H A   G   + KLL+D   K +     G     PLH+AC + H   +++L++S  +I+A  E   +P++ A   GH+ I K L+ +     VF  K +  P+HM     H D+   LI     +    KD + P+H A  +GH  + ++L++   + D   +AG     P+H    GGH +  E+L+       +  ++ + P+H+A + G  +I  +L++R+    +  G     P+H A    H  IVR+L+++         + + P+H A ++   + A+ L+     C+ ++  G+    P+H A + GH D+  LL+ ++ +V+   ++   P+  AS+ G++ I ++L++    + A  R  + PLH AC  G+ ++VK L Q   ++ A+T+  ++P+  A
Sbjct:  342 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF---TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVET-PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSA-GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA 774          

HSP 3 Score: 207.994 bits (528), Expect = 1.301e-54
Identity = 122/491 (24.85%), Postives = 232/491 (47.25%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  ++V+ L++H  ++  + +    P++ A ++    +VK L++N  + +    +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  +N    +H+    G+  +V++L+D    I+ C KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+    +I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ +      GA  N +      P+H A    H D+A  L+  K  VNA  ++D  P+  A+  G+ E+V++L+      D        PLH     GHT+  +LL        ++T++ ++P+ +A
Sbjct:   96 ELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKT-KNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNA-RALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK------GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVA 576          

HSP 4 Score: 179.489 bits (454), Expect = 1.711e-45
Identity = 104/420 (24.76%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID--RKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA---------------------------GAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC   H+ +++ L+     I+   E    P+H A   G   IVK L+       +F  +  + PLH+A    H D    LI++   +NA  + +++P++ A + GH E+ +LL++     D     G     P+H+    GH    ++L+D      +  K G  P+H+A + G + IA++L++       SAGK    P+H A    H+ I+ +L++K  +        + P+H+A ++   +  R L+     C+ ++  G+    P+H A + GH  +V +L+ ++ ++    + +  P+H A + GH NIA++L+     + A                            A +N      + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  408 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 5 Score: 174.481 bits (441), Expect = 6.983e-44
Identity = 97/366 (26.50%), Postives = 184/366 (50.27%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI-DRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVD 1291
            K E  +H+A    H ++  FLI +   +  R +  + P+H A   G  E+V+LL++N    D     G     PLHL    GH  T ++L+++     +  +   +P++ A K G ++IA+LL+++        GK    P+H+  +  H +IV++L+++        ++G  P+H+A +   V  A+ L+     C+ ++  G     P+H A   GH +++ +L+SK  N+   ++ S  P+HLA ++G   I  +L+     + A   M  + P+H AC +G+  +V+ L+  + ++ A  +  + P+H A ++GH +I  LL+ +  C  +  A +N   P+  A   G+    D+  L+ D
Sbjct:  469 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRM-GFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQ--ASMNGITPLAIAKRLGYISVTDVLSLVTD 824          

HSP 6 Score: 162.54 bits (410), Expect = 4.622e-40
Identity = 102/435 (23.45%), Postives = 195/435 (44.83%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H + ++G  ++V  L+   I  E    + N   LH+A   G +D V+ L+    N+N+  +   +P+Y A +                                  E H  +VK L++   +     +DG  P+ +A + GH  +   LI          GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N    +H A + G+ ++VR+L+DR   I+AC +D   P+H A   GH  I+++L+D    I+A    N   PIH A +  H D  +LL+  +  ++    +   P+  A+  G+  + K+L+++    +A     + PLH AC++ H  +++LL ++G  I+A+T    +P+ +A
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTA-LHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQ----------------------------------ENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK-NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVA 444          

HSP 7 Score: 140.969 bits (354), Expect = 2.688e-33
Identity = 79/324 (24.38%), Postives = 153/324 (47.22%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLM-DRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+V+ L+++    +        P+H     G  +  +LL+DN+        +    PLH+A   G     ++L+E   + N+  +   +P++ A    H+ I +LL+++         +N   P+HM   +   D  + L+            G  P+HLA + GH  +  +L+    ++     K S  P+H A   GH+ I EVL+S + ++ AE    + P+H+AC  G+ ++V+ L+  + ++ A   +  + P+H A + GH  IV +L+ +  C  +A + +   P+  A   G+ ++  +L
Sbjct:  501 KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKK-GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCT-ARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL-GFTPLHQAAQQGHTDIVTLLLKNGACPNQASM-NGITPLAIAKRLGYISVTDVL 819          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 214.542 bits (545), Expect = 9.760e-57
Identity = 116/438 (26.48%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+ +    +    +    PLH+A + GH   VK L++   + N       +P++ A +  H ++A  LI  +  +     K+ + P+H     GH ++V++L++     +     G  P+HL    GH   A++L+D N     S  KK   P+H A   G ++I E+L+ +  +  +  +    P+H+A       IVR+L+++      C   N Y P+H A K       R L+       A       P+H A + GH ++  LL+ ++ ++  G   ++  P+H A + GH +IA++LV     V A     + P+  A   G I++VK L+  + +++A  +  + PLH A ++GHT+IV LL + G      +    +P+ +A
Sbjct:  338 LHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVT-ESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARA-KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD-NQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLG-NKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIA 770          

HSP 2 Score: 213.001 bits (541), Expect = 2.875e-56
Identity = 118/444 (26.58%), Postives = 221/444 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +   I+        P+H A   G   + KLL+D   K +     G     PLH+AC + H   +++L++S  +I+A  E   +P++ A   GH+ I K L+ +     VF  K +  P+HM     H D+   LI     +    KD + P+H A  +GH  + ++L++   + D   +AG     P+H    GGH +  E+L+       +  ++ + P+H+A + G  +I  +L++R+    +  G     P+H A    H  IVR+L+++         + + P+H A ++   + A+ L+     C+ ++  G+    P+H A + GH D+  LL+ ++ +V+   ++   P+  AS+ G++ I ++L++    + A  R  + PLH AC  G+ ++VK L Q   ++ A+T+  ++P+  A
Sbjct:  305 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF---TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVET-PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSA-GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA 737          

HSP 3 Score: 207.608 bits (527), Expect = 1.598e-54
Identity = 122/491 (24.85%), Postives = 232/491 (47.25%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  ++V+ L++H  ++  + +    P++ A ++    +VK L++N  + +    +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  +N    +H+    G+  +V++L+D    I+ C KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+    +I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ +      GA  N +      P+H A    H D+A  L+  K  VNA  ++D  P+  A+  G+ E+V++L+      D        PLH     GHT+  +LL        ++T++ ++P+ +A
Sbjct:   59 ELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKT-KNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNA-RALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK------GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVA 539          

HSP 4 Score: 179.104 bits (453), Expect = 2.114e-45
Identity = 104/420 (24.76%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID--RKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA---------------------------GAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC   H+ +++ L+     I+   E    P+H A   G   IVK L+       +F  +  + PLH+A    H D    LI++   +NA  + +++P++ A + GH E+ +LL++     D     G     P+H+    GH    ++L+D      +  K G  P+H+A + G + IA++L++       SAGK    P+H A    H+ I+ +L++K  +        + P+H+A ++   +  R L+     C+ ++  G+    P+H A + GH  +V +L+ ++ ++    + +  P+H A + GH NIA++L+     + A                            A +N      + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  371 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 5 Score: 174.096 bits (440), Expect = 9.582e-44
Identity = 97/366 (26.50%), Postives = 184/366 (50.27%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI-DRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVD 1291
            K E  +H+A    H ++  FLI +   +  R +  + P+H A   G  E+V+LL++N    D     G     PLHL    GH  T ++L+++     +  +   +P++ A K G ++IA+LL+++        GK    P+H+  +  H +IV++L+++        ++G  P+H+A +   V  A+ L+     C+ ++  G     P+H A   GH +++ +L+SK  N+   ++ S  P+HLA ++G   I  +L+     + A   M  + P+H AC +G+  +V+ L+  + ++ A  +  + P+H A ++GH +I  LL+ +  C  +  A +N   P+  A   G+    D+  L+ D
Sbjct:  432 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRM-GFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQ--ASMNGITPLAIAKRLGYISVTDVLSLVTD 787          

HSP 6 Score: 162.155 bits (409), Expect = 5.410e-40
Identity = 102/435 (23.45%), Postives = 195/435 (44.83%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H + ++G  ++V  L+   I  E    + N   LH+A   G +D V+ L+    N+N+  +   +P+Y A +                                  E H  +VK L++   +     +DG  P+ +A + GH  +   LI          GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N    +H A + G+ ++VR+L+DR   I+AC +D   P+H A   GH  I+++L+D    I+A    N   PIH A +  H D  +LL+  +  ++    +   P+  A+  G+  + K+L+++    +A     + PLH AC++ H  +++LL ++G  I+A+T    +P+ +A
Sbjct:   15 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTA-LHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQ----------------------------------ENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK-NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVA 407          

HSP 7 Score: 140.584 bits (353), Expect = 2.985e-33
Identity = 79/324 (24.38%), Postives = 153/324 (47.22%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLM-DRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+V+ L+++    +        P+H     G  +  +LL+DN+        +    PLH+A   G     ++L+E   + N+  +   +P++ A    H+ I +LL+++         +N   P+HM   +   D  + L+            G  P+HLA + GH  +  +L+    ++     K S  P+H A   GH+ I EVL+S + ++ AE    + P+H+AC  G+ ++V+ L+  + ++ A   +  + P+H A + GH  IV +L+ +  C  +A + +   P+  A   G+ ++  +L
Sbjct:  464 KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKK-GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCT-ARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL-GFTPLHQAAQQGHTDIVTLLLKNGACPNQASM-NGITPLAIAKRLGYISVTDVL 782          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 214.157 bits (544), Expect = 1.040e-56
Identity = 120/441 (27.21%), Postives = 212/441 (48.07%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAG-CDIEA--LTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+ +    +    +    PLH+A + GH   VK L++   + N       +P++ A +  H ++A  LI  +  +     K+ + P+H     GH ++V++L++     +     G  P+HL    GH   A++L+D N     S  KK   P+H A   G ++I E+L+ +  +  +  +    P+H+A       IVR+L+++      C   N Y P+H A K       R L+       A       P+H A + GH ++  LL+ ++ ++  G   ++  P+H A + GH +IA++LV     V A     + P+  A   G I++VK L+  + +++A  +  + PLH A ++GHT+IV LL + G C  +A  ++    SP +LA
Sbjct:  333 LHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVT-ESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNA-RAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD-NQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLG-NKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMVSALTLSPPQLA 768          

HSP 2 Score: 213.001 bits (541), Expect = 2.676e-56
Identity = 118/444 (26.58%), Postives = 221/444 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +   I+        P+H A   G   + KLL+D   K +     G     PLH+AC + H   +++L++S  +I+A  E   +P++ A   GH+ I K L+ +     VF  K +  P+HM     H D+   LI     +    KD + P+H A  +GH  + ++L++   + D   +AG     P+H    GGH +  E+L+       +  ++ + P+H+A + G  +I  +L++R+    +  G     P+H A    H  IVR+L+++         + + P+H A ++   + A+ L+     C+ ++  G+    P+H A + GH D+  LL+ ++ +V+   ++   P+  AS+ G++ I ++L++    + A  R  + PLH AC  G+ ++VK L Q   ++ A+T+  ++P+  A
Sbjct:  300 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF---TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVET-PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSA-GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA 732          

HSP 3 Score: 207.608 bits (527), Expect = 1.586e-54
Identity = 122/491 (24.85%), Postives = 232/491 (47.25%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  ++V+ L++H  ++  + +    P++ A ++    +VK L++N  + +    +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  +N    +H+    G+  +V++L+D    I+ C KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+    +I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ +      GA  N +      P+H A    H D+A  L+  K  VNA  ++D  P+  A+  G+ E+V++L+      D        PLH     GHT+  +LL        ++T++ ++P+ +A
Sbjct:   54 ELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKT-KNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNA-RALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK------GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVA 534          

HSP 4 Score: 170.244 bits (430), Expect = 1.367e-42
Identity = 98/370 (26.49%), Postives = 183/370 (49.46%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI-DRKCDIEAG-AGLNNWRPIHFACERGHKDIAKLLVDRKCDVN 1309
            K E  +H+A    H ++  FLI +   +  R +  + P+H A   G  E+V+LL++N    D     G     PLHL    GH  T ++L+++     +  +   +P++ A K G ++IA+LL+++        GK    P+H+  +  H +IV++L+++        ++G  P+H+A +   V  A+ L+     C+ ++  G     P+H A   GH +++ +L+SK  N+   ++ S  P+HLA ++G   I  +L+     + A   M  + P+H AC +G+  +V+ L+  + ++ A  +  + P+H A ++GH +I  LL+ +  C  +A         P   A ER H+      +D   DV+
Sbjct:  427 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRM-GFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMVSALTLSPPQLANER-HRMSFPETMDEPMDVS 787          

HSP 5 Score: 162.155 bits (409), Expect = 5.508e-40
Identity = 101/425 (23.76%), Postives = 191/425 (44.94%), Query Frame = 2
Query:  281 IDH---NVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +DH    VDI   ++     +H + ++G  ++V  L+   I  E    + N   LH+A   G +D V+ L+    N+N+  +   +P+Y A +                                  E H  +VK L++   +     +DG  P+ +A + GH  +   LI          GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N    +H A + G+ ++VR+L+DR   I+AC +D   P+H A   GH  I+++L+D    I+A    N   PIH A +  H D  +LL+  +  ++    +   P+  A+  G+  + K+L+++    +A     + PLH AC++ H  +++LL ++G  I+A+T    +P+ +A
Sbjct:   20 LDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTA-LHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQ----------------------------------ENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK-NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVA 402          

HSP 6 Score: 141.354 bits (355), Expect = 1.726e-33
Identity = 83/334 (24.85%), Postives = 153/334 (45.81%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLM-DRKCDIEACIED--NWRPIHFACERGHRNIAKLLIDRKCDIE 1207
            + D+  +H A   GH E+V+ L+++    +        P+H     G  +  +LL+DN+        +    PLH+A   G     ++L+E   + N+  +   +P++ A    H+ I +LL+++         +N   P+HM   +   D  + L+            G  P+HLA + GH  +  +L+    ++     K S  P+H A   GH+ I EVL+S + ++ AE    + P+H+AC  G+ ++V+ L+  + ++ A   +  + P+H A + GH  IV +L+ +  C  +A +       P   A ER HR      +D   D+ 
Sbjct:  459 KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKK-GFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHC-TARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL-GFTPLHQAAQQGHTDIVTLLLKNGACPNQASMVSALTLSPPQLANER-HRMSFPETMDEPMDVS 787          

HSP 7 Score: 135.191 bits (339), Expect = 1.407e-31
Identity = 85/370 (22.97%), Postives = 172/370 (46.49%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ + K GHV++   L+ +   ++    K     +H+    G  D+V+ L++   ++ +  + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LIS       + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R  ++    ++    +H A  RG+  + +LL+DR   I+A    +   P+H A   GH  I+++L+D    + A  +N   PI  AS+  +++ V++L+  +  ID        PLH A   GH  + KLL   G    A     ++P+ +A
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTA-LHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLE-NGANQNLATEDGFTPLAVALQQGHENVVAYLISYGM----KGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTG---FTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTK-DELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIA 369          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 214.157 bits (544), Expect = 1.260e-56
Identity = 116/438 (26.48%), Postives = 208/438 (47.49%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+ +    +    +    PLH+A + GH   VK L++   + N       +P++ A +  H ++A  LI  +  +     K+ + P+H     GH ++V++L++     +     G  P+HL    GH   A++L+D N     S  KK   P+H A   G ++I E+L+ +  +  +  +    P+H+A       IVR+L+++      C   N Y P+H A K       R L+       A       P+H A + GH ++  LL+ ++ ++  G   ++  P+H A + GH +IA++LV     V A     + P+  A   G I++VK L+  + +++A  +  + PLH A ++GHT+IV LL + G      +    +P+ +A
Sbjct:  300 LHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVT-ESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARA-KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLD-NQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPH-CTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLG-NKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIA 732          

HSP 2 Score: 213.001 bits (541), Expect = 3.273e-56
Identity = 118/444 (26.58%), Postives = 221/444 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--RKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +   I+        P+H A   G   + KLL+D   K +     G     PLH+AC + H   +++L++S  +I+A  E   +P++ A   GH+ I K L+ +     VF  K +  P+HM     H D+   LI     +    KD + P+H A  +GH  + ++L++   + D   +AG     P+H    GGH +  E+L+       +  ++ + P+H+A + G  +I  +L++R+    +  G     P+H A    H  IVR+L+++         + + P+H A ++   + A+ L+     C+ ++  G+    P+H A + GH D+  LL+ ++ +V+   ++   P+  AS+ G++ I ++L++    + A  R  + PLH AC  G+ ++VK L Q   ++ A+T+  ++P+  A
Sbjct:  267 IHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGF---TPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVET-PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSA-GKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQA 699          

HSP 3 Score: 207.223 bits (526), Expect = 1.971e-54
Identity = 122/491 (24.85%), Postives = 232/491 (47.25%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  ++V+ L++H  ++  + +    P++ A ++    +VK L++N  + +    +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  +N    +H+    G+  +V++L+D    I+ C KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+    +I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ +      GA  N +      P+H A    H D+A  L+  K  VNA  ++D  P+  A+  G+ E+V++L+      D        PLH     GHT+  +LL        ++T++ ++P+ +A
Sbjct:   21 ELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGAN-QNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKT-KNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNAR-ALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK------GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVA 501          

HSP 4 Score: 184.496 bits (467), Expect = 3.943e-47
Identity = 106/442 (23.98%), Postives = 208/442 (47.06%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKC--DIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   G++ +V+ L+D    I+   + +  P+H A   G   I ++L+D+    +    +    P+H+A    H D V++L++   +I+     + +P++ A   GH  +AKLL+D+  + + +   G     P+H+ C + H  ++++L+     I+   + G  P+H+A   GH+ I K L+         +  K   P+H A    H ++ + LI     + A  ++   P+H A   G  E+VR+L++     D     G   + P+H   + GH     +L+D +    +  +  + P+H A + G   IA+LL++R+    + AG     P+H A    H +I +LL+++    +    N + P+  A ++  ++  + L+      +A       PLH A + GH ++V LL     ++    +   +P+ LA
Sbjct:  201 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQA-KTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFT---PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFS-VKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLA 633          

HSP 5 Score: 178.718 bits (452), Expect = 2.741e-45
Identity = 104/420 (24.76%), Postives = 190/420 (45.24%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLID--RKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA---------------------------GAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC   H+ +++ L+     I+   E    P+H A   G   IVK L+       +F  +  + PLH+A    H D    LI++   +NA  + +++P++ A + GH E+ +LL++     D     G     P+H+    GH    ++L+D      +  K G  P+H+A + G + IA++L++       SAGK    P+H A    H+ I+ +L++K  +        + P+H+A ++   +  R L+     C+ ++  G+    P+H A + GH  +V +L+ ++ ++    + +  P+H A + GH NIA++L+     + A                            A +N      + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  333 LHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-ETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHT---PLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPN-SAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 6 Score: 174.096 bits (440), Expect = 1.032e-43
Identity = 97/366 (26.50%), Postives = 184/366 (50.27%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI-DRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVD 1291
            K E  +H+A    H ++  FLI +   +  R +  + P+H A   G  E+V+LL++N    D     G     PLHL    GH  T ++L+++     +  +   +P++ A K G ++IA+LL+++        GK    P+H+  +  H +IV++L+++        ++G  P+H+A +   V  A+ L+     C+ ++  G     P+H A   GH +++ +L+SK  N+   ++ S  P+HLA ++G   I  +L+     + A   M  + P+H AC +G+  +V+ L+  + ++ A  +  + P+H A ++GH +I  LL+ +  C  +  A +N   P+  A   G+    D+  L+ D
Sbjct:  394 KVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAG---HTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNS-AGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVT---PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRM-GFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQ--ASMNGITPLAIAKRLGYISVTDVLSLVTD 749          

HSP 7 Score: 161.77 bits (408), Expect = 8.117e-40
Identity = 91/371 (24.53%), Postives = 177/371 (47.71%), Query Frame = 2
Query:  434 LHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            LHL+  EGH   V  L+  +  +    +   + ++ A   G  ++ + L++   ++     K    P++M   E H  +VK L++   +     +DG  P+ +A + GH  +   LI          GK     +H A          VL+  + N +   +  + P+H+A    +  + ++L++R  ++      N    +H A + G+ ++VR+L+DR   I+AC +D   P+H A   GH  I+++L+D    I+A    N   PIH A +  H D  +LL+  +  ++    +   P+  A+  G+  + K+L+++    +A     + PLH AC++ H  +++LL ++G  I+A+T    +P+ +A
Sbjct:    7 LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFT-PLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTK-NGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVA 369          

HSP 8 Score: 140.584 bits (353), Expect = 3.503e-33
Identity = 79/324 (24.38%), Postives = 153/324 (47.22%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLM-DRKCDIEACIEDNWRPIHFACERGHRNIAKLL 1183
            + D+  +H A   GH E+V+ L+++    +        P+H     G  +  +LL+DN+        +    PLH+A   G     ++L+E   + N+  +   +P++ A    H+ I +LL+++         +N   P+HM   +   D  + L+            G  P+HLA + GH  +  +L+    ++     K S  P+H A   GH+ I EVL+S + ++ AE    + P+H+AC  G+ ++V+ L+  + ++ A   +  + P+H A + GH  IV +L+ +  C  +A + +   P+  A   G+ ++  +L
Sbjct:  426 KDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSM-TKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCT-ARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHL-GNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL-GFTPLHQAAQQGHTDIVTLLLKNGACPNQASM-NGITPLAIAKRLGYISVTDVL 744          

HSP 9 Score: 124.405 bits (311), Expect = 3.364e-28
Identity = 72/309 (23.30%), Postives = 147/309 (47.57%), Query Frame = 2
Query:  620 NKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            N  + +H+   EGH  +V  L+ ++  +ET  K G   +H+A   G   + + L++   ++  S  +K   P++ A    H+ +++ L+    N     E+ + P+ +A ++G + +V  LI          G      +H A +        +L+    + +   +  + P+H A    + N+A+LL++R  ++      N    +H A  RG+  + +LL+DR   ++AC +++  P+  A   G++ I +IL++    I A  +    P+H A +  H + V+LL Q    I+ +T +  +P+ +A
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVN-SQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQ-NGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVA 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 209.534 bits (532), Expect = 1.358e-55
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  346 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 2 Score: 198.749 bits (504), Expect = 4.162e-52
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   67 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 547          

HSP 3 Score: 197.208 bits (500), Expect = 1.370e-51
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  313 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 745          

HSP 4 Score: 190.66 bits (483), Expect = 2.219e-49
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   53 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 478          

HSP 5 Score: 163.696 bits (413), Expect = 8.804e-41
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  440 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 800          

HSP 6 Score: 132.88 bits (333), Expect = 3.803e-31
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   23 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 382          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 208.764 bits (530), Expect = 5.877e-55
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  375 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 807          

HSP 2 Score: 198.364 bits (503), Expect = 1.333e-51
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   96 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 576          

HSP 3 Score: 196.438 bits (498), Expect = 5.655e-51
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  342 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 774          

HSP 4 Score: 190.66 bits (483), Expect = 4.053e-49
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   82 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 507          

HSP 5 Score: 174.866 bits (442), Expect = 4.383e-44
Identity = 105/403 (26.05%), Postives = 182/403 (45.16%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK          +Q PLH A   GH   VK+L+E+  + N       +P++ A + GHV+ A  L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     +E+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  424 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKD-DQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQAN--GNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 819          

HSP 6 Score: 164.081 bits (414), Expect = 9.590e-41
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  469 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 829          

HSP 7 Score: 132.494 bits (332), Expect = 7.510e-31
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 411          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 207.608 bits (527), Expect = 1.231e-54
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  346 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 778          

HSP 2 Score: 197.208 bits (500), Expect = 2.981e-51
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   67 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 547          

HSP 3 Score: 195.667 bits (496), Expect = 9.586e-51
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  313 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 745          

HSP 4 Score: 189.504 bits (480), Expect = 8.260e-49
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   53 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 478          

HSP 5 Score: 163.696 bits (413), Expect = 1.468e-40
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  440 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 800          

HSP 6 Score: 131.724 bits (330), Expect = 1.269e-30
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   23 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 382          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 207.608 bits (527), Expect = 1.237e-54
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  338 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 2 Score: 197.593 bits (501), Expect = 2.484e-51
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   59 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 539          

HSP 3 Score: 195.282 bits (495), Expect = 1.204e-50
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  305 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 737          

HSP 4 Score: 189.504 bits (480), Expect = 8.600e-49
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   45 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 470          

HSP 5 Score: 174.096 bits (440), Expect = 7.139e-44
Identity = 105/403 (26.05%), Postives = 182/403 (45.16%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK          +Q PLH A   GH   VK+L+E+  + N       +P++ A + GHV+ A  L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     +E+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  387 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKD-DQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQAN--GNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          

HSP 6 Score: 163.696 bits (413), Expect = 1.305e-40
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  432 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 792          

HSP 7 Score: 131.724 bits (330), Expect = 1.251e-30
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   15 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 374          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 207.608 bits (527), Expect = 1.293e-54
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  338 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 2 Score: 197.208 bits (500), Expect = 2.644e-51
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   59 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 539          

HSP 3 Score: 195.282 bits (495), Expect = 1.203e-50
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  305 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 737          

HSP 4 Score: 189.504 bits (480), Expect = 8.521e-49
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   45 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 470          

HSP 5 Score: 174.096 bits (440), Expect = 6.891e-44
Identity = 105/403 (26.05%), Postives = 182/403 (45.16%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK          +Q PLH A   GH   VK+L+E+  + N       +P++ A + GHV+ A  L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     +E+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  387 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKD-DQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQAN--GNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          

HSP 6 Score: 164.081 bits (414), Expect = 1.206e-40
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  432 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 792          

HSP 7 Score: 131.724 bits (330), Expect = 1.306e-30
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   15 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 374          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 218.009 bits (554), Expect = 4.262e-57
Identity = 119/440 (27.05%), Postives = 212/440 (48.18%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+  +  +     K+ + P+H     GH ++VK+L++ N +       G  P+H+A   GHV     L++     +A   KK   P+H A   G V + E+L+ ++ +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++ +  +P+ +A
Sbjct:  342 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLT---PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 2 Score: 209.92 bits (533), Expect = 1.808e-54
Identity = 125/489 (25.56%), Postives = 235/489 (48.06%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  +  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K  VNA  ++D  P+  A+  G+  +VK+L+    + +        PLH A   GH E V  L +       +T++ ++P+ +A
Sbjct:   63 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVA 543          

HSP 3 Score: 194.512 bits (493), Expect = 1.667e-49
Identity = 118/437 (27.00%), Postives = 213/437 (48.74%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE + ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q    + A  +++ +P+
Sbjct:   49 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPL 474          

HSP 4 Score: 183.341 bits (464), Expect = 5.453e-46
Identity = 107/403 (26.55%), Postives = 184/403 (45.66%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK        + +Q PLH A   GH + VK+L+E+N N N       +P++ A + GHVE    L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     VE+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    +   P+  A   GYI +  +L
Sbjct:  391 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-QACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN--GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 5 Score: 173.326 bits (438), Expect = 8.583e-43
Identity = 113/437 (25.86%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+L+     + + VDI   ++     +H A ++G  ++V  L+  +I  E    + N   LH+A   G  + V+ L+    N+NA  +   +P+Y A +  H+E+ K L++   + Q    ++   P+ +   +GH ++V  LI+      T  K     +H+A  N     A +L+  D N D+ +  G     P+H A    ++ + ++L+++  ++    +    P+H+A  +G+  +VR+L+DR   IE     +   P+H A + GH  I  +L+D    I+A  ++   PIH A +  H +  +LL+    +I+    L++  P+H A   GH  +AK+L+D+    N+   N + P+  A ++ ++ ++++L+     IDA       PLH A   GH  IVK L Q G        +  +P+ +A
Sbjct:   19 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTA-LHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGAN-QNVATEDGFTPLAVALQQGHENVVAHLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKT-KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEID-DITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA 444          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 7.492e-54
Identity = 120/440 (27.27%), Postives = 206/440 (46.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    +++LL+      +    +    PLH+A + GH   VK L++   + N  +    +P++ A + GH E+AK L+ Q         K+ + P+H     GH  +VK+L++           G  P+H A   GHV  A  L++     +A   KK   P+H A   G V + E+L+  + +  A  +    P+H+A    + +IV++L+ R     +    N Y P+H A K     + R L+       A       P+H A + GH  +  LL+ ++ +   G  +GL    P+H   + GH  +A +L+     V+A     + P+  AS  G I++VK L+  + D++A  +  + PLH A ++GHT+IV LL + G     ++    +P+ +A
Sbjct:  338 LHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVT-ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLL-QNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP-AWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLT---PLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIA 770          

HSP 2 Score: 197.593 bits (501), Expect = 1.547e-50
Identity = 123/489 (25.15%), Postives = 232/489 (47.44%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKD-----------------------------TVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +K  + E   +K    +H+A   G  E+V+ L+++  ++  + +    P++ A ++   E+VK L++N  +  +   +    PL +A  +GH++                             T  +L++++ N +   +   +P++ A    ++ +A+LL+++   +  F  +N   P+H+    G+  +V++L+D    IET  KD   P+H A  NGHV I++IL+D    I+A   K    PIH A  G H++ + +L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     I+A  E    P+H A   GH  I K L+ R     A   ++N +   P+H A   GH ++AK L+  K   NA  ++D  P+  A+  G+  +VK+L+      +        PLH A   GH +    L +       +T++ ++P+ +A
Sbjct:   59 ELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNV-ATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVN-FTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRG----ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVA 539          

HSP 3 Score: 195.667 bits (496), Expect = 7.234e-50
Identity = 116/442 (26.24%), Postives = 213/442 (48.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    HL+ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   +++L+++  +I+A  E   +P++ A   GH+ I K L+ +     V   K +  P+HM    GH ++ K L+          KD + P+H A   GH  + K+L++   + ++  +AG     P+H A   GHV+    L+ K  +     ++ + P+H+A + G   +  +L++      A  G N   P+H A    +  IV++L+ R     +   + + P+H A ++    +A+ L+       A + +    P+H A + GH ++  LL+ ++ + N   ++   P+   S+ G++ +  +LI     +DA  R  + PLH A   G+ ++VK L Q   D+ A T+  YSP+  A
Sbjct:  305 IHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGF---TPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVET-PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHT---PLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQA 737          

HSP 4 Score: 189.889 bits (481), Expect = 4.860e-48
Identity = 118/437 (27.00%), Postives = 211/437 (48.28%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNK-RHP-IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +HLA   GH+++V  L+   + +E   +     +H A   GQ E+V+ L++   +      Q    PL++A  E H + VK L+E+  N N   E   +P+  A ++GH  +   LI+       +G K K R P +H+           +L+  + + +   K G  P+H+A    ++ +A++L++    +  +  +    P+H A   G+V ++ +L+ +   IE   ++   P+H A   G   I  +L+D    I+A    N   PIH A +  H   VR+L+    +I+    D+  P+H A   GH  +AK+L+D+     + A LN + P+H AC++ H  + +LL+     ++A  E+   P+  AS  G++ IVK L+ +    +  +     PLH A   GHTE+ K L Q      A  +++ +P+
Sbjct:   45 LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN-------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP-QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKT-KNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPL 470          

HSP 5 Score: 174.481 bits (441), Expect = 4.376e-43
Identity = 105/403 (26.05%), Postives = 182/403 (45.16%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVG-MNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L     +D   E    PL H+A   GHL IVK L+       + +     P+H A   G  E+ K L+ NK          +Q PLH A   GH   VK+L+E+  + N       +P++ A + GHV+ A  L+++    Q    K    P+H+    G   + ++L++ +       K+G  P+H+A  + ++ I K+L+       + A      P+H A     +E+   L+    +  AE  +   P+HLA ++G  E+V +L+ ++ +    +G  +   P+H   + GH  +  +L+     ++A     + P+H A   G+  + K L+  + D+ A   L  + P+H A ++GH DI  LL+      N    N   P+  A   GYI +  +L
Sbjct:  387 LKTGASIDAVTESGLTPL-HVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKD-DQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEAS-QACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWN-GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQAN--GNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLG-YSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 782          

HSP 6 Score: 164.081 bits (414), Expect = 7.530e-40
Identity = 97/366 (26.50%), Postives = 172/366 (46.99%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGH---KDIAKLLVDRKCDV 1306
            K E  +H+A   GH E+ K+L+ +      + +  + P+H A   G   +VKLL++N     +        PLH A  EGH DT   L+E   +     +   +P++ A K G V +A+LL++         GKN   P+H+     + DIVK+L+       +   +G  P+H+A +   + +A+ L+       A +  +   P+H A   GH E++ +L+SK  N    ++    P+HL  ++G   +  +LI     ++A   M  Y P+H A  +G+  +V+ L+  + D+ A  +  + P+H A ++GH +I  LL+         +  N   P+  A   G+    D+ K++ D    V
Sbjct:  432 KVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNL-ATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNA-AGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAES-VQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRM-GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSS-NGTTPLAIAKRLGYISVTDVLKVVTDETSVV 792          

HSP 7 Score: 132.109 bits (331), Expect = 8.100e-30
Identity = 83/370 (22.43%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D     + +  +IN C++   + ++ A K GHV++   L+ +   ++    K     +H+    G  ++V+ L++   ++    + G  P+++A +  H+ + K L++ N   +  A +    P+  A   GH  ++  LI    N   + +     +H+A    D     +L+  D   D+ +  G   + P+H A  + +  + ++L++R   +    ++   P+H A  RG+  + +LL+DR   IE     +   P+H A   GH  I+++L+D    + A  +N   PI  A++  +++ V++L+    +ID        PLH A   GH  + K+L   G    +     ++P+ +A
Sbjct:   15 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNT-ALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE-NGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTK-DELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA 374          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.290e-52
Identity = 114/440 (25.91%), Postives = 219/440 (49.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+E+V  L+    +++   +     +H A   GQAE+VK+L+ N  +      Q    PL++A  E H + V+ L+++  + +   E   +P+  A ++GH ++  LL++         GK +   +H+   +       +L+  D N D+E+  K G  P+H+A   G++ +A +L++    ++ +A +    P+H A   G+  ++++L+ +   I+A+  +   P+H     G +++V ML+DR   I +    N   P+H A +  H   V++L+     ++    D    +H A   GH  +AK+L+D+K    A A LN + P+H AC++    + +LL+     + A  E+   PI  A+  G++ IV  L++     +  +      LH A   G  E+V+ L Q G  +EA  +++ +P+ ++
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKAAALLLQNDTNADVES--KSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKA-LNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHIS 489          

HSP 2 Score: 202.601 bits (514), Expect = 3.453e-52
Identity = 111/485 (22.89%), Postives = 220/485 (45.36%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID-------------NKIDFEIFGGQWN--------QCP-----------LHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            L N+    ++  R D   +H+A   G+  +VK L+D    I+ +      P+H     G  ++V++L+D             + +     G   N          P           LH+A   GH    K+L++   + NA      +P++ ACK+  + + +LL+     IQ    ++   PIH+  F GH +IV  L+       T +  G+  +H+A  +G   + + L+     +EA A K  + P+H +   G  +I++ L+ +  +  A     + P+HLA  +G +++   L+D    + +      + P+H A K+G   +  +L+ +    +A  +    P+H A    ++ +A LL+D+     A A  N + P+H A ++   DIA  L++   D NA        +  A++ G++++V +L+++  +++  ++    PLH A +     + ++L   G  ++A T+  Y+P+
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV-TESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA-KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL 717          

HSP 3 Score: 198.364 bits (503), Expect = 9.173e-51
Identity = 114/476 (23.95%), Postives = 217/476 (45.59%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE-----------------------------SNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +K    +H+A   G  E+VK L+ +  ++  + +    P++ A ++   E+V+ L+DN    +    +    PL +A  +GH   V +L+E                             ++ N +   +   +P++ A   G++ +A LL+++   +  F  +N   P+H+    G+A++VK+L+D    I+   +DG  P+H    +GH  + ++L+D +  I  S  K    P+H A  G H+  +++L+  N  ++    +    +H+A   G  ++ ++L+D+K    A   +N + P+H ACK     ++ +L+     I+A  E    PIH A   GH NI   L+       A     N R    +H A   G  ++ + LV     V A  ++D  P+  ++  G  +IV+ L+ Q    +A     + PLH A   GH ++   L   G  +   T++ ++P+ +A
Sbjct:   88 KKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS-QSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD-FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAK-ALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG----ASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVA 555          

HSP 4 Score: 197.208 bits (500), Expect = 2.084e-50
Identity = 110/471 (23.35%), Postives = 211/471 (44.80%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRP---------------------------------IHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H     GH ++V+ L+D +  I  + +    P+H A +      V+LL+ + +  +     +    LH+A   GH    K+L++   + NA      +P++ ACK+  + + +LL+     IQ    ++   PIH+  F GH +IV  L+       T +  G+  +H+A  +G   + + L+     +EA A K  + P+H +   G  +I++ L+ +  +  A     + P+HLA  +G +++   L+D    + +      + P+H A K+G   +  +L+ +    +A  +    P+H A    ++ +A LL+D+     A A  N + P                                 +H A + GH D+  LL+ R  +VN   ++   P+  A++   + + ++L+NQ   +DA  +  + PLH  C  G+ +IV  L Q    + A T+  Y+ +  A
Sbjct:  288 LHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTA-LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVT-ESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKA-KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASL-SITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA 753          

HSP 5 Score: 177.178 bits (448), Expect = 4.899e-44
Identity = 100/402 (24.88%), Postives = 192/402 (47.76%), Query Frame = 2
Query:  341 ACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G  E     I N +D  I   Q     LHLA  EGH + V  L++   N++A  +   + ++ A   G  E+ K+L+    ++     +N   P++M   E H ++V+ L+D         +DG  P+ +A + GH  +  +L++ +     + GK     +H A      +   +L+  + N + E +  + P+H+A   G+  +  +L++R   ++     N+  P+H A K G+  +V++L+DR   I+A   D   P+H     GH  + ++L+DR   I +    N   P+H A +  H +  +LL+     V+    +    +  A+  G+ ++ K+L+++K   +A     + PLH AC++    +++LL + G  I+A+T    +P+ +A
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICN-QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNA-QSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEND-----TKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD-FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTK-NGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVA 423          

HSP 6 Score: 170.629 bits (431), Expect = 7.217e-42
Identity = 94/417 (22.54%), Postives = 190/417 (45.56%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLL 1483
            +H+AC    + +++ L+ H   I+   E    PIH A   G   IV  L+ +         +  +  LH+A   G  + V+ L++    + A  + +++P++ + + G  +I + L+ Q          +   P+H+   EGH D+   L+D    +    K G  P+H+A + G + +A +L+  +   +A AGK    P+H A    + ++  +L+ +  +  A  +  + P+H+A +K   +I   L++   D  A V       +H A + GH  +V +L+ R  ++    +    P+H A +    N+A++L+++   ++A   +  + P+H  C  G+  I   L+     VNA  +N +  +  A+++G+  I+ +L+      +         L  A   G+  +V  L
Sbjct:  387 LHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVR-GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNA-ATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA-AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANA-VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMG-YTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|Q5URB9|YR840_MIMIV (Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R840 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 8.152e-49
Identity = 137/440 (31.14%), Postives = 211/440 (47.95%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI----ESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEA 1510
            +  +D   I LAC+ GH+E+VK+LID+ VD  IR E K   +  AC  G  +IVKLLI    +       ++ C +  A   GH + VKIL+    +S  N N        P+  A K GH+E+ K L+ Q  RC             I      GH +IVK L     +I     D    I +A  NGH+ + K L+   C+I +         + +A   GH+E++E L+S+  +I++E + S R    A + G  E+V+ L+ +  +I     +N+Y  + +A + GH  +V  L+ +  +I     DN  P+  AC +GH  + K L+    DI     +NN++P+  A   GH +I K LV +  +V + +      I      GY EIVK L++   DI+  D    R    A E GH +IVK L + G ++ A
Sbjct:  105 IRSRDNFAIKLACEHGHIEVVKYLIDNGVD--IRSE-KNYAVRIACNNGHIDIVKLLISKGANIR----DYDNCAIKWASENGHIEIVKILVSQGYDSTSNFN-------EPVILAVKNGHLEVVKYLVSQSDRC--------RNNSAIISAAENGHIEIVKFLASRGSNIRI---DDDYTIRIASGNGHLEVVKFLVSKGCNIRSEID----HAVQWASTNGHLEVVEYLVSQGADIKSEYDRSVR---CASQNGHIEVVKYLVSQGANIR---NINDY-AVRYASENGHIEVVEYLVSQGANIRV---DNDSPLLRACLKGHIKVVKFLVSSGADIR----VNNYQPLLIAAGNGHLEILKYLVSQGVNV-SIINVPLVGIACIDGYGYFEIVKYLVSIGADINLADDMAIR---LASEYGHLDIVKYLVENGANVRA 497          

HSP 2 Score: 147.902 bits (372), Expect = 3.743e-36
Identity = 108/389 (27.76%), Postives = 186/389 (47.81%), Query Frame = 2
Query:  422 NQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGK------------------------KSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALT 1516
            N+C L ++C  G  D VK  +    NI + D      I  AC+ GH+E+ K LID   DI+      K + + + C  GH DIVK+LI +  +I   D      I  A ENGH+ I KIL+    D  ++  +                        ++   I  A   GH+EI++ L S+  NI  +D+ + R   +A   G  E+V+ L+ + C+I + +       + +A   GH  +V  L+ +  DI++  +   R +  A + GH  + K L+ +  +I     +N++  + +A E GH ++ + LV +  ++   V+ND  P++ A  +G+I++VK L++   DI   +   ++PL  A   GH EI+K L   G ++  + 
Sbjct:   80 NEC-LFISCKRGRNDFVKYFVSKGANIRSRDNF---AIKLACEHGHIEVVKYLIDNGVDIR----SEKNYAVRIACNNGHIDIVKLLISKGANIRDYDN---CAIKWASENGHIEIVKILVSQGYDSTSNFNEPVILAVKNGHLEVVKYLVSQSDRCRNNSAIISAAENGHIEIVKFLASRGSNIRIDDDYTIR---IASGNGHLEVVKFLVSKGCNIRSEID----HAVQWASTNGHLEVVEYLVSQGADIKSEYD---RSVRCASQNGHIEVVKYLVSQGANIR---NINDY-AVRYASENGHIEVVEYLVSQGANIR--VDND-SPLLRACLKGHIKVVKFLVSSGADIRVNN---YQPLLIAAGNGHLEILKYLVSQGVNVSIIN 437          

HSP 3 Score: 106.686 bits (265), Expect = 1.181e-22
Identity = 91/334 (27.25%), Postives = 155/334 (46.41%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID------NKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDK--EIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR 1192
            R +  +I  A + GH+EIVKFL     +I I D++    I  A   G  E+VK L+       ++ID  +   QW       A   GH + V+ L+    +I +  E +RS +  A + GH+E+ K L+ Q  +I+        + +      GH ++V+ L+ +  +I     D   P+  AC  GH+ + K L+    DI  +    + +P+  A   GH+EIL+ L+S+  N+   +      + +AC  G    EIV+ L+    DI     M     I  A ++GH  IV+ L++   ++ A   +N   I  A  +GH+ +   L+ +
Sbjct:  226 RNNSAIIS-AAENGHIEIVKFLASRGSNIRIDDDY---TIRIASGNGHLEVVKFLVSKGCNIRSEIDHAV---QW-------ASTNGHLEVVEYLVSQGADIKS--EYDRS-VRCASQNGHIEVVKYLVSQGANIRNI----NDYAVRYASENGHIEVVEYLVSQGANIRV---DNDSPLLRACLKGHIKVVKFLVSSGADIRVN----NYQPLLIAAGNGHLEILKYLVSQGVNVSIINVP---LVGIACIDGYGYFEIVKYLVSIGADINLADDM----AIRLASEYGHLDIVKYLVENGANVRA---ENDYAIKQAHRKGHQEVVNYLLSK 521          
BLAST of Protein kinase domain-containing protein vs. UniProt
Match: sp|Q5UR04|YR911_MIMIV (Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R911 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.929e-48
Identity = 120/418 (28.71%), Postives = 204/418 (48.80%), Query Frame = 2
Query:  245 CDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGC 1498
            C    LEIVKFL+    DI   +++    +  + + G  E+VK L++   D        N   +  A   GH + VK L+    NI A    N   I  A   G++E+ K L+ Q  DI+     +  + + M    GH ++V+ L+ +  +I +   D    + LA +NGH+ + K L+    DI++     +   +  A   GH+E++E L+++  NI   +      +  A + G+ E+V+ LI +  DI   +  NN+  + +A + GH  +V+ L+    DI++   DN   + +A   GH  + K L+ +  DI     + N   + +A   GH D+ K LV +  D+ +  +ND+  + WASE G++E+VK L++   DI A D +  R   WA E+GH E+V+ L   G 
Sbjct:   88 CGENQLEIVKFLVSLGADIRAGNDY---AVGLSSQNGHLEVVKYLVNQGSDIR----AENDYAVRWASGNGHLEVVKYLVSQGANIRAD---NDHAIGLASYYGYLEVVKYLVSQGADIR----SDNDYAVRMASRNGHIEVVEYLVSQGANIRS---DNDYAVRLASQNGHLEVVKYLVSQGADIKSD----NDYAVRLASQNGHLEVVEYLVTQGTNIRVNNN---YAVEWASKNGNLEVVKYLISQGADI---IADNNF-AVRWASRNGHLEVVKYLVSLGADIKS---DNDYAVRWASGNGHLEVVKYLVSQGSDIR----VENDYAVRWASRNGHFDVIKYLVSQGADIRS--DNDY-AVKWASENGHLEVVKFLVSLGADIKAEDDYAVR---WASEKGHLEVVEYLVSQGA 464          

HSP 2 Score: 171.014 bits (432), Expect = 1.977e-44
Identity = 110/389 (28.28%), Postives = 198/389 (50.90%), Query Frame = 2
Query:  344 CEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEA 1510
            C + Q EIVK L+   +  +I  G  N   + L+   GH + VK L+    +I A    N   + +A   GH+E+ K L+ Q  +I+     +  H I +  + G+ ++VK L+ +  DI +   D    + +A  NGH+ + + L+    +I +     +   +  A   GH+E+++ L+S+  +I+++++ + R   LA + G  E+V  L+ +  +I     +NN   + +A K G+  +V+ L+ +  DI   I DN   + +A   GH  + K L+    DI++    +N   + +A   GH ++ K LV +  D+   VEND+  + WAS  G+ +++K L++Q  DI + + +    + WA E GH E+VK L   G DI+A
Sbjct:   88 CGENQLEIVKFLV--SLGADIRAG--NDYAVGLSSQNGHLEVVKYLVNQGSDIRAE---NDYAVRWASGNGHLEVVKYLVSQGANIR----ADNDHAIGLASYYGYLEVVKYLVSQGADIRS---DNDYAVRMASRNGHIEVVEYLVSQGANIRSD----NDYAVRLASQNGHLEVVKYLVSQGADIKSDNDYAVR---LASQNGHLEVVEYLVTQGTNIR----VNNNYAVEWASKNGNLEVVKYLISQGADI---IADNNFAVRWASRNGHLEVVKYLVSLGADIKS----DNDYAVRWASGNGHLEVVKYLVSQGSDIR--VENDY-AVRWASRNGHFDVIKYLVSQGADIRSDNDY---AVKWASENGHLEVVKFLVSLGADIKA 438          

HSP 3 Score: 125.561 bits (314), Expect = 4.267e-29
Identity = 88/364 (24.18%), Postives = 171/364 (46.98%), Query Frame = 2
Query:  209 LERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKC 1300
            +  +++  +  A   GHLE+VK+L+    +I   ++     I  A   G  E+VK L+    D        N   + +A   GH + V+ L+    NI +    N   +  A + GH+E+ K L+ Q  DI+     +  + + +    GH ++V+ L+ +  +I     +    +  A +NG++ + K LI    DI A     +   + +A   GH+E+++ L+S   +I+++++ + R    A   G  E+V+ L+ +  DI     + N   + +A + GH  +++ L+ +  DI +   DN   + +A E GH  + K L+    DI+A     +   + +A E+GH ++ + LV +  
Sbjct:  136 IRAENDYAVRWASGNGHLEVVKYLVSQGANIRADND---HAIGLASYYGYLEVVKYLVSQGADIR----SDNDYAVRMASRNGHIEVVEYLVSQGANIRSD---NDYAVRLASQNGHLEVVKYLVSQGADIK----SDNDYAVRLASQNGHLEVVEYLVTQGTNIRV---NNNYAVEWASKNGNLEVVKYLISQGADIIA----DNNFAVRWASRNGHLEVVKYLVSLGADIKSDNDYAVR---WASGNGHLEVVKYLVSQGSDIR----VENDYAVRWASRNGHFDVIKYLVSQGADIRS---DNDYAVKWASENGHLEVVKFLVSLGADIKA----EDDYAVRWASEKGHLEVVEYLVSQGA 464          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16488909 (tr|A0A182GGY8|A0A182GGY8_AEDAL ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 6.234e-100
Identity = 182/487 (37.37%), Postives = 284/487 (58.32%), Query Frame = 2
Query:  182 CNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA--------------------------------GAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             N  D +EY      PL H AC  G  E+V+ LI    +I+   + K  P+H AC+ G+ E+V++LI  K + E    Q N  PLHLAC  GHK+ V+ILI+ N NI+A  E   +P++ AC RGH E  ++LI ++ +I     +NK  P+H  C  GHA++V++L+ E  +I+   +    P+HLAC+NGH  + +ILI    +I+A   KKS  P+H AC  GH E++E+LI    NIEA ++ +W P+H AC  G KE+V +LI  K +IEA +  +N+ P+H +C+ GH  +V +L+  K +IEA  +DNW P+H AC+ GH+ + ++LI  + +IEA                                  G  NW P+H AC  GHK++ ++L+  K ++ A  +++W P+  A + G+ E+V+IL+ +K +IDA    ++ PLH AC+ GH E+V++L     +I+ALT ++ +P+ LA
Sbjct: 1194 VNAADTNEY-----TPL-HWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEAL-NQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDAL-DENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKS-TPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEA-LNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLA 1670          

HSP 2 Score: 352.058 bits (902), Expect = 1.829e-99
Identity = 174/451 (38.58%), Postives = 282/451 (62.53%), Query Frame = 2
Query:  194 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            ++D   E K  PL HLAC  GH E V+ LI    +I+  DE K  P+H AC+ G AE+V++L+  K + +    +    PLHLAC  GHK+ V+ILI    NI+A  E   +P++ AC+ GH E+ ++LI  + +I+     N   P+H  C  GH ++V++LI E  +IE  ++D   P+HL+C +GH  + +ILI    +IEA   + +  P+H AC  GH E++E+LI +  NIEA ++ ++ P+H+A   G +++V +LI  K +IEA +G  N+ P+H AC+ GH  +V +L+  K +IEA  +DNW P+H AC+ GH  + ++L+  K +I+A A    + P+H AC+ GHK++ ++L+  K +++A  E    P+  A + G+ E+V+IL+ +K +I+A ++  W PLH ACE+GH E+VK+L     +I+ALT+++ +P+ LA
Sbjct: 1292 NIDALTEHKYTPL-HLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEK-KFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWT-PLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEA-LNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEA-LGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAE-KKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLA 1736          

HSP 3 Score: 351.288 bits (900), Expect = 2.677e-99
Identity = 177/453 (39.07%), Postives = 283/453 (62.47%), Query Frame = 2
Query:  188 KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            K ++D   E K  PL H AC  GH E+V+ L+    +I+   E K  P+H AC+ G  E+V++LI  K + +    +    PLHLAC  GHK+ V+ILI    NI A ++VN +P++FAC  GH E+ ++LI ++ +I+     N   P+H+ C  GH ++V++LI E  +IE  ++D   P+HLAC++GH  + +ILI    +IEA   + +  P+H A   GH +++E+LI +  NIEA  +E+W P+HLAC  G KE+V +LI  K +IEA +  +N+ P+H AC+ GH  +V +L+  K +I+A  E  + P+H AC+ GH+ + ++LI  K +I+A     +  P+H AC+ GHK++ ++LV  K ++ A  +++W P+  A E+G+ E+VKILI +K +IDA  + +  PLH AC+RGH E+V++  +   +I AL  E+ +P+ LA
Sbjct: 1323 KANIDALDENKFTPL-HKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEK-KSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWT-PLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEA-LNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEA-LTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKS-TPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLA 1769          

HSP 4 Score: 329.717 bits (844), Expect = 6.628e-92
Identity = 162/436 (37.16%), Postives = 266/436 (61.01%), Query Frame = 2
Query:  188 KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAG 1495
            K ++D   E+K  PL HLAC  GH E+V+ LI    +I+   E K  P+H AC+ G  E+V++LI  K + E    Q N  PLH AC  GHK+ V+ILI    NI A ++ N +P++ +C+ GH E+ ++LI ++ +I+     N   P+H+ C +GH ++V++LI E  +IE  ++    P+H+A  NGH  + +ILI    +IEA  G+++  P+H AC  GH E++E+LI    NIEA  +++W P+H AC+ G  E+V +L+  K +I+A +    + P+H AC+ GH  +V +L+  K +I+A  E    P+H AC+ GH+ + ++L+  K +IEA    +NW P+H ACE+GHK++ K+L+  K +++A  +    P+  A +RG+ E+V+I + +  +I A D  +  PL+ A + GHTE+ K++ +  
Sbjct: 1356 KANIDALAEKKFTPL-HLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALN-QVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWT-PLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEA-LGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDA-LAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEA-LNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEKA 1785          

HSP 5 Score: 328.176 bits (840), Expect = 2.213e-91
Identity = 173/503 (34.39%), Postives = 285/503 (56.66%), Query Frame = 2
Query:  137 FETLIGTIRSQAPELCN-KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFE------------------------IFGGQWN--------QCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            F+T +    S   ++   K+    + +  D PL+H+A   G +E VK LI++  ++          +H +   G   IV+LL+DN  +                          + GG+ N          PLH AC  G K+ V+ILI    NI A ++ N +P++ AC+ GH E+ ++LI +  +I     ++K  P+H+ C  GH + V++LI E  +I+  D++   P+H AC+NGH  + +IL+    +I+A A KK   P+H AC  GH E++E+LI +  NI+A  E+   P+HLAC+ G KE+V +LI  K +IEA +   N+ P+HFAC  GH  +V +L+  K +IEA  +DNW P+H +C  GH+ + ++LI  K +IEA    +NW P+H AC+ GHK++ ++L+  + ++ A  + ++ P+  AS  G+ ++V+ILI +K +I+A  +  W PLH AC  GH E+V++L +   +IEALT++ ++P+  A
Sbjct: 1106 FQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDAL-TEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKF-TPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEA-LNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEA-LNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKA 1604          

HSP 6 Score: 298.13 bits (762), Expect = 2.976e-81
Identity = 160/480 (33.33%), Postives = 268/480 (55.83%), Query Frame = 2
Query:  206 YLERKDEPLIHLACDFGHLEIVKFLIDHNVD--------------------IEIRDEWKRR------------PI-HSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            Y  R+ +  ++LA   GH E+V  LI+  ++                      ++D  KR+            P+ H A   G  E VK LI+N  +            LH++   GH+  V++L+++  N+NA D    +P+++AC  G  E+ ++LI  + +I     KNK  P+H  C  G  ++V++LI E  +IE  ++    P+HLAC+NGH  + +ILI  N +I+A    K   P+H AC  GH E +++LI +  NI+A DE  + P+H AC+ G  E+V +L+  K +I+A +    + P+H AC+ GH  +V +L+  K +I+A  E    P+H AC+ GH+ + ++LI  K +IEA   + NW P+HFAC  GHK++ ++L+  K ++ A  +++W P+  +   G+ E+V+ILI +K +I+A ++  W PLH AC+ GH E+V++L +   +IEAL +  Y+P+ +A
Sbjct: 1064 YQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNA-PSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDAL-AKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHK-YTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDA-LAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQV-NWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIA 1538          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21873125 (tr|A0A1X7T5B0|A0A1X7T5B0_AMPQE ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.382e-91
Identity = 186/451 (41.24%), Postives = 278/451 (61.64%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDI-EIRDEWKRRPIHSACEKGQAEIVK-LLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI-ESNCNINACDE--VNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKD-GKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVRML-IDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNWRPIHFACERGHRNIA-KLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDR-KCDVNACVENDWRPIIWASERGYIEIVK-ILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLT-QAGCDIEALTREEYSPM 1537
            +H AC+ GH E+VK L +H   I E  D    RP+H ACE G  +IV+ L+ID   D     G+    PLH AC +GH + VKIL     CN  A      N  P++ AC+ G+V+I + L+ID+ CD+    G+N   P+H  C +GH ++VK+L +   C+ E  D     RP+H ACE+G++ I   ++ID +CD+ A  G+    P+HFAC  GH EI+++L +   CN EAED  + RP+H  CE G+ +IVR L ID+ CD+ A  G N Y P+H+AC+ GH  IV++L +  +C+IEA     +RP+H ACE G+ +I   L+ID+ CD+ A AG +N+ P+ +AC++GH +I K+L +  +C+  A   + +RP+  A E G ++IV+ ++I++ CD++A  R  + PLH ACE+GH EIVK+LT    C+IEA    +Y P+
Sbjct:  196 LHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEDSYFNDRPLHKACESGNIDIVHHLVIDKHCDVNAK-GRYGYTPLHFACEKGHFEIVKILTNHPQCNTEAEDNSNDRPLHEVCESGNVDIVRYLVIDKHCDVNA-KGRNGYAPLHYACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLDYACKKGHFEIVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTNHPQCNIEAEDNSQYRPL 642          

HSP 2 Score: 306.605 bits (784), Expect = 3.254e-89
Identity = 188/463 (40.60%), Postives = 279/463 (60.26%), Query Frame = 2
Query:  212 ERKDEPLIHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIHSACEKGQAEIV-KLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI-ESNCNINACDEVNRSPIYFACKRGHVEIA-KLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESW--RPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNW---RPIHFACERGHRNIA-KLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDR-KCDVNACVENDWRPIIWASERGYIEIVKIL-INQKCDIDACDRWQWRPLHWACERGHTEIVKLLT-QAGCDIEALTREEYSPMKLA 1546
            ER     +H AC+ GH EIVK L +H   + E  D    RP+H ACE G  +IV  L+ID   D     G+    PLH AC +GH + VK+L     C   A D  +  P++ AC+ G+V+I   L+ID+ CD+    G+N   P+H  C +GH ++VK+L +   C  E  D    RP+H ACE+G+V I + ++ID +CD+ A  G+    P+HFAC  GH E++++L +   CN EAE    +  RP+H ACE G+ +IVR ++ID+ CD+ A  G N Y P+HFAC+ GH  +V++L +  +C+ EA  ED++   RP+H ACE G+ +I   L+ID+ CD+ A  G   + P+HFACE+GH +I K+L +  +C+  A   ++ RP+    E G ++IV+ L I++ CD++A  R  + PLH+ACE+GH EIVK+LT    C+IEA    +Y P+  A
Sbjct:   53 ERIGYTPLHYACEMGHFEIVKILTNHPQCNAEAEDNSNDRPLHKACESGNVDIVCHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVCHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNAK-GRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEA--EDSYFNDRPLHKACESGNIDIVHHLVIDKHCDVNA-KGRYGYTPLHFACEKGHFEIVKILTNHPQCNTEAEDNSNDRPLHEVCESGNVDIVRYLVIDKHCDVNAKGRNGYAPLHYACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKA 508          

HSP 3 Score: 293.508 bits (750), Expect = 2.638e-84
Identity = 185/489 (37.83%), Postives = 279/489 (57.06%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDI-EIRDEWKRRPIHSACEKGQAEIV-KLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI-ESNCNINACDEVNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE---NCDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEE-SWRPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNWRPIHFACERGHRNIAK-LLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLL-----------------------------------VDRKCDVNACVE-NDWRPIIWASERGYIEIVKILINQ-KCDIDACDRWQWRPLHWACERGHTEIVK-LLTQAGCDIEALTREEYSPMKLA 1546
            +H AC+ GH E+VK L +H   I E  D    RP+H ACE G  +IV  L+ID   D     G+    PLH AC +GH + VK+L     C   A D  +  P++ AC+ G+V+I + L+ID+ CD+    G+N   P+H  C +GH ++VK+L +    N + E       RP+H ACE+G+V I + ++ID +CD+ A  G+    P+HFAC  GH E++++L +   CN EAED   + RP+H ACE G+ +IV  ++ID+ CD+ A  G   Y P+HFAC+ GH  IV++L +  +C+ EA    N RP+H  CE G+ +I + L+ID+ CD+ A  G N + P+H+ACE+GH +I K+L                                   +D+ CDVNA    +++ P+ +A ++G+ EIVKIL N  +C+ +A +  Q+RPLH ACE G  +IV+ L+    CD+ A  R +Y+P+  A
Sbjct:  128 LHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVCHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNA-KGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNAK-GRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEDSYFNDRPLHKACESGNIDIVHHLVIDKHCDVNA-KGRYGYTPLHFACEKGHFEIVKILTNHPQCNTEAEDNSNDRPLHEVCESGNVDIVRYLVIDKHCDVNA-KGRNGYAPLHYACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLDYACKKGHFEIVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCA 611          

HSP 4 Score: 255.758 bits (652), Expect = 2.079e-70
Identity = 143/379 (37.73%), Postives = 234/379 (61.74%), Query Frame = 2
Query:  443 ACWEGHKDTVK-ILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ-RCDIQVFGGKNKRHPIHMGCFEGHADIV-KMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEIL-EVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVR-MLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR-KCDIEA-GAGLNNWRPIHFACERGHKDIAK-LLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQ-KCDIDACDRW-QWRPLHWACERGHTEIV-KLLTQAGCDIEALTREEYSPMKLA 1546
            AC  G+ D V+ ++I+ +C++NA + +  +P+++AC+ GH EI K+L +  +C+ +     N R P+H  C  G+ DIV  ++ID++CD+    ++G  P+H ACE GH  + K+L +    I  +      RP+H AC  G+V+I+  ++I K+C++ A+    + P+H ACEKG  E+V++L +    I       + RP+H AC+ G+  IVR +++D+ CD+ A   + + P+HFACE+GH  + K+L +  +C+ EA G+ L N RP+H ACE G+ DI + L++D+ CDVNA   N + P+ +A E+G+ E+VKIL N  +C+ +A D +   RPLH ACE G+ +IV  L+    CD+ A  R  Y+P+  A
Sbjct:   29 ACKSGNVDFVRHLVIDKHCDVNAKERIGYTPLHYACEMGHFEIVKILTNHPQCNAEAEDNSNDR-PLHKACESGNVDIVCHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVCHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKVLTNHPQCITEAEDNTDDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEGSYLFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHFACEKGHFEVVKILTNHPQCNTEAEDSYFNDRPLHKACESGNIDIVHHLVIDKHCDVNAKGRYGYTPLHFA 406          

HSP 5 Score: 174.866 bits (442), Expect = 4.998e-42
Identity = 105/257 (40.86%), Postives = 148/257 (57.59%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIHSACEKGQAEIVK-LLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI-ESNCNINACDEVNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVRML 982
            +H AC+ GH EIVK L +H   + E  D    RP+H  CE G  +IV+ L+ID   D     G+    PLH AC +GH + VKIL     CNI A D     P++ AC+ G+V+I   L+ID+ CD+    G +   P+   C +GH +IVK+L +   C+ E  +    RP+H ACE G V I + ++ID +CD+ A  G+    P+H AC  GH EI+++L +   CNIEAED   +RP+H  CE G+ +IVR L
Sbjct:  403 LHFACEKGHFEIVKILTNHPQCNTEAEDNSNDRPLHEVCESGNVDIVRYLVIDKHCDVNA-KGRNGYAPLHYACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLDYACKKGHFEIVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAK-GRSDYTPLHCACEKGHFEIVKILTNHPQCNIEAEDNSQYRPLHKVCESGNVDIVRHL 657          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16847531 (tr|Q16FI9|Q16FI9_AEDAE AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 7.976e-91
Identity = 156/470 (33.19%), Postives = 264/470 (56.17%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKR-HPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDN-----------WRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            N  ++D   +    PL HLA + GHLE+VK LID+  +++ +      P+H A + G  E+VKLLI+N+ + +    + W   PLH A   GH + VK LI++  N++   +   +P++ A + GH+E+ KLLI+ R ++     KN+   P+H     GH ++VK LID   +++T   +G  P+HLA ENGH+ + K+LI+   N D + + G     P+H A   GH+E+++ LI    N++    E W P+H+A + G  E+V++LID K +++         P+HFA + GH  +V++L+D + ++   + +N             P+HFA + GH  + KLLI+ + ++  G   N  W P+HFA   GH ++ KLL++ + +V+      W P+  AS  G++E+VK+LIN + ++D      W PL+ A + GH E+VKLL     +++    E ++P+ +A
Sbjct:   74 NGANVDTTQDEGWTPL-HLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGW--TPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDT--KKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGG---WTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKG-ITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANV--GTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVA 532          

HSP 2 Score: 312.383 bits (799), Expect = 5.450e-90
Identity = 146/449 (32.52%), Postives = 256/449 (57.02%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEI-FGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD-----IEAGAGLNNWR-----PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA + G+LE+VK LID+  +++   +    P+H A E G  E+VKLLIDN+ + +    G W   PLH+A   GH + VK+LIE+  N++       +P++FA + GH+E+ K LID R ++     +    P+H+    GH ++VK+LI+   +++T   +G  P+H A +NGH+ + K LID   +++ +   +   P+H A   GH+E++++LI    N++ +    W P+H+A + G  E+V+ LID + +++       + P+H A + GH  +V++L+D K +++        P+HFA + GH  + KLLID + +     IE  A ++  +     P+HFA + GH ++ KLL++ + +V       W P+ +AS  G++E+VK+LI  + ++D      W PL+ A   GH E+VKLL     +++    E ++P+ +A
Sbjct:   56 LHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGW--TPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWT-PLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQ-DEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTT-QYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVA 499          

HSP 3 Score: 308.916 bits (790), Expect = 8.889e-89
Identity = 148/465 (31.83%), Postives = 257/465 (55.27%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCD-----IEASAG-----KKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            N+ ++D   +    PL H+A   GHLE+VK LI++  +++ +      P+H A + G  E+VK LIDN+ + +    + W   PLHLA   GH + VK+LIE+  N++       +P++ A + GH+E+ K LID R ++     +    P+H+    GH ++VK+LID   +++T    G  P+H A +NGH+ + K+LID   +     IE  A       K   P+HFA   GH+E++++LI    N+     E W P+H A   G  E+V++LI+ + +++       + P++ A   GH  +V++L++ + +++    + W P++ A + GH  + KLLID K +++       W P+H A + GH ++ KLL+D + +V+        P+  AS+ G++E+VK+LI+ K ++D  D   W PLH A + GH E+VKLL +   +++    +  +P+  A
Sbjct:  173 NRANVDTTQDEGWTPL-HVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGW--TPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWT-PLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQN-EGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQN-EGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFA 631          

HSP 4 Score: 307.76 bits (787), Expect = 2.663e-88
Identity = 153/455 (33.63%), Postives = 261/455 (57.36%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDH--NVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKR-HPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA--GAGLNNWRPIHFACERGHKDIAKLLVDRKCD-VNACVEN----------DWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GHL++VK LID+  NVD E  + W   P+H A E G  E+VKLLIDN  + +    + W   PLHLA   GH + VK+LI++  N++       +P++ A + GH+E+ KLLI+ R ++     KN+   P+H     GH ++VK LID   +++T   +G  P+H+A +NGH+ + K+LI+   +++     +   P+HFA   GH+E+++ LI    N++   +E W P+HLA E G  E+V++LI+ + +++       + P+H A + GH  +V+ L+D + +++    + W P+H A + GH  + KLLID K +++     G+    P+HFA + GH ++ KLL+D + + V   +EN             P+ +AS+ G++E+VK+LI  + ++       W PLH+A   GH E+VKLL +   +++    E ++P+ +A
Sbjct:   23 LHVASQNGHLKVVKLLIDNGANVDTEGDEGWT--PLHLAAENGYLEVVKLLIDNGANVDTTQDEGW--TPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDT--KKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKK-NEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKN-GGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGI---TPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVA 466          

HSP 5 Score: 306.605 bits (784), Expect = 7.809e-88
Identity = 145/453 (32.01%), Postives = 257/453 (56.73%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDH--NVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGH-----------KDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA--GAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GHLE+VKFLID+  NVD    + W   P+H A + G  E+VKLLIDNK + +    +    PLH A   GH            + VK+LIE+  N++       +P++FA + GH+E+ KLLI+ R ++     +    P+H     GH ++VK+LI+   +++T   +G  P+++A  NGH+ + K+LI+   +++ +   +   P++ A   GH+E++++LI    N++    E W P+H+A + G  E+V++LID + +++         P++ A K GH  +V++L+D K +++    + W P+H A + GH  + KLLI+ + +++     G+    P+HFA + GH ++ KLL+D + +V+      W P+  AS+ G++E+VK+LI  + ++D        PLH+A + GH E+VKLL     +++    E ++P+ +A
Sbjct:  287 LHVASQNGHLEVVKFLIDNRANVDTTQYEGWT--PLHVASQNGHLEVVKLLIDNKANVDTTQNK-GITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWT-PLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQ-NEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKG-ITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGI---TPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVA 730          

HSP 6 Score: 300.827 bits (769), Expect = 9.280e-86
Identity = 140/441 (31.75%), Postives = 249/441 (56.46%), Query Frame = 2
Query:  266 IVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQV--FGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILIN-----------QKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +VKFLIDHN +I+  +   R P+H A + G  ++VKLLIDN  + +  G + W   PLHLA   G+ + VK+LI++  N++   +   +P++ A + GH+E+ KLLID R ++     GG     P+H+    GH ++VK+LI+   +++T   +G  P+H A +NGH+ + K LID   +++ +   +   P+H A   GH+E++++LI    N++ +  E W P+H A + G  E+V+ LID + +++       + P+H A + GH  +V++L++ + +++      W P+H A + GH  + K LID + +++       W P+H A + GH ++ KLL+D K +V+        P+ +AS+ G++E+VK+LI+            + ++D        PLH+A + GH E+VKLL +   ++     E ++P+  A
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGW--TPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWT---PLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQ-DEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQD-EGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDT-TQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFA 433          

HSP 7 Score: 300.827 bits (769), Expect = 9.472e-86
Identity = 148/460 (32.17%), Postives = 259/460 (56.30%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVD-----IEIR---DEWKRR---PIHSACEKGQAEIVKLLIDNKIDFEIFGGQ-WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEA--GAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTRE 1522
            NK ++D    +   PL H A   GHLE+VK LID+  +     IE R   D  + +   P+H A + G  E+VKLLI+N+ +      + W   PLH A   GH + VK+LIE+  N++       +P+Y A   GH+E+ KLLI+ R ++     +    P+++    GH ++VK+LID   +++T   +G  P+H+A +NGH+ + K+LID   +++ +   K   P++ A   GH+E++++LI    N++  D E W P+H+A + G  E+V++LI+ + +++         P+HFA + GH  +V++L+D + +++    + W P+H A + GH  + KLLI+ + +++     G+    P+HFA + GH ++ KLL+D + +V+      W P+  AS+ G++E+VK+LI+ + ++D        PL+ A   GH E+VKLL     +++    E
Sbjct:  338 NKANVDTTQNKGITPL-HFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGW--TPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWT-PLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTK-NKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKG-ITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGI---TPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNE 788          

HSP 8 Score: 295.819 bits (756), Expect = 6.952e-84
Identity = 139/464 (29.96%), Postives = 259/464 (55.82%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFE--IFGGQWNQ--------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            N+ ++D        PL H+A   GHLE+VK LID+  +++        P+H A + G  E+VKLLIDN+ +    +   + N          PLH A   GH + VK+LIE+  N+        +P++FA + GH+E+ KLLI+ R ++     +    P+++    GH ++VK+LI+   +++T   +G  P+++A +NGH+ + K+LID   +++ +   +   P+H A   GH+E++++LI    N++    +   P+++A + G  E+V++LID K +++       + P+H A + GH  +V++L++ + +++        P+HFA + GH  + KLLID + +++       W P+H A + GH ++ KLL++ + +V+        P+ +AS+ G++E+VK+LI+ + ++D      W PLH A + GH E+VKLL     +++    +  +P+ +A
Sbjct:  305 NRANVDTTQYEGWTPL-HVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWT-PLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQ-NEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTT-DNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQN-EGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVA 763          

HSP 9 Score: 122.479 bits (306), Expect = 1.066e-24
Identity = 63/182 (34.62%), Postives = 102/182 (56.04%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDH--NVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDG 724
            N+ ++D    +   PL H A   GHLE+VK LID+  NVD    + W   P+H A + G  E+VKLLI+N+ + +    +    PLH A   GH + VK+LI++  N++       +P++ A + GH+E+ KLLID R ++     K    P+++    GH ++VK+LID   +++T   +G
Sbjct:  613 NRANVDTTQNKGITPL-HFASQNGHLEVVKLLIDNRANVDTTQNEGWT--PLHVASQNGHLEVVKLLIENRANVDTTQNK-GITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGIT-PLYVASINGHLEVVKLLIDNRANVDTTQNEG 789          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21867373 (tr|A0A1X7T1N6|A0A1X7T1N6_AMPQE ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.141e-90
Identity = 188/457 (41.14%), Postives = 275/457 (60.18%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIHSACEKGQAEIVK-LLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE-SNCNINACDEVNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNWRPIHFACERGHRNIAK-LLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDR-KCDVNACVENDWRPIIWASERGYIEIVK-ILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLT-QAGCDIEALTREEYSPMKLA 1546
            R D   +H AC+ GH EIVK L DH   + E       RP+H ACE G  +IV  L+ID   D     G  N  PLH AC +GH + VKIL +   CN  A    N  P++ AC+ G+++I + L+ID+ CD+    G+N   P+H  C +GH +IVK+L     C+IE  D    RP+H ACE+G+V I   ++ID +CD  A AG  +  P+H AC  GH EI+++L     CN EA+   + RP+H ACE G+ +IVR ++ID+ C + A  G N Y P+H+AC+ GH  +V++L +  +C+ EA     +RP+H ACE G  +I + L+ID+ CD+ A  G +++ P+H ACE+GH +I K+L +  +C+  A   + +RP+  A E G ++IV  ++I++ CD +A  R  + PLH ACE+GH EIVK+LT Q  C+IEA  +    P+ LA
Sbjct:  194 RSDYTPLHCACEKGHFEIVKILTDHPQCNTEAESNSNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLHCACEKGHFEIVKILTDHPQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCDVNA-KGRNGYTPLHYACEKGHFEIVKILTHHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDFNAKAGWSNYTPLHCACEKGHFEIVKILTDHSQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCGVNA-KGRNGYTPLHYACEKGHFEVVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNA-KGRSDYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQYRPLHKACELGSVDIVHHLVIDKHCDANAKGRSDYTPLHCACEKGHFEIVKILTDQPQCNIEAEDKYNDRPIHLA 647          

HSP 2 Score: 300.442 bits (768), Expect = 7.231e-83
Identity = 191/545 (35.05%), Postives = 289/545 (53.03%), Query Frame = 2
Query:  110 NRTYFWMDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIH-----------------------------------------------------SACEKGQAEIVK-LLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE-SNCNINACDEVNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMD-RKCDIEACIEDNWRPIHFACERGHRNIAK-LLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDR-KCDVNACVENDWRPIIWASERGYIEIVK-ILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLT-QAGCDIEALTREEYSPMKLA 1546
            N+ Y   D FE +   I S         D++   E      +H AC  G L IV++LI     +IE +D    +P+H                                                     +ACE G  +I+  L+ID   D     G+ +  PLH AC +GH + VKIL +   CN  A    N  P++ AC+ G+V+I   L+ID+ CD+    G +   P+H  C +GH +IVK+L D   C+ E       RP+H ACE+G++ I + ++ID +CD+ A  G+    P+H+AC  GH EI+++L     CNIEAED   +RP+H ACE G+ +IV  ++ID+ CD  A  G +NY P+H AC+ GH  IV++L D  +C+ EA    N RP+H ACE G+ +I + L+ID+ C + A  G N + P+H+ACE+GH ++ K+L +  +C+  A   + +RP+  A E G ++IV+ ++I++ CD++A  R  + PLH ACE+GH EIVK+LT    C+ EA    +Y P+  A
Sbjct:   44 NKEYLEKDYFEIMKHLIESTG------CDINVREEGTGSTPLHKACYNGSLSIVEYLISKPQCNIEAKDNEGNQPLHYAACQGHKEIVSILGKKVSGDGLSKCMTSAKQLAEPDIMELLNDCFLDRISLINACESGNVDILHHLVIDKHCDVNA-KGRSDYTPLHCACEKGHFEIVKILTDHPQCNTEAESNSNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLHCACEKGHFEIVKILTDHPQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCDVNAK-GRNGYTPLHYACEKGHFEIVKILTHHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDFNAKAGWSNYTPLHCACEKGHFEIVKILTDHSQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCGVNA-KGRNGYTPLHYACEKGHFEVVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNAKGRSDYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQYRPLHKA 579          

HSP 3 Score: 275.018 bits (702), Expect = 5.881e-74
Identity = 182/514 (35.41%), Postives = 275/514 (53.50%), Query Frame = 2
Query:  239 LACDFGHLEIVKFL-------IDHN---------------------------------------VDIEIRDEWK-RRPIHSACEKGQAEIVKLLIDN-KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE-------SNCNINACDE-------------VNRSPIYFACKRGHVEIA-KLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIA-KILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNWRPIHFACERGHRNIA-KLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVD-RKCDVNACVENDWRPIIWASERGYIEIVK-ILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLT-QAGCDIEALTREEYSPMKLA 1546
            +AC + HL +V++L       I+ N                                        DI +R+E     P+H AC  G   IV+ LI   + + E    + NQ PLH A  +GHK+ V IL +       S C  +A                ++R  +  AC+ G+V+I   L+ID+ CD+    G++   P+H  C +GH +IVK+L D   C+ E       RP+H ACE+G+V I   ++ID +CD+ A AG  +  P+H AC  GH EI+++L     CN EA+   + RP+H ACE G+ +IVR ++ID+ CD+ A  G N Y P+H+AC+ GH  IV++L    +C+IEA     +RP+H ACE G+ +I   L+ID+ CD  A AG +N+ P+H ACE+GH +I K+L D  +C+  A    + RP+  A E G I+IV+ ++I++ C ++A  R  + PLH+ACE+GH E+VK+LT    C+ EA    +Y P+  A
Sbjct:    1 MACIYNHLPVVEYLTGQQNCNINSNNERHPLLAAADKELVCKTNKEYLEKDYFEIMKHLIESTGCDINVREEGTGSTPLHKACYNGSLSIVEYLISKPQCNIEAKDNEGNQ-PLHYAACQGHKEIVSILGKKVSGDGLSKCMTSAKQLAEPDIMELLNDCFLDRISLINACESGNVDILHHLVIDKHCDVNA-KGRSDYTPLHCACEKGHFEIVKILTDHPQCNTEAESNSNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAGWSNYTPLHCACEKGHFEIVKILTDHPQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCDVNA-KGRNGYTPLHYACEKGHFEIVKILTHHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDFNAKAGWSNYTPLHCACEKGHFEIVKILTDHSQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCGVNAKGRNGYTPLHYACEKGHFEVVKILTNHPQCNTEAENNSQYRPLHEA 511          

HSP 4 Score: 268.47 bits (685), Expect = 8.335e-72
Identity = 166/425 (39.06%), Postives = 248/425 (58.35%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIHSACEKGQAEIVK-LLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE-SNCNINACDEVNRSPIYFACKRGHVEIAK-LLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDEN-CDIETCDKDGKRPIHLACENGHVAIAK-ILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLIS-KNCNIEAEDEESWRPIHLACEKGDKEIVR-MLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDR-KCDIEACIEDNWRPIHFACERGHRNIAK-LLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDR-KCDVNACVENDWRPIIWA-SERGYIEIVKILINQK-CD---IDACDRWQWRPLHWACERG 1459
            +H AC+ GH EIVK L DH   + E +     RP+H ACE G  +IV+ L+ID   D     G+    PLH AC +GH + VKIL     CNI A D     P++ AC+ G+V+I   L+ID+ CD     G +   P+H  C +GH +IVK+L D + C+ E       RP+H ACE+G++ I + ++ID +C + A  G+    P+H+AC  GH E++++L +   CN EAE+   +RP+H ACE G  +IVR ++ID+ CD+ A  G ++Y P+H AC+ GH  IV++L +  +C+ EA     +RP+H ACE G  +I   L+ID+ CD  A  G +++ P+H ACE+GH +I K+L D+ +C++ A  + + RPI  A  ++ Y+ IV  L+  K C+   I   DR     LH     G
Sbjct:  269 LHCACEKGHFEIVKILTDHPQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCDVNA-KGRNGYTPLHYACEKGHFEIVKILTHHPQCNIEAEDNSQYRPLHKACESGNVDIVHHLVIDKHCDFNAKAGWSNYTPLHCACEKGHFEIVKILTDHSQCNTEAKSNTNDRPLHKACESGNIDIVRHLVIDKHCGVNAK-GRNGYTPLHYACEKGHFEVVKILTNHPQCNTEAENNSQYRPLHEACELGSVDIVRHLVIDKHCDVNA-KGRSDYTPLHCACEKGHFEIVKILTNHPQCNTEAENNSQYRPLHKACELGSVDIVHHLVIDKHCDANA-KGRSDYTPLHCACEKGHFEIVKILTDQPQCNIEAEDKYNDRPIHLALKDKTYMNIVNYLVQVKGCNTQGISTYDRKASSYLHIYQSSG 689          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|156434906 (tr|A0A2P1P9J0|A0A2P1P9J0_9RICK Ankyrin 2,3/unc44 OS=Candidatus Phycorickettsia trachydisci OX=2115978 GN=phytr_10060 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 6.603e-90
Identity = 144/438 (32.88%), Postives = 255/438 (58.22%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GHLE+VK+L+    +I+   +    P+H A  KG  E+VK L+  K + E    Q+   PL++   EGH + V+ L+    NI   ++   +P+Y + ++GH+E+ K L++Q+ +I+    +N   P++ G   GH ++VK L+D+  +IE   + G  P+H+A +NGH+ + K L+    +IEA   +    P+HFA   GH+E+++ L+ +  NIEA  +    P++L  E+G  EI++ L+D+K +IE  +  N    ++ A + GH  +++ L+ +K +IE   +D   P+H A + G+  + K L+ +K DIE  A  + + P+HFA + GH ++ + LV +K ++ A  ++ + P+   +ERG++E++K LI QK +I+   +    PLH A  RG+ E+VK L     +IEA T++  +P+ LA
Sbjct:  274 LHIAAQNGHLEVVKYLVGEKANIKAMTQDGFTPLHFAAGKGHLEVVKYLVGEKANIEATV-QYGYTPLYITAVEGHLEVVRYLVSQKANIEVMNQNGATPLYASAQQGHLEVVKYLVEQKANIEATA-QNGTTPLYAGAQNGHLEVVKYLVDQKANIEATAQGGLSPLHIAAQNGHLGVVKYLVGEKANIEAMT-QDGFTPLHFAGSKGHLEVVKYLVDQKANIEATAQNGATPLYLTAEQGHLEIIKYLVDQKANIE-VMNQNGATSLYLAAQNGHLEVLKFLLTQKANIETRTQDGATPLHAAADSGYLEVVKYLVGQKADIELTAQ-DGFTPLHFAAQNGHLEVVRYLVGQKANIEATAQDGYTPLYLIAERGHLEVIKYLIGQKANIEVRTKDGLSPLHIAAHRGYLEVVKYLVSQKANIEARTKDGATPLHLA 706          

HSP 2 Score: 306.605 bits (784), Expect = 8.249e-86
Identity = 148/464 (31.90%), Postives = 264/464 (56.90%), Query Frame = 2
Query:  167 QAPELCNKYDLDEYLERKDEP---LIHLACDFGHLEIVKFLIDH-NVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +A EL  K  +D+ ++ KDE     +HLA ++  LE++K L+    + IE  +     P+H A  KG  E+VK L+  K + E    Q +  PL+LA  +GH + V+ L++   NI A  +   +P+Y A  +GH+E+ K L+ Q+ +I+    +N   P+H     G  ++VK L+ E  +I+   ++G  P+H A +NGH+ + K L++   DIE +A +    P+HFA   GH+E+++ L+ +  NIEA  +    P+H+A + G  E+V+ L+  K +I+A    + + P+HFA   GH  +V+ L+  K +IEA ++  + P++     GH  + + L+ +K +IE     N   P++ + ++GH ++ K LV++K ++ A  +N   P+   ++ G++E+VK L++QK +I+A  +    PLH A + GH  +VK L     +IEA+T++ ++P+  A
Sbjct:   19 RAIELIRK--IDDVVQLKDEQNQNALHLAVEYNCLEVIKVLVQELGIGIEEGNIRGSTPLHFAAGKGHLEVVKYLVSQKANIESM-TQDSATPLYLAAQKGHLEVVRYLVDEKANIEATAQKESTPLYIAAAQGHLEVLKFLLTQKANIEAR-TQNGFTPLHAAAGTGRLEVVKYLVGEKANIKATAQNGTTPLHAAAQNGHLEVVKYLVEQKADIEPTA-QDGFTPLHFAAGKGHLEVVKYLVGEKANIEATAQGGLSPLHIAAQNGHLEVVKYLVGEKANIKAMT-QDGFTPLHFAAGKGHLEVVKYLVGEKANIEATVQYGYTPLYITAVEGHLEVVRYLVSQKANIEV-MNQNGATPLYASAQQGHLEVVKYLVEQKANIEATAQNGTTPLYAGAQNGHLEVVKYLVDQKANIEATAQGGLSPLHIAAQNGHLGVVKYLVGEKANIEAMTQDGFTPLHFA 475          

HSP 3 Score: 305.449 bits (781), Expect = 1.869e-85
Identity = 140/453 (30.91%), Postives = 257/453 (56.73%), Query Frame = 2
Query:  188 KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            K +++   +++  PL ++A   GHLE++KFL+    +IE R +    P+H+A   G+ E+VK L+  K + +    Q    PLH A   GH + VK L+E   +I    +   +P++FA  +GH+E+ K L+ ++ +I+    +    P+H+    GH ++VK L+ E  +I+   +DG  P+H A   GH+ + K L+    +IEA+  +    P++   + GH+E++  L+S+  NIE  ++    P++ + ++G  E+V+ L+++K +IEA    N   P++   + GH  +V+ L+D+K +IEA  +    P+H A + GH  + K L+  K +IEA    + + P+HFA  +GH ++ K LVD+K ++ A  +N   P+   +E+G++EI+K L++QK +I+  ++     L+ A + GH E++K L     +IE  T++  +P+  A
Sbjct:  128 KANIEATAQKESTPL-YIAAAQGHLEVLKFLLTQKANIEARTQNGFTPLHAAAGTGRLEVVKYLVGEKANIKA-TAQNGTTPLHAAAQNGHLEVVKYLVEQKADIEPTAQDGFTPLHFAAGKGHLEVVKYLVGEKANIEA-TAQGGLSPLHIAAQNGHLEVVKYLVGEKANIKAMTQDGFTPLHFAAGKGHLEVVKYLVGEKANIEATV-QYGYTPLYITAVEGHLEVVRYLVSQKANIEVMNQNGATPLYASAQQGHLEVVKYLVEQKANIEAT-AQNGTTPLYAGAQNGHLEVVKYLVDQKANIEATAQGGLSPLHIAAQNGHLGVVKYLVGEKANIEAMTQ-DGFTPLHFAGSKGHLEVVKYLVDQKANIEATAQNGATPLYLTAEQGHLEIIKYLVDQKANIEVMNQNGATSLYLAAQNGHLEVLKFLLTQKANIETRTQDGATPLHAA 574          

HSP 4 Score: 303.138 bits (775), Expect = 1.318e-84
Identity = 143/443 (32.28%), Postives = 249/443 (56.21%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKL 1543
            R   PL H A   GHLE+VK+L+    +IE   +    P++ A +KG  E+V+ L+D K + E    Q    PL++A  +GH + +K L+    NI A  +   +P++ A   G +E+ K L+ ++ +I+    +N   P+H     GH ++VK L+++  DIE   +DG  P+H A   GH+ + K L+    +IEA+A +    P+H A   GH+E+++ L+ +  NI+A  ++ + P+H A  KG  E+V+ L+  K +IEA V    Y P++     GH  +VR L+ +K +IE   ++   P++ + ++GH  + K L+++K +IEA A  N   P++   + GH ++ K LVD+K ++ A  +    P+  A++ G++ +VK L+ +K +I+A  +  + PLH+A  +GH E+VK L     +IEA  +   +P+ L
Sbjct:   71 RGSTPL-HFAAGKGHLEVVKYLVSQKANIESMTQDSATPLYLAAQKGHLEVVRYLVDEKANIEA-TAQKESTPLYIAAAQGHLEVLKFLLTQKANIEARTQNGFTPLHAAAGTGRLEVVKYLVGEKANIKA-TAQNGTTPLHAAAQNGHLEVVKYLVEQKADIEPTAQDGFTPLHFAAGKGHLEVVKYLVGEKANIEATA-QGGLSPLHIAAQNGHLEVVKYLVGEKANIKAMTQDGFTPLHFAAGKGHLEVVKYLVGEKANIEATV-QYGYTPLYITAVEGHLEVVRYLVSQKANIEVMNQNGATPLYASAQQGHLEVVKYLVEQKANIEATAQ-NGTTPLYAGAQNGHLEVVKYLVDQKANIEATAQGGLSPLHIAAQNGHLGVVKYLVGEKANIEAMTQDGFTPLHFAGSKGHLEVVKYLVDQKANIEATAQNGATPLYL 507          

HSP 5 Score: 278.87 bits (712), Expect = 4.944e-76
Identity = 135/439 (30.75%), Postives = 245/439 (55.81%), Query Frame = 2
Query:  188 KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDI 1504
            K +++  ++    PL   A + GHLE+V++L+    +IE+ ++    P++++ ++G  E+VK L++ K + E    Q    PL+     GH + VK L++   NI A  +   SP++ A + GH+ + K L+ ++ +I+    ++   P+H    +GH ++VK L+D+  +IE   ++G  P++L  E GH+ I K L+D   +IE    +     ++ A   GH+E+L+ L+++  NIE   ++   P+H A + G  E+V+ L+ +K DIE     + + P+HFA + GH  +VR L+ +K +IEA  +D + P++   ERGH  + K LI +K +IE     +   P+H A  RG+ ++ K LV +K ++ A  ++   P+  A+  G   IVKIL+ +  D+DA D     P++    + H +IV++L + G +I
Sbjct:  326 KANIEATVQYGYTPLYITAVE-GHLEVVRYLVSQKANIEVMNQNGATPLYASAQQGHLEVVKYLVEQKANIEATA-QNGTTPLYAGAQNGHLEVVKYLVDQKANIEATAQGGLSPLHIAAQNGHLGVVKYLVGEKANIEAMT-QDGFTPLHFAGSKGHLEVVKYLVDQKANIEATAQNGATPLYLTAEQGHLEIIKYLVDQKANIEV-MNQNGATSLYLAAQNGHLEVLKFLLTQKANIETRTQDGATPLHAAADSGYLEVVKYLVGQKADIE-LTAQDGFTPLHFAAQNGHLEVVRYLVGQKANIEATAQDGYTPLYLIAERGHLEVIKYLIGQKANIEVRTK-DGLSPLHIAAHRGYLEVVKYLVSQKANIEARTKDGATPLHLAARAGCSNIVKILVRRGADVDAEDIHSETPIYRTV-KNHRDIVEILAERGANI 757          

HSP 6 Score: 205.297 bits (521), Expect = 6.648e-51
Identity = 102/333 (30.63%), Postives = 183/333 (54.95%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE-NCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            A K   V+ A  LI +  D+     +  ++ +H+       +++K+L+ E    IE  +  G  P+H A   GH+ + K L+    +IE S  + S  P++ A   GH+E++  L+ +  NIEA  ++   P+++A  +G  E+++ L+ +K +IEA    N + P+H A   G   +V+ L+  K +I+A  ++   P+H A + GH  + K L+++K DIE  A  + + P+HFA  +GH ++ K LV  K ++ A  +    P+  A++ G++E+VK L+ +K +I A  +  + PLH+A  +GH E+VK L     +IEA  +  Y+P+
Sbjct:   11 AVKNKRVQRAIELIRKIDDVVQLKDEQNQNALHLAVEYNCLEVIKVLVQELGIGIEEGNIRGSTPLHFAAGKGHLEVVKYLVSQKANIE-SMTQDSATPLYLAAQKGHLEVVRYLVDEKANIEATAQKESTPLYIAAAQGHLEVLKFLLTQKANIEART-QNGFTPLHAAAGTGRLEVVKYLVGEKANIKATAQNGTTPLHAAAQNGHLEVVKYLVEQKADIEPTAQ-DGFTPLHFAAGKGHLEVVKYLVGEKANIEATAQGGLSPLHIAAQNGHLEVVKYLVGEKANIKAMTQDGFTPLHFAAGKGHLEVVKYLVGEKANIEATVQYGYTPL 340          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 223.787 bits (569), Expect = 4.905e-60
Identity = 120/440 (27.27%), Postives = 211/440 (47.95%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K    ++ LL+ +    E    +    PLH+A + GH + VKIL++   + NA +    +P++ A + GH E+A+ L+     +     K+ +  +H     GH ++VK+L++   +  +    G  P+H+A   GH    +IL+D+N   +    KK   P+H A   G V++ E+L+ +  N  A  +    P+H+A    + ++V +L+ +     +    N Y P+H A K     +   L+       A       P+H A + G  ++  LLI ++ ++  G  +GL    P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+ +++   R  + PLH A ++GHT+IV LL + G     +T    S + +A
Sbjct:  314 LHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVT-ESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDA-KAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQ-QTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA-ARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLT---PLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIA 746          

HSP 2 Score: 207.608 bits (527), Expect = 7.256e-55
Identity = 118/473 (24.95%), Postives = 226/473 (47.78%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEI---------------------------------VKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   G++ +V+ L+D    I+ + + +  P+H A   G   I+++L+D     +    +    P+H+A    H D V+ L++ N  I+     + +P++ A   GH  +AK+L+D+  + + +   G     P+H+ C + H  ++ +L+  +  +E   + G  P+H+A   GH+ I KIL+       AS   K   P+H A   GH E+ E L+     ++A+ ++    +H A   G KE+V++L++ K +  +      + P+H A + GH   VR+L+D         +  + P+H A + G  ++A+LL++R  +  A AG N   P+H A    + D+  LLV +    ++   N + P+  AS++  +E+                                 V +LI+++ +++  ++    PLH   + GH  I  +L + G  + A TR  Y+P+ +A
Sbjct:  215 LHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQA-KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFT---PLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNAS-NVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTT-TAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVA 680          

HSP 3 Score: 207.223 bits (526), Expect = 1.003e-54
Identity = 126/474 (26.58%), Postives = 222/474 (46.84%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRS----------PIYFACKRGHV--------------------------EIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ + V +E   +     +H A   GQ ++V  L++   +      Q    PL++A  E H + VK L+E+  N +   EV  S          P+Y +    H+                           +A+LL+++  ++  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV I +IL+D    I+A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   + ++L+D+         +N + P+H ACK  H  ++ +L+     +EA  E    P+H A   GH NI K+L+ +     A + +    P+H A   GH ++A+ L+     V+A  ++D   +  A+  G+ E+VK+L+  K + ++       PLH A   GHT+ V++L         +T++ ++P+ +A
Sbjct:   47 LHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPN-TRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNA-SNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVA 515          

HSP 4 Score: 199.134 bits (505), Expect = 4.603e-52
Identity = 111/442 (25.11%), Postives = 212/442 (47.96%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    H++ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H   + +L++ + ++ A  E   +P++ A   GH+ I K+L+ +         K +  P+HM    GH ++ + L+     ++   KD +  +H A   GH  + K+L++   N +   +AG     P+H A   GH + + +L+  N       ++ + P+H+A + G  ++  +L++R  +  A  G N   P+H A    +  +V +L+ +     +   + + P+H A ++    +A  L+       A + L    P+H A + G  D+  LL+ ++ +VN   ++   P+   ++ G++ I  IL+ Q   + A  R  + PLH AC  G+ ++VK L Q   ++   TR  Y+P+  A
Sbjct:  281 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGF---TPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVET-PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHT---PLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAA-GKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAES-LQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQA 713          

HSP 5 Score: 193.356 bits (490), Expect = 2.946e-50
Identity = 117/474 (24.68%), Postives = 215/474 (45.36%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRR------------------------------------PIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VKFL+++  +  I  E K                                      P+H A       + +LL++   +   F  +    PLH+A   G+   V++L++    I+A  +   +P++ A + GHV I ++L+DQ   IQ    KN   PIHM     H D V+ L+  N +I+    D   P+H+A   GH  +AK+L+D        A      P+H AC   H+ ++++L+  + ++EA  E    P+H+A   G   IV++L+ +     A   +    P+H A + GH  +   L+     ++A  +D+   +H A   GH+ + KLL++ K +  +     +  P+H A   GH    ++L+D         +  + P+  A++ G +++ ++L+ +  + +A  +    PLH A    + ++V LL   G    +  R  Y+P+ +A
Sbjct:  113 LYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQA-KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRA-LNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNAS-NVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHT-PLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIA 581          

HSP 6 Score: 187.193 bits (474), Expect = 3.341e-48
Identity = 102/402 (25.37%), Postives = 184/402 (45.77%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            L +   L+   E    PL H+A   GHL IVK L+         +     P+H A   G  E+ + L+ N    +    + +Q  LH A   GHK+ VK+L+E   N N+      +P++ A + GH +  ++L+D     Q    K    P+H+    G  D+ ++L++   +     K+G  P+H+A  + ++ +  +L+        SA +    P+H A     VE+   L+    +  AE  +   P+HLA ++G  ++V +LI ++ ++      +   P+H   + GH  I  +L+ +   + A     + P+H AC  G+  + K L+ ++ ++  G     + P+H A ++GH DI  LL+      N    N    +  A   GYI ++ +L
Sbjct:  363 LKHSASLEAVTESGLTPL-HVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDA-KAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQ-QTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPH-SAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLG-NKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVN-GKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 7 Score: 126.716 bits (317), Expect = 3.278e-29
Identity = 72/299 (24.08%), Postives = 150/299 (50.17%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL--NCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCD--------IEACVGMNNYR-PIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            I    DI T +++G   +HLA + GHV   K++++L  N  +  +  KK    +H A + G  +++  L++   N+ A+ ++ + P+++A ++   E+V+ L++   +          A    N+Y  P++ +    H     + +   C         + P+H A    + N+A+LL++R  ++      N   P+H A  RG+  + +LL+DR   ++A  +++  P+  A+  G++ I++IL++Q   I A  +    P+H A +  H + V+ L Q   +I+ +T +  +P+ +A
Sbjct:   30 IKNGIDINTANQNGLNGLHLASKEGHV---KMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASH-----ITLKNVCSF--ITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVA 317          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 217.624 bits (553), Expect = 3.903e-58
Identity = 120/438 (27.40%), Postives = 217/438 (49.54%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VKFL+++  +  +  E    P+  A ++G   +V LLI+         G+     LH+A       T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV + +IL+D    I+A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + D+       PLH A   GH    ++L         +T++ ++P+ +A
Sbjct:   90 LYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN-FTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANAR-ALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNA-SNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVA 518          

HSP 2 Score: 216.083 bits (549), Expect = 1.207e-57
Identity = 121/444 (27.25%), Postives = 212/444 (47.75%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIED--NWRPIHFACERGHRNIAKLLIDRKCDIEAG----AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   + ++    G  P+H+A   GH    +IL+D N   +    KK   P+H AC  G V++ E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y P+H A K     +   L+  +C   A  E      P+H A + G  ++  LLI ++ ++  G      L    P+H   + GH  IA +LV +   V +     +  +  A   G I++VK L+ Q+  ++   R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  317 LHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDA-KAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHST-ARNGYTPLHIAAKQNQLEVASSLL--QCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 754          

HSP 3 Score: 199.519 bits (506), Expect = 3.154e-52
Identity = 120/466 (25.75%), Postives = 218/466 (46.78%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI--------------------DQRCDIQVFG--------GKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ H +D+E   +     +H A   GQ ++V  L+    +      Q    PL++A  E H + VK L+E+  N +   E   +P+  A ++GH  +  LLI                    D R    +           K    P+H+     +  + ++L++   ++    K+G  P+H+A   G+V + ++L+D    I+A   K    P+H A   GHV ++E+L+ +   I+A+ +    PIH+A +    + VR L+    +I+  + +++  P+H A   GH+ + ++L+D+     A   + + P+H AC++ H     LL+     +EA    +   P+H A   GH +I K L+ R    NA       P+  A+  G+ E+ + L+     +DA  +    PLH A   GH E+VKLL +   + ++ T   ++P+ +A
Sbjct:   24 LHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNA-QSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDART-KDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDD-ITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA-VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIA 485          

HSP 4 Score: 182.57 bits (462), Expect = 7.969e-47
Identity = 104/415 (25.06%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  158 IRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDI----EACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +RS    L +   L+   E    PL H+A   GHL IVK L+         +     P+H A   G  E+ + L+ N  ++D +    + +Q PLH A   GHK+ VK+L+E   N ++      +P++ A + GH    ++L+D     Q    K    P+H+ C  G  D+ ++L++   +     K+G  P+H+A  + ++ + K+L+       ++A +    P+H A     +E+   L+    N  +E  +   P+HLA ++G  ++V +LI ++ ++    +    +    P+H   + GH  I  ML+ +   + +     +  +H AC  G+  + K L+ ++  +     +  + P+H A ++GH DI  LL+      N    N   P+  A   GYI ++ +L
Sbjct:  359 MRSMDLLLKHSASLEAVTESGLTPL-HVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAK---AKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQ-QTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-RNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVG-YTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 5 Score: 132.88 bits (333), Expect = 4.248e-31
Identity = 72/310 (23.23%), Postives = 152/310 (49.03%), Query Frame = 2
Query:  617 KNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +N  + +H+   EGH  +V  L+    D+ET  K G   +H+A   G   +   L+    ++ A + +K   P++ A    H+E+++ L+    N     E+ + P+ +A ++G + +V +LI+         G      +H A +        +L+    + +   +  + P+H A    + ++A+LL++R  ++      N   P+H A  RG+  + +LL+DR   ++A  +++  P+  A+  G++ +++IL++Q   I A  +    P+H A +  H + V+ L Q   +I+ +T +  +P+ +A
Sbjct:   18 QNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQS-QKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVA 320          

HSP 6 Score: 129.028 bits (323), Expect = 6.862e-30
Identity = 72/290 (24.83%), Postives = 147/290 (50.69%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            I     I T +++G   +HLA + GHV +   L+    D+E +  KK    +H A + G  +++  L+    N+ A+ ++ + P+++A ++   E+V+ L++   + ++    + + P+  A + GH  +V +L++     +  +      +H A        A +L+  D   D+ +  G   + P+H A    +  +A+LL++R  +VN   +N   P+  A+ RG + +V++L+++   IDA  + +  PLH A   GH  ++++L   G  I+A T+   SP+ +A
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTT-KKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPA----LHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMA 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 205.297 bits (521), Expect = 4.770e-54
Identity = 111/438 (25.34%), Postives = 212/438 (48.40%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+V+FL++H     I  E    P+  A ++G  ++V LL++N        G+     LH+A  +    +  +L++++ N +   +   +P++ A   G++ +A LL+++   +  F  +N   P+H+    G+ ++VK+L+D    I+   KDG  P+H    +GH  + ++L+D    I  S  K    P+H A  G H+  +++L+  +  ++    +    +H+A   G  ++ ++++D+K +  A   +N + P+H ACK     ++ +L+     ++A  E    PIH A   GH NI K L            +     +H A   G  D+ + L+     V+   ++D   +  AS  G  EIV++L+ +     A     + PLH A   GH E   LL + G  + A T++ ++P+ +A
Sbjct:  146 LYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD-FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNT-TNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVA 574          

HSP 2 Score: 195.282 bits (495), Expect = 1.011e-50
Identity = 110/488 (22.54%), Postives = 219/488 (44.88%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID-------------NKIDFEIFGGQWN-------------------QCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            L N+    +++ R D   +H+A   G+  +VK L+D    I+ + +    P+H     G  ++V++L+D             + +     G   N                      LH+A   GH    K++++   N NA      +P++ ACK+  V++ +LL+     +Q    ++   PIH+  F GH +IVK L        T +  G+  +H+A   G   + + L+     ++  A K  +  +H A   G  EI+++L+ K     A     + P+HLA  +G +E   +L++    + A      + P+H A K+G     ++L+ ++   +   +    P+H A    ++ +A LL+D      A A  N + P+H A ++   +I   L++   + NA       P+  A++ G +++V +L+ +  +++  ++    PLH A +     + ++L   G +++A T+  Y+P+ +A
Sbjct:  256 LLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAV-TESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKA-KDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAAT-KKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAK-NGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVA 739          

HSP 3 Score: 189.889 bits (481), Expect = 5.067e-49
Identity = 110/442 (24.89%), Postives = 209/442 (47.29%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A      +    L+  DHN D+E +  +   P+H A   G   +  LL++     + F  + +  PLH+A   G+ + VK+L++    I+A  +   +P++   + GH ++ ++L+D+   I +   KN   P+HM     H + V++L+  +  ++    D    +H+A   GH  +AK+++D   +  A A      P+H AC    V+++E+L+    +++A  E    PIH+A   G + IV+ L            +     +H A + G   +VR L+     ++   +D+   +H A   G   I +LL+ +K    + A  + + P+H A   GH++ A LL++    ++A  +  + P+  A++ G IE  K+L+ ++   D   +    PLH A    +  +  LL   G    A  +  Y+P+ +A
Sbjct:  206 PALHIAARKDDTKSAALLLQNDHNADVESKSGFT--PLHIAAHYGNINVATLLLNRGAAVD-FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPN-TTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL-QKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIA 640          

HSP 4 Score: 189.119 bits (479), Expect = 7.830e-49
Identity = 101/438 (23.06%), Postives = 205/438 (46.80%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH ++ K ++D   +   +      P+H AC+K + ++++LL+ +    +    +    P+H+A + GH++ VK L     + N  +    + ++ A + G  ++ + L+     + +   K+ +  +H+    G A+IV++L+ +          G  P+HLA   GH   A +L++    + A A KK   P+H A   G +E  ++L+ K    +   +    P+H+A    ++ +  +L+D      A    N Y P+H A K     I   L++   +  A       P+H A + G  ++  LL+ +  ++  G   N   P+H A +     +A++L++   +V+A  +  + P+  A   G +++V  L+  +  I++  +  + PLH A ++GHT I+ +L Q       LT    + + +A
Sbjct:  373 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVT-ESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDI-KAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSA-ATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAA-KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMG-NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIA 805          

HSP 5 Score: 177.948 bits (450), Expect = 3.260e-45
Identity = 111/466 (23.82%), Postives = 214/466 (45.92%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI-------------------------------DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+LE     +   VDI I ++     +H A ++G  E+V  L+      +    + N   LH+A   G  D V+ L+ +  N+NA  +   +P+Y A +  H+E+ + L++     Q    ++   P+ +   +GH  +V +L+                               D N D+E+  K G  P+H+A   G++ +A +L++    ++  A +    P+H A   G+  ++++L+ +   I+A+ ++   P+H     G +++V ML+DR   I +    N   P+H A +  H   V++L+     ++    D    +H A   GH  +AK+++D+K +  A A LN + P+H AC++    + +LL+     + A  E+   PI  A+  G+  IVK L +     +  +      LH A   G  ++V+ L Q G  ++   +++ + + +A
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTA-LHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGAS-QSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFMA-RNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIA 508          

HSP 6 Score: 167.548 bits (423), Expect = 6.754e-42
Identity = 95/384 (24.74%), Postives = 175/384 (45.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            IH+A   GH  IVK L  H       +      +H A   GQA++V+ L+ N    +I   + +Q  LH+A   G  + V++L++     +A      +P++ A + GH E A LL++    +     K    P+H+    G  +  K+L+ +    +T  K G  P+H+A    +  +A +L+D      A+A K    P+H A     +EI   L+       A   +   P+HLA ++G  ++V +L+ +  ++      N   P+H A +     +  +L++   +++A  +  + P+H AC  G+  +   L++ +  I +    + + P+H A ++GH  I  +L+  +   N    N    +  A   GYI +V  L
Sbjct:  439 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDI-KAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSA-ATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAA-KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMG-NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTK-SGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 204.142 bits (518), Expect = 1.455e-53
Identity = 106/438 (24.20%), Postives = 212/438 (48.40%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H     GH ++V+ L+D    I  + +    P+H A +      V+LL+ +++  +     +    LH+A   GH    K++++   N NA      +P++ ACK+  +++ +LL+     IQ    ++   PIH+  F GH +IV  L++      T +  G+  +H+A   G   + K L+     ++A + K  + P+H +   G  EI++ L+      ++     + P+HLA  +G K++  +L+D+   +        + P+H A K+G   +  +L+ ++   +A  +    P+H A    ++ +A LL+D+     A A  N + P+H A ++   +IA  L++   D NA       P+  AS+ G +++V +L+ +   I+ C++    PLH A +     + ++L   G  ++  T+  Y+P+ +A
Sbjct:  252 LHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTA-LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVT-ESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKS-KDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASL-GITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAK-NGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVA 684          

HSP 2 Score: 199.519 bits (506), Expect = 3.911e-52
Identity = 115/440 (26.14%), Postives = 220/440 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+E+V  LI     ++   +     +H A   GQ+++VK L+ N  +      Q    PL++A  E H D V+ L+++  + +   E   +P+  A ++GH ++  LL++         GK +   +H+   +       +L+  D N D+E+  K G  P+H+A   G++ +A +L++    ++  A +    P+H A   G+  ++++L+ +   I+A+ ++   P+H     G +++V ML+DR   I +    N   P+H A +  H   V++L+  +  ++    D    +H A   GH  +AK+++D+K +  A A LN + P+H AC++    + +LL+     + A  E+   PI  A+  G+  IV  L+N     +  +      LH A   G TE+VK L Q G  ++A ++++ +P+ ++
Sbjct:   25 LHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNA-QSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKAAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFKA-RNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHIS 453          

HSP 3 Score: 196.052 bits (497), Expect = 5.948e-51
Identity = 109/441 (24.72%), Postives = 214/441 (48.53%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HL++V++L+D+     I  E    P+  A ++G  ++V LL++N        G+     LH+A  +       +L++++ N +   +   +P++ A   G++ +A LL+++   +  F  +N   P+H+    G++++VK+L++    I+   KDG  P+H    +GH  + ++L+D    I  S  K    P+H A  G H+  +++L+     ++    +    +H+A   G  ++ ++++D+K +  A   +N + P+H ACK     ++ +L+     I+A  E    PIH A   GH NI   L++      A     N R    +H A   G  ++ K LV     V+A  ++D  P+  +S  G  EI++ L+      D+     + PLH A   GH ++  +L   G  +   T++ ++P+ +A
Sbjct:   91 LYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD-FKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHG----ASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVA 519          

HSP 4 Score: 192.586 bits (488), Expect = 5.971e-50
Identity = 114/447 (25.50%), Postives = 212/447 (47.43%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLI--DHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYR---PIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKC--DIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            P +H+A      +    L+  DHN D+E +  +   P+H A   G   +  LL++     + F  + +  PLH+A   G+ + VK+L+E    I+A  +   +P++   + GH ++ ++L+D+   I +   KN   P+HM     H + V++L+     ++    D    +H+A   GH  +AK+++D   +  A A      P+H AC    ++++E+L+    +I+A  E    PIH+A   G + IV  L++      A     N R    +H A + G   +V+ L+     ++A  +D+  P+H +   G   I + L+      D    +G   + P+H A   GHKD+A +L+D+   +    +  + P+  A++ G IE+  +L+ ++   DA  +    PLH A    + ++  LL   G    A  +  Y+P+ +A
Sbjct:  151 PALHIAARKDDTKAAALLLQNDHNADVESKSGFT--PLHIAAHYGNINVATLLLNRGAAVD-FKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHG----ASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSG---YTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIA 585          

HSP 5 Score: 157.532 bits (397), Expect = 8.213e-39
Identity = 97/413 (23.49%), Postives = 182/413 (44.07%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFAC---------------------------ERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC    +++++ L+ H   I+   E    PIH A   G   IV  L+++         +  +  LH+A   G  + VK L+++   ++A  + +++P++ + + G  EI + L+      D     G     P+H+   EGH D+  +L+D+   +    K G  P+H+A + G + +A +L+      +AS GK    P+H A    + ++  +L+ +  +  A  +  + P+H+A +K   EI   L++   D  A +      P+H A + G+  +V +LM R   I  C +    P+H A +    N+A++L++    ++    +  + P+H AC                           ++GH  I  LL+      N    N    +  A   GYI +V  L
Sbjct:  351 LHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVR-GETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYT---PLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDAS-GKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNA-ITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMG-YTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 6 Score: 157.147 bits (396), Expect = 1.114e-38
Identity = 86/384 (22.40%), Postives = 185/384 (48.18%), Query Frame = 2
Query:  482 IESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNC-----------------------------NIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            ++S  +IN C++   + ++ A K GHVE+   LI     +     K     +H+    G +D+VK L+    ++    ++G  P+++A +  H+ + + L+D N   ++ A +    P+  A   GH +++ +L+  +                              N + E +  + P+H+A   G+  +  +L++R   ++     N+  P+H A K G++ +V++L++R   I+A  +D   P+H     GH  + ++L+DR   I +    N   P+H A +  H +  +LL+  +  V+    +    +  A+  G+ ++ K+++++K + +A     + PLH AC++   ++++LL + G  I+A+T    +P+ +A
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDA-ATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLD-NGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD-FKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTK-NGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVA 387          

HSP 7 Score: 150.984 bits (380), Expect = 9.450e-37
Identity = 81/325 (24.92%), Postives = 162/325 (49.85%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI 1186
            + E  +H+A   G  E+VK+L+ +   ++ + +  + P+H +   G+ EI++ L+ +    D     G     PLHLA  EGHKD   IL++   ++    +   +P++ A K G +E+A LL+ +R       GK+   P+H+     +  +  +L+D+        K+G  P+H+A +   + IA  L++   D  A   ++   P+H A   G+V+++ +L++++  I   ++    P+HLA ++    +  +L++    ++    M  Y P+H AC +G+  +V  L+  +  + A  +        A ++GH +I  LL+
Sbjct:  412 RGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSG---YTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDA-SGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAIT-RQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKM-GYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVT------AAQQGHTHIINLLL 724          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 200.29 bits (508), Expect = 2.091e-52
Identity = 115/449 (25.61%), Postives = 216/449 (48.11%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNR--------SPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR---PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+V+FL++H     I  E    P+  A ++G  ++V LL++N        G+     LH+A  +    +  +L++++ N +   +V+         +P++ A   G++ +A LL+++   +  F  +N   P+H+    G+ ++VK+L+D    I+   KDG  P+H    +GH  + ++L+D    I  S  K    P+H A  G H+  +++L+  +  ++    +    +H+A   G  ++ ++++D+K +  A   +N + P+H ACK     ++ +L+     ++A  E    PIH A   GH NI K L        A     N R    +H A   G  D+ + L+     V+   ++D   +  AS  G  EIV++L+ +     A     + PLH A   GH E   LL + G  + A T++ ++P+ +A
Sbjct:  110 LYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVD-FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAK-ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHG----ASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVA 546          

HSP 2 Score: 194.126 bits (492), Expect = 2.384e-50
Identity = 110/488 (22.54%), Postives = 219/488 (44.88%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID-------------NKIDFEIFGGQWN-------------------QCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            L N+    +++ R D   +H+A   G+  +VK L+D    I+ + +    P+H     G  ++V++L+D             + +     G   N                      LH+A   GH    K++++   N NA      +P++ ACK+  V++ +LL+     +Q    ++   PIH+  F GH +IVK L        T +  G+  +H+A   G   + + L+     ++  A K  +  +H A   G  EI+++L+ K     A     + P+HLA  +G +E   +L++    + A      + P+H A K+G     ++L+ ++   +   +    P+H A    ++ +A LL+D      A A  N + P+H A ++   +I   L++   + NA       P+  A++ G +++V +L+ +  +++  ++    PLH A +     + ++L   G +++A T+  Y+P+ +A
Sbjct:  228 LLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAV-TESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKA-KDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAAT-KKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAK-NGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVA 711          

HSP 3 Score: 188.734 bits (478), Expect = 1.397e-48
Identity = 101/438 (23.06%), Postives = 205/438 (46.80%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH ++ K ++D   +   +      P+H AC+K + ++++LL+ +    +    +    P+H+A + GH++ VK L     + N  +    + ++ A + G  ++ + L+     + +   K+ +  +H+    G A+IV++L+ +          G  P+HLA   GH   A +L++    + A A KK   P+H A   G +E  ++L+ K    +   +    P+H+A    ++ +  +L+D      A    N Y P+H A K     I   L++   +  A       P+H A + G  ++  LL+ +  ++  G   N   P+H A +     +A++L++   +V+A  +  + P+  A   G +++V  L+  +  I++  +  + PLH A ++GHT I+ +L Q       LT    + + +A
Sbjct:  345 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVT-ESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDI-KAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSA-ATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAA-AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMG-NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIA 777          

HSP 4 Score: 188.348 bits (477), Expect = 1.744e-48
Identity = 110/470 (23.40%), Postives = 211/470 (44.89%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID--------------------RKCDIEAGAGLNNW------------RPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H     GH ++V+ L+D    I  + +    P+H A +      V+LL+ + +  +     +    LH+A   GH    K++++   N NA      +P++ ACK+  V++ +LL+     +Q    ++   PIH+  F GH +IVK L        T +  G+  +H+A   G   + + L+     ++  A K  +  +H A   G  EI+++L+ K     A     + P+HLA  +G +E   +L++    + A      + P+H A K+G     ++L+ ++   +   +    P+H A    ++ +A LL+D                    +K  +E G  L  +             P+H A + G  D+  LL+ +  +VN   +N   P+  A++   + + ++L+N   ++DA  +  + PLH AC  G+ ++V  L +    I + T+  Y+P+  A
Sbjct:  279 LHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTA-LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVT-ESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKA-KDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAAT-KKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQA 744          

HSP 5 Score: 179.104 bits (453), Expect = 1.640e-45
Identity = 109/446 (24.44%), Postives = 212/446 (47.53%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIE------TCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+E+V  L+     ++   +     +H A   GQ ++V+ L+ N  +      Q    PL++A  E H + V+ L+E   + +   E   +P+  A ++GH ++  LL++         GK +   +H+   +       +L+  D N D+E      T    G  P+H+A   G++ +A +L++    ++  A +    P+H A   G+  ++++L+ +   I+A+ ++   P+H     G +++V ML+DR   I +    N   P+H A +  H   V++L+     ++    D    +H A   GH  +AK+++D+K +  A A LN + P+H AC++    + +LL+     + A  E+   PI  A+  G+  IVK L +     +  +      LH A   G  ++V+ L Q G  ++   +++ + + +A
Sbjct:   44 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNA-QSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMA-RNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKT-KNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKA-LNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIA 480          

HSP 6 Score: 166.777 bits (421), Expect = 1.140e-41
Identity = 95/384 (24.74%), Postives = 175/384 (45.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            IH+A   GH  IVK L  H       +      +H A   GQA++V+ L+ N    +I   + +Q  LH+A   G  + V++L++     +A      +P++ A + GH E A LL++    +     K    P+H+    G  +  K+L+ +    +T  K G  P+H+A    +  +A +L+D      A+A K    P+H A     +EI   L+       A   +   P+HLA ++G  ++V +L+ +  ++      N   P+H A +     +  +L++   +++A  +  + P+H AC  G+  +   L++ +  I +    + + P+H A ++GH  I  +L+  +   N    N    +  A   GYI +V  L
Sbjct:  411 IHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDI-KAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSA-ATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAA-KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMG-NKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTK-SGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 7 Score: 145.206 bits (365), Expect = 7.428e-35
Identity = 81/392 (20.66%), Postives = 183/392 (46.68%), Query Frame = 2
Query:  482 IESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISK-------------------------------NCNIEAE------DEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++  +IN C++   + ++ A K GHVE+   L+     +     K     +H+    G  D+V+ L+    ++    ++G  P+++A +  H+ + + L++     ++ A +    P+  A   GH +++ +L+                                 N ++E++          + P+H+A   G+  +  +L++R   ++  +  N+  P+H A K G+  +V++L+DR   I+A  +D   P+H     GH  + ++L+DR   I +    N   P+H A +  H +  +LL+     V+    +    +  A+  G+ ++ K+++++K + +A     + PLH AC++   ++++LL + G  ++A+T    +P+ +A
Sbjct:   27 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDA-ATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGAS-QSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVD-FMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTK-NGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVA 414          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 217.238 bits (552), Expect = 1.262e-59
Identity = 115/438 (26.26%), Postives = 216/438 (49.32%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLEIVKFL+D+  +  +  E    P+  A ++G  ++V LL+++        G+     LH+A  +   +   +L++   N +   +   +P++ A   G++ +A LL++    +  F  +N   P+H+    G+ ++VK+L+D    I+T  +DG  P+H A  +GH  + ++L++ +  I A   K    P+H A  G H+  +++L+ +   ++    +   P+H+A   G   + ++L+DR  +  A   +N + P+H ACK     ++ +L+     I    E    PIH A   GH N+ +LL+       A   +    P+H A   G  ++ K L+     V      D  P+  AS  G  EIV++L+ +  D +A       PL++A   GH ++  LL + G DI  +T++ ++P+ +A
Sbjct:  114 LYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK-----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVD-FTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNA-TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIA 542          

HSP 2 Score: 216.468 bits (550), Expect = 1.865e-59
Identity = 117/444 (26.35%), Postives = 222/444 (50.00%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+    +I+   +     +H A   GQ +IV++L++       FG   N        PL++A  E H + VK L+++  N +   E   +P+  A ++GH ++  LL++         GK +   +H+   +   +   +L+    + +   K G  P+H+A   G++ +A +L++L   ++ +A +    P+H A   G+  ++++L+ +   I+ +  +   P+H A   G ++++ ML++R   I A    N   P+H A +  H   V++L+ R+  ++    D   P+H A   GH  +AKLL+DR  +  A A LN + P+H AC++    + +LL+     ++   E+   PI  AS  G++ +V++L+      +A +     PLH A   G  E+VK L Q+G  +    RE+ +P+ +A
Sbjct:   48 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVE-------FGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK-----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTA-RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA 476          

HSP 3 Score: 208.764 bits (530), Expect = 9.070e-57
Identity = 113/450 (25.11%), Postives = 215/450 (47.78%), Query Frame = 2
Query:  203 EYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ-CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG-AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            ++  R     +H+A   G+  +VK L+D    I+ +      P+H A   G  +++++L++   D  I     N   PLH+A    H   V++L+     ++       +P++ A   GH  +AKLL+D+  +       N   P+H+ C +    ++++L+     I T  + G  PIH+A   GH+ + ++L+       A+   +   P+H A   G +E+++ L+     +  +  E   P+H+A   G  EIV++L+ R  D  A    +   P++FA + GH  +  +L++   DI    +  + P+H A + G   +A LL+++    +   AG N   P+H A    H+ +A LL+D+    ++  +N + P+  A+++  +E+ K+L+    + +   +    PLH A + GH ++V LL      I   T+   + M LA
Sbjct:  232 DFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER--DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT-NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA-SGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 676          

HSP 4 Score: 202.601 bits (514), Expect = 1.188e-54
Identity = 109/440 (24.77%), Postives = 211/440 (47.95%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISK--NCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D   +   R      P+H AC+K + ++++LL+ +         +    P+H+A + GH + V++L+++  + NA +    +P++ A + G +E+ K L+     + V   +  + P+H+    G A+IV++L+    D       G  P++ A   GH  +A +L++   DI +   KK   P+H A   G +E+  +L+ K  + + +   +    P+H+A     +++  +L+D+     +    N Y P+H A K     + ++L++   +     +    P+H A + GH ++  LL+ R   I   A       +H A +    ++A++L   K DVN   +  + P+  AS  G I++V  L+  +  ++A  R  + PLH A ++GHT +V  L Q       LT    + + +A
Sbjct:  341 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTT-ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGV-KAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADI-SPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTA-KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISL-ATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 775          

HSP 5 Score: 191.815 bits (486), Expect = 4.398e-51
Identity = 110/470 (23.40%), Postives = 211/470 (44.89%), Query Frame = 2
Query:  203 EYLERKDEPLI----------HLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACV-GMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            E L  +D P++          H+A    HL  V+ L+     ++        P+H A   G   + KLL+D        GG+ N        PLH+AC +     +++L++   +I+   E   +PI+ A   GH+ + +LL+           + +  P+HM    G  ++VK L+     +    ++ + P+H+A   G   I ++L+    D  A     S  P++FA   GH ++  +L+    +I    ++ + P+H+A + G  E+  +L+++    +  V G N   P+H A  + H  +  +L+D+     +  ++ + P+H A ++    + K+L+      E GA  N        P+H A + GH D+  LL+ R   ++   +     +  A++   + + +IL   K D++   +  + PLH A   G+ ++V  L +    + A TR  Y+P+  A
Sbjct:  288 EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR-------GGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGET-PLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST-PLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLL------ELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQA 742          

HSP 6 Score: 191.045 bits (484), Expect = 7.041e-51
Identity = 116/493 (23.53%), Postives = 217/493 (44.02%), Query Frame = 2
Query:   80 FVSFVFGKNFNRTYFWMDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLID--NKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQ--WRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             V F+     N++    D F  L   ++    ++       +   +   P +H+A           L+ H  + ++  +    P+H A   G   +  LL++    +DF    G     PLH+A   G+ + VK+L++    I+       +P++ A + GH ++ ++L+++   I +   KN   P+HM     H   V++L+     ++    D   P+H+A   GH  +AK+L+D   +  A A      P+H AC    ++++E+L+    +I    E    PIH+A   G   +V++L+       A   +    P+H A + G   +V+ L+     +     ++  P+H A   G   I +LL+ R  D  A    +   P++FA   GH D+A LL++   D++   +  + P+  AS+ G +E+  +L+ +    D     Q    PLH A    H ++  LL   G    +  +  Y+P+ +A
Sbjct:  125 IVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNG---ITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI-LAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT-NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA-SGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIA 610          

HSP 7 Score: 171.014 bits (432), Expect = 2.692e-44
Identity = 95/386 (24.61%), Postives = 177/386 (45.85%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDE--NCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            IH+A   GHL +V+ L+ +       +     P+H A   GQ E+VK L+ +     +   + +Q PLH+A   G  + V++L++   + NA      +P+YFA + GH ++A LL++   DI     K    P+H+    G  ++  +L+++  + D +   ++G  P+H+A    H  +A +L+D      ++A K    P+H A     +E+ +VL+          ++   P+HLA ++G  ++V +L+ R   I           +H A +     +  +L   K D+    +  + P+H A   G+  +   L+  +  + A    N + P+H A ++GH  +   L+  +   N    N    +  A   GYI +V  L
Sbjct:  407 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGV-KAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFT-PLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTA-KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLAT-KGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKT-RNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 8 Score: 164.466 bits (415), Expect = 3.567e-42
Identity = 84/331 (25.38%), Postives = 166/331 (50.15%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD 1201
            R + PL H+A   G LE+VK L+     + ++    + P+H A   G+AEIV+LL+    D        +  PL+ A  EGH D   +L+E+  +I+   +   +P++ A K G +E+A LL+++    D +V  G+N   P+H+     H  +  +L+D+     +  K+G  P+H+A +   + + K+L++L  +      ++   P+H A   GH +++ +L+ ++ +I    +     +HLA ++    +  +L   K D+     +  Y P+H A  +G+  +V  L+  +  + A   + + P+H A ++GH ++   L+  +  
Sbjct:  435 RGETPL-HMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGS-TPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKV-AGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLT-QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKL-CYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 760          

HSP 9 Score: 142.895 bits (359), Expect = 2.854e-35
Identity = 78/285 (27.37%), Postives = 148/285 (51.93%), Query Frame = 2
Query:  698 DIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            DI TC+++G   +HLA + GHV +   L+    +I+ +A K     +H A + G  +I+ VL+    NI A+ +  + P+++A ++   EIV+ L+D   + ++    + + P+  A + GH  +V +L++   D +  +      +H A  +   N A LL+  +   D+ + +G   + P+H A   G+ ++A LL++    V+    N   P+  A++RG   +VK+L+++   ID   R    PLH A   GH +++++L +    I A T+   SP+ +A
Sbjct:   36 DINTCNQNGLNALHLASKEGHVDVVTELLKREAEID-TATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGAN-QSVATEDGFTPLAVALQQGHEQVVGLLLE--SDTKGKVR--LPALHIAARKDDTNAAALLLQHEHNADVTSKSG---FTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMA 311          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.157 bits (544), Expect = 1.956e-58
Identity = 117/446 (26.23%), Postives = 217/446 (48.65%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIE--------SNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLEIVKFL+D+  +  +  E    P+  A ++G  ++V LL+++        G+     LH+A  +   +   +L++        S   +N   E   +P++ A   G++ +A LL++    +  F  +N   P+H+    G+ ++VK+L+D    I+T  +DG  P+H A  +GH  + ++L++ +  I A   K    P+H A  G H+  +++L+ +   ++    +   P+H+A   G   + ++L+DR  +  A   +N + P+H ACK     ++ +L+     I    E    PIH A   GH N+ +LL+       A   +    P+H A   G  ++ K L+     V      D  P+  AS  G  EIV++L+ +  D +A       PL++A   GH ++  LL + G DI  +T++ ++P+ +A
Sbjct:  113 LYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK-----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVD-FTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNA-TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIA 549          

HSP 2 Score: 211.075 bits (536), Expect = 2.186e-57
Identity = 118/452 (26.11%), Postives = 225/452 (49.78%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIET------CDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+    +I+   +     +H A   GQ +IV++L++       FG   N        PL++A  E H + VK L+++  N +   E   +P+  A ++GH ++  LL++         GK +   +H+   +   +   +L+  + N D+ +        + G  P+H+A   G++ +A +L++L   ++ +A +    P+H A   G+  ++++L+ +   I+ +  +   P+H A   G ++++ ML++R   I A    N   P+H A +  H   V++L+ R+  ++    D   P+H A   GH  +AKLL+DR  +  A A LN + P+H AC++    + +LL+     ++   E+   PI  AS  G++ +V++L+      +A +     PLH A   G  E+VK L Q+G  +    RE+ +P+ +A
Sbjct:   47 LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVE-------FGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK-----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTA-RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT-KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIA 483          

HSP 3 Score: 209.149 bits (531), Expect = 9.422e-57
Identity = 121/492 (24.59%), Postives = 227/492 (46.14%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKR---------------------------------GHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            ++ +K  L++  E    PL H+A  +G++ +   L++    ++        P+H A ++G   +VKLL+D   KID +   G     PLH A   GH+  +++L+E +  I A  +   SP++ A +                                  GH  +AKLL+D+  +       N   P+H+ C +    ++++L+     I T  + G  PIH+A   GH+ + ++L+  N     +   +   P+H A   G +E+++ L+     +  +  E   P+H+A   G  EIV++L+ R  D  A    +   P++FA + GH  +  +L++   DI    +  + P+H A + G   +A LL+++    +   G N   P+H A    H+ +A LL+D+    ++  +N + P+  A+++  +E+ K+L+    + +   +    PLH A + GH ++V LL      I   T+   + M LA
Sbjct:  198 DVTSKMMLNQTTESGFTPL-HIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGL---TPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA-SGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADP-KGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 681          

HSP 4 Score: 206.838 bits (525), Expect = 6.696e-56
Identity = 109/438 (24.89%), Postives = 211/438 (48.17%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D   +   R      P+H AC+K + ++++LL+ +         +    P+H+A + GH + V++L+++  + NA +    +P++ A + G +E+ K L+     + V   +  + P+H+    G A+IV++L+    D       G  P++ A   GH  +A +L++   DI +   KK   P+H A   G +E+  +L+ K  + + + +    P+H+A     +++  +L+D+     +    N Y P+H A K     + ++L++   +     +    P+H A + GH ++  LL+ R   I   A       +H A +    ++A++L   K DVN   +  + P+  AS  G I++V  L+  +  ++A  R  + PLH A ++GHT +V  L Q       LT    + + +A
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTT-ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGV-KAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADI-SPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTA-KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISL-ATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIA 780          

HSP 5 Score: 191.045 bits (484), Expect = 1.198e-50
Identity = 118/499 (23.65%), Postives = 219/499 (43.89%), Query Frame = 2
Query:   80 FVSFVFGKNFNRTYFWMDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLI--DHNVDIEIR------DEWKRRPIHSACEKGQAEIVKLLID--NKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             V F+     N++    D F  L   ++    ++       +   +   P +H+A           L+  +HN D+  +       E    P+H A   G   +  LL++    +DF    G     PLH+A   G+ + VK+L++    I+       +P++ A + GH ++ ++L+++   I +   KN   P+HM     H   V++L+     ++    D   P+H+A   GH  +AK+L+D   +  A A      P+H AC    ++++E+L+    +I    E    PIH+A   G   +V++L+       A   +    P+H A + G   +V+ L+     +     ++  P+H A   G   I +LL+ R  D  A    +   P++FA   GH D+A LL++   D++   +  + P+  AS+ G +E+  +L+ +    D   +    PLH A    H ++  LL   G    +  +  Y+P+ +A
Sbjct:  124 IVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI---TPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI-LAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT-NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA-SGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIA 615          

HSP 6 Score: 189.504 bits (480), Expect = 3.820e-50
Identity = 109/469 (23.24%), Postives = 210/469 (44.78%), Query Frame = 2
Query:  203 EYLERKDEPLI----------HLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ------CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            E L  +D P++          H+A    HL  V+ L+     ++        P+H A   G   + KLL+D        GG+ N        PLH+AC +     +++L++   +I+   E   +PI+ A   GH+ + +LL+           + +  P+HM    G  ++VK L+     +    ++ + P+H+A   G   I ++L+    D  A     S  P++FA   GH ++  +L+    +I    ++ + P+H+A + G  E+  +L+++    +   G N   P+H A  + H  +  +L+D+     +  ++ + P+H A ++    + K+L+      E GA  N        P+H A + GH D+  LL+ R   ++   +     +  A++   + + +IL   K D++   +  + PLH A   G+ ++V  L +    + A TR  Y+P+  A
Sbjct:  295 EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDR-------GGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGET-PLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST-PLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK-GKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLL------ELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQA 747          

HSP 7 Score: 173.326 bits (438), Expect = 7.384e-45
Identity = 95/384 (24.74%), Postives = 175/384 (45.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            IH+A   GHL +V+ L+ +       +     P+H A   GQ E+VK L+ +     +   + +Q PLH+A   G  + V++L++   + NA      +P+YFA + GH ++A LL++   DI     K    P+H+    G  ++  +L+++    +   K+G  P+H+A    H  +A +L+D      ++A K    P+H A     +E+ +VL+          ++   P+HLA ++G  ++V +L+ R   I           +H A +     +  +L   K D+    +  + P+H A   G+  +   L+  +  + A    N + P+H A ++GH  +   L+  +   N    N    +  A   GYI +V  L
Sbjct:  414 IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGV-KAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFT-PLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTA-KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLAT-KGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKT-RNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 8 Score: 164.466 bits (415), Expect = 4.692e-42
Identity = 83/329 (25.23%), Postives = 163/329 (49.54%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD 1201
            R + PL H+A   G LE+VK L+     + ++    + P+H A   G+AEIV+LL+    D        +  PL+ A  EGH D   +L+E+  +I+   +   +P++ A K G +E+A LL+++        GKN   P+H+     H  +  +L+D+     +  K+G  P+H+A +   + + K+L++L  +      ++   P+H A   GH +++ +L+ ++ +I    +     +HLA ++    +  +L   K D+     +  Y P+H A  +G+  +V  L+  +  + A   + + P+H A ++GH ++   L+  +  
Sbjct:  442 RGETPL-HMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGS-TPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADP-KGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLT-QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKL-CYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 765          

HSP 9 Score: 153.295 bits (386), Expect = 1.650e-38
Identity = 87/364 (23.90%), Postives = 179/364 (49.18%), Query Frame = 2
Query:  482 IESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI--DRKCDIEACVGMN-----NYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            ++   +IN C++   + ++ A K GHV++   L+ +  +I     K     +H+    G  DIV++L++   +I    ++G  P+++A +  H+ I K L+D N   ++ A +    P+  A   GH +++ +L+  +     + +     +H+A  K D     +L+  +   D+ + + +N      + P+H A  +G+  +  +L++    ++    +   P+H A +RG+ N+ KLL+DR  K D +   GL    P+H A   GH+ + ++L++R   + A  +N   P+  A++  ++  V++L+ ++  +D        PLH A   GH  + KLL   G +  A     ++P+ +A
Sbjct:   30 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDT-ATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLD-NGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDT----KGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLT---PLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIA 384          

HSP 10 Score: 62.7734 bits (151), Expect = 3.040e-10
Identity = 43/185 (23.24%), Postives = 85/185 (45.95%), Query Frame = 2
Query: 1223 NNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAXXXXXXXXXXXXXXVKSERKGEKRLTWKYKTPKDQTFEEQEEKNLARMISLMGLKCQMNCDHSLCPTSLKNKTFQNG 1777
            N    +H A + GH D+   L+ R+ +++   +     +  A+  G  +IV++L+    +I+A  +  + PL+ A +  H EIVK L   G +    T + ++P  LA          +   ++S+ KG+ RL      P       +++ N A ++    L+ + N D  +    + N+T ++G
Sbjct:   42 NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTP--LAVALQQGHEQVVGLLLESDTKGKVRL------PALHIAARKDDTNAAALL----LQHEHNAD--VTSKMMLNQTTESG 212          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.134 bits (505), Expect = 8.840e-53
Identity = 106/422 (25.12%), Postives = 203/422 (48.10%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGC 1498
            +H+A   GH    K L+D   +  +R      P+H AC+K +  +++LL+      E    +    P+H++ + G+ + V IL++   + NA +    + ++ A + G  E+ + L+     +     + ++ P+H+    G  +IV++L+      +    +G  P+H+A   GH  +  IL++    + A   KK   P+H A   G +E+  +L+ +  + +A  +    P+H+A    ++++  +L+D+     A    N Y P+H A K     I   L++   +  A       P+H   + GH ++A LL+ R  D+   A  +   P+H A +    ++A++LV     VNA  +  + P+I A   G I++V  L+    D+++  +  + PLH A ++GHT IV LL + G 
Sbjct:   76 LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVT-ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDA-KAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-AVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHA-TAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNH-ATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 492          

HSP 2 Score: 189.504 bits (480), Expect = 1.022e-49
Identity = 108/470 (22.98%), Postives = 217/470 (46.17%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCD---------------------------IEAGAGLN-----NWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H A   GH ++V+ L++    I  + +    P+H A +    E V++L+  +   +     +    LH+A   GH  T K+L++   N N       +P++ ACK+  + + +LL+     I+    ++   P+H+  F G+ +IV +L+         +  G+  +H+A   G   + + L+     ++A A ++ + P+H A   G +EI+++L+    + +A     + P+H+A  +G +++  +L++    + A      + P+H A K+G   +  +L+ R    +A  ++   P+H A    ++ +A LL+D+                              +E GA  N        P+H   + GH D+A LL+ R  DVN   ++   P+  A++   + + +IL+     ++A  +  + PL  AC  G+ ++V  L Q G D+ + T+  Y+P+  A
Sbjct:   10 LHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTA-LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAV-TESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKA-REEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-AVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQA 475          

HSP 3 Score: 174.481 bits (441), Expect = 6.882e-45
Identity = 103/406 (25.37%), Postives = 181/406 (44.58%), Query Frame = 2
Query:  428 CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVE---------------------------------IAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             PLH A   GH+  V+IL+E    I A  +   SP++ A +  HVE                                  AK+L+D+  +  V    N   P+H+ C +    ++++L+     IE   + G  P+H++   G++ I  IL+       A+   +    +H A   G  E++  L+     ++A+  E   P+H+A   G  EIV++L+      +A    N Y P+H A + GH  +  +L++    +    +  + P+H A + G   +A LL+ R    +A AG N   P+H A    ++ +A LL+D+    +A  +N + P+  A+++  +EI   L+    + +A  R    PLH   + GH ++  LL     D+   T+   SP+ LA
Sbjct:    8 TPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVR-ALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNAT-NVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDA-AGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLA 409          

HSP 4 Score: 158.303 bits (399), Expect = 7.790e-40
Identity = 80/323 (24.77%), Postives = 160/323 (49.54%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI 1186
            + E  +H+A   G  E+V+ L+ +   ++ +   ++ P+H A   G+ EIV+LL+ +    +         PLH+A  EGH+D   IL+E   ++    +   +P++ A K G +E+A LL+ QR       GKN   P+H+     +  +  +L+D+        K+G  P+H+A +   + IA  L++   +  A   ++   P+H     GH ++  +L+++  ++    +    P+HLA ++    +  +L+     + A   +  Y P+  AC +G+  +V  L+    D+ +  ++ + P+H A ++GH +I  LL+
Sbjct:  170 RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAIT-RQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKL-GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 5 Score: 151.369 bits (381), Expect = 1.241e-37
Identity = 92/416 (22.12%), Postives = 174/416 (41.83%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGL--------------------------------NNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +H+AC    + +++ L+ +   IE   E    P+H +   G   IV +L+           +  +  LH+A   G  + V+ L+ +   ++A     ++P++ A + G +EI +LL+            N   P+H+   EGH D+  +L++    +    K G  P+H+A + G + +A +L+      +A AGK    P+H A    + ++  +L+ +  +  A  +  + P+H+A +K   EI   L++   +  A +      P+H   + GH  +  +L+ R  D+    +    P+H A +    N+A++L+     + A   L                                N + P+H A ++GH  I  LL+      N    N    +  A   GYI +V  L
Sbjct:  109 LHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVR-GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDA-ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDA-AGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA-ITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 6 Score: 128.642 bits (322), Expect = 1.657e-30
Identity = 70/277 (25.27%), Postives = 129/277 (46.57%), Query Frame = 2
Query:  716 KDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +DG  P+H A  +GH  + +IL++    I A   K    P+H A  G HVE ++VL+     ++    +    +H+A   G     ++L+D+  +      +N + P+H ACK     ++ +L+     IEA  E    P+H +   G+ NI  +L+       A   +     +H A   G  ++ + L+     V+A    +  P+  A+  G +EIV++L+      DA     + PLH A   GH ++  +L + G  +   T++ ++P+ +A
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKT-KNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPN-VRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNA-TNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVA 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 1.779e-51
Identity = 118/429 (27.51%), Postives = 210/429 (48.95%), Query Frame = 2
Query:  224 EPLIHLACDFGHLEIVKFLIDHNVDIEIRD-EWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIE-ACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDID-ACDRWQWRPLHWACERGHTEIVKLLTQAGCD 1501
            E L+ LAC  G+ E+ + L+  + ++E R  +    P+ +A   G  +IV+LL+ +  D        N   L  AC  G+ D V++L+E+  N+   +E   +P+  A   GHVE+A+LL+++   I     + K   + + C++GH ++V+ L++   D E    +    +  AC +GHV +A++L++    +   A      P+  A  GGHVE+  +LI +  N+E  ++E + P+  A  +G +E+V +L+ +  +I A         +  AC  G   +   L+    D+E  C      P+  A + GH  + K L+    ++ A     +   + +ACE GH D+A LL+    D+    E    P++ A+  G++  V+ LI++  D++ A        L  AC  GH  +V+LL   G D
Sbjct:  134 ESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTA-LTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPA-DSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGC----STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTA-LTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGAD 555          

HSP 2 Score: 169.859 bits (429), Expect = 2.260e-43
Identity = 96/316 (30.38%), Postives = 165/316 (52.22%), Query Frame = 2
Query:  617 KNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMN-NYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWR-PIHFACERGHRNIAKLLIDRKCDIE--AGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWR--PIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             N    + + C  GH D+V +LI    +IE  DK G  P+ LA   GHV + ++L+D   DIEA + +    P+  AC GG  E++E+LI++  N E  +   + P+ LA   G   I+++L++   +I +  G      P+  A   GH   V++L+D   DI A IE N    +  AC +G   +  LL++RK ++E  A  GL    P+  A   G+ ++ ++L++R  DVNA      R   +  A+++G+ +  +++I++   ID  ++    PL  A   GH ++V+LL  +G D++A    + +P+  A
Sbjct:  931 SNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLT---PLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAA 1243          

HSP 3 Score: 162.54 bits (410), Expect = 4.054e-41
Identity = 100/339 (29.50%), Postives = 171/339 (50.44%), Query Frame = 2
Query:  434 LHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKK-SRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWR-PIHLACEKGDKEIVRMLIDRKCDIE--ACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWR--PIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL---INQKCDIDACDRW 1423
            L LAC  GH+D V +LI    NI   D+   +P+  A   GHV + +LL+D   DI+    + K  P+ + C  G  ++V++LI    + E  +     P+ LA   G+V I KIL++   +I +  G K    P+  A + GH   +++L+    +I A+ E +    + LAC +G  E+V +L++RK ++E  A  G+    P+  A   G+  + R+L++R  D+ A    + R   +  A ++GH    +L+I R   I+      N  P+  A   GH D+ +LLV+   DV+A       P++ A  +G++++V+ L   +NQ      C R+
Sbjct:  937 LTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLT---PLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNT-PLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRY 1271          

HSP 4 Score: 160.999 bits (406), Expect = 1.099e-40
Identity = 90/383 (23.50%), Postives = 180/383 (47.00%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILIN 1390
            AC  G++++V+ L++   ++E  +E    P+  A   G  E+ +LL++          ++ +  L LAC++GH + V+ L+E+  +     +   + +  AC  GHVE+A+LL++    +      +   P+ +    GH ++  +LI+   ++E  + +G  P+  A   GH  +  +L+    +I A   +     +  AC GG +E+ + LI    ++E        P+  A ++G  E+V+ L+    ++ A     +   + +AC+ GH  +  +L+    D+E   E    P+  A   GH    + LI +  D+      N+   +  AC  GH  + +LL+    D N  +++    +I A++ G+  +V  LI+
Sbjct:  207 ACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVN-MPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELG---CSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTA-LTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLID 584          

HSP 5 Score: 155.606 bits (392), Expect = 6.302e-39
Identity = 104/426 (24.41%), Postives = 188/426 (44.13%), Query Frame = 2
Query:  362 EIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEE-SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNN--WRPIHFACERGHKDIAKLLVDRKCDVNACVENDWR-------------------------------PIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            E    L   + +     GQ +   L  AC +G  + V+ L+    +++   E   S +  AC  G+ E+A++L+    +++  G K    P+      G  DIV++L+    D+      G   +  AC  G+V + ++L++   ++E    +    P+  A  GGHVE+  +L+ +   I     E     + LAC KG  E+VR L++   D E       +  +  AC  GH  + R+L++    +    +    P+  A   GH  +A LLI+R  ++E    +N+  + P+  A   GH+++  LL+ +  ++NA  E                                   P++ A++ G++E+VK L+    ++ A        L +ACE GHT++  LL QAG D+E  +    +P+
Sbjct:   80 EAAAALTRMRAETAAATGQPDNRSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLE-DHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTD-EMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEE---VNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPL 500          

HSP 6 Score: 141.739 bits (356), Expect = 1.465e-34
Identity = 86/293 (29.35%), Postives = 153/293 (52.22%), Query Frame = 2
Query:  227 PLIHLACDFGHLEIVKFLIDHNVDIEIRDE-WKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINA--CDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSR-RPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYR--PIHFACKWGHNVIVRMLM 1087
            PLI LA   GH+ +V+ L+D+  DIE + E  K  P+  AC  G+ E+V+LLI    + E      +  PL LA   G+ + +KIL+ +   IN+    ++  SP+  A   GH    KLL+D   DI      N+   + + CF+G  ++V +L++   ++E   K G  P+  A   G+  + ++L++   D+ A+    SR   +  A   GH +  E++IS+  +I+  +++   P+ LA   G  ++V++L++   D++A    +N +  P+  A + GH  +VR L+
Sbjct:  969 PLI-LAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKE-HRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAA---DNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 7 Score: 137.502 bits (345), Expect = 3.291e-33
Identity = 82/323 (25.39%), Postives = 149/323 (46.13%), Query Frame = 2
Query:  224 EPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIET-CDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLID 1189
            E  + LAC  GHLE+V+FL++   D E + +     +  AC  G  E+ +LL+++     +    + + PL LA   GH +   +LIE   N+   ++   +P+  A + GH E+  LL+ Q  +I     + +   + + C  G  ++   LI    D+E  C      P+  A + GH+ + K L+    ++ A+        + +AC  GH ++ ++L+    ++E E E    P+  A   G    V+ LI +  D+      N++  +  AC  GH  +V +L+    D    ++D    +  A + GH ++   LID
Sbjct:  268 ESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSF-ESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCST----PLMEAAQEGHLELVKYLLAAGANVHATTATGDTA-LTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLID 584          

HSP 8 Score: 119.783 bits (299), Expect = 9.940e-28
Identity = 76/274 (27.74%), Postives = 136/274 (49.64%), Query Frame = 2
Query:  179 LCNKYDLDEYLER-KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEI-FGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNR-SPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKR--PIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLI 985
            L N  D++   ER KD PL  LAC  G  E+V+ LI    + E R+     P+  A   G   I+K+L++   +     G +    PL LA   GH   VK+L++   +INA  E NR + +  AC +G  E+  LL++++ +++    K    P+      G+A++ ++L++   D+        R   + +A + GH    +++I     I+    KK   P+  A  GGH++++++L++   +++A D     P+  A  KG  ++VR L+
Sbjct:  986 LDNGADIEAQSERTKDTPL-SLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVE-HRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVR-NKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 9 Score: 88.1965 bits (217), Expect = 5.826e-18
Identity = 54/203 (26.60%), Postives = 90/203 (44.33%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID 787
            L    +++   E   E  + LAC  G LE+  FLI    D+E+       P+  A ++G  E+VK L+    +        +   L  AC  GH D   +L+++  ++    E  R+P+  A + GHV   + LI +  D+      N    + + C  GH  +V++L+    D     KDG   +  A + GH ++   LID
Sbjct:  386 LAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLEL---GCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTA-LTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLID 584          

HSP 10 Score: 59.3066 bits (142), Expect = 3.595e-9
Identity = 38/166 (22.89%), Postives = 70/166 (42.17%), Query Frame = 2
Query:  194 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLI---------------DNKIDFEIFGGQWNQC-------------------PLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ 589
            D++  +E      + LAC  G  E+V  L++   ++E R +    P+  A   G AE+ ++L+               D  +      G +  C                   PL LA   GH D V++L+ S  +++A D    +P+  A ++GHV++ + L+ +
Sbjct: 1093 DINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKE 1258          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 8.736e-50
Identity = 101/407 (24.82%), Postives = 196/407 (48.16%), Query Frame = 2
Query:  278 LIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGC 1498
            L+D   +  +R      P+H AC+K +  +++LL+      E    +    P+H++ + G+ + V IL++   + NA +    + ++ A + G  E+ + L+     +     + ++ P+H+    G  +IV++L+      +    +G  P+H+A   GH  +  IL++    + A   KK   P+H A   G +E+  +L+ +  + +A  +    P+H+A    ++++  +L+D+     A    N Y P+H A K     I   L++   +  A       P+H   + GH ++A LL+ R  D+   A  +   P+H A +    ++A++LV     VNA  +  + P+I A   G I++V  L+    D+++  +  + PLH A ++GHT IV LL + G 
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVT-ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDA-KAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-AVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHA-TAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNH-ATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 402          

HSP 2 Score: 171.4 bits (433), Expect = 4.577e-44
Identity = 86/373 (23.06%), Postives = 179/373 (47.99%), Query Frame = 2
Query:  428 CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             PLH+AC +     +++L++   +I A  E   +P++ +   G++ I  +L+           + +   +HM    G  ++V+ L+     ++   ++ + P+H+A   G + I ++L+      +A A      P+H A   GH ++  +L+    ++    ++ + P+H+A + G  E+  +L+ R    +A  G N   P+H A  + +  +  +L+D+     A  ++ + P+H A ++    IA  L++   +  A        P+H   + GH D+A LL+ R  DVN   ++   P+  A++   + + +IL+     ++A  +  + PL  AC  G+ ++V  L Q G D+ + T+  Y+P+  A
Sbjct:   17 TPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGET-ALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDA-ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAA-GKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA-ITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQA 385          

HSP 3 Score: 168.318 bits (425), Expect = 4.917e-43
Identity = 90/385 (23.38%), Postives = 180/385 (46.75%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILI 1387
            +H+AC    + +++ L+ +   IE   E    P+H +   G   IV +L+           +  +  LH+A   G  + V+ L+ +   ++A     ++P++ A + G +EI +LL+            N   P+H+   EGH D+  +L++    +    K G  P+H+A + G + +A +L+      +A AGK    P+H A    + ++  +L+ +  +  A  +  + P+H+A +K   EI   L++   +  A +      P+H   + GH  +  +L+ R  D+    +    P+H A +    N+A++L+     + A   L  + P+  AC  G+  +   L+    DVN+  +N + P+  A+++G+  IV +L+
Sbjct:   19 LHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVR-GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDA-ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDA-AGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA-ITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKL-GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 4 Score: 158.688 bits (400), Expect = 5.012e-40
Identity = 80/323 (24.77%), Postives = 160/323 (49.54%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI 1186
            + E  +H+A   G  E+V+ L+ +   ++ +   ++ P+H A   G+ EIV+LL+ +    +         PLH+A  EGH+D   IL+E   ++    +   +P++ A K G +E+A LL+ QR       GKN   P+H+     +  +  +L+D+        K+G  P+H+A +   + IA  L++   +  A   ++   P+H     GH ++  +L+++  ++    +    P+HLA ++    +  +L+     + A   +  Y P+  AC +G+  +V  L+    D+ +  ++ + P+H A ++GH +I  LL+
Sbjct:   80 RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-QRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAIT-RQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKL-GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 5 Score: 65.4698 bits (158), Expect = 4.093e-11
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = 2
Query: 1181 LIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            L+D+  +    A LN + P+H AC++    + +LL+     + A  E+   P+  ++  G + IV IL+      +A +      LH A   G TE+V+ L + G  ++A  REE +P+ +A
Sbjct:    1 LLDKGANPNVRA-LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIA 121          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 130.568 bits (327), Expect = 3.104e-33
Identity = 70/216 (32.41%), Postives = 117/216 (54.17%), Query Frame = 2
Query: 1766 FQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIP----DPEKDLFKVIQ 2401
            FQ    +G G+FG V +V+  ++ R +A+K +    V   +     ND    + +++H  +I+ +G    A  +++ M+Y++GG +   ++K +  P      Y+ ++   + +LH   II+RD+KP N+L+D+N ++K+ DFG  +       QTV   T CGTP Y+ PEV   KPY+ S D +SLG  IY M+ G  P     P K   K++Q
Sbjct:   70 FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-----EVQTV-TWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQ 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 130.183 bits (326), Expect = 6.316e-33
Identity = 66/201 (32.84%), Postives = 110/201 (54.73%), Query Frame = 2
Query: 1766 FQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIP 2368
            FQ    +G G+FG V +++  ++ R +AMK +  + V   +     ND    + I+ H  II+ +G    A  +++ M+Y++GG +   ++K +  P      Y+ ++   + +LH K II+RD+KP N+L+DKN ++K+ DFG  + +           T CGTP Y+ PEV + KPY+ S D +S G  IY M+ G  P
Sbjct:   87 FQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV------TYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTP 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 128.642 bits (322), Expect = 1.750e-32
Identity = 73/253 (28.85%), Postives = 124/253 (49.01%), Query Frame = 2
Query: 1766 FQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFI 2524
            FQ    +G G+FG V +++ +++ R +A+K +    +   +     ND    + I+ H  II+ +G    +  +++ M+Y++GG +   ++K +  P      Y+ ++   + +LH K II+RD+KP N+L+DKN ++K+ DFG  + +           T CGTP Y+ PEV + KPY+ S D +S G  IY M+ G  P                   S   K +E IL   +       P AQ L+ + I
Sbjct:   88 FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV------TYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTP----------------FYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLI 318          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 119.398 bits (298), Expect = 1.165e-28
Identity = 77/265 (29.06%), Postives = 133/265 (50.19%), Query Frame = 2
Query: 1781 IIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIG--KANGLYVFMEYLDGGSIEKR----MKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGI-GRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQE--------GFSQSVKSIQQ------KKFEFILKWTVNPDASMRPTAQKLM 2512
            I+G+GA G V   +  N  + FA+K I   N D    K +  ++  +    K D+I+QYYG+    +++ +Y+ MEY+ G S+E      +K+   I    I   ++ +  G+++LHE+++IHRDIKP N+L+++   +KL DFG+ G  +         A T  GT  YM PE    +PYS + D++SLG T+  +  G  P     + + +           FS  +K   +      K F   + + +  DA  RP+ ++++
Sbjct:  219 ILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQ-FNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNS------LAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQML 476          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 120.939 bits (302), Expect = 1.848e-28
Identity = 79/262 (30.15%), Postives = 141/262 (53.82%), Query Frame = 2
Query: 1748 SLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILK---HDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKL-IPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPD---PEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLM 2512
            S K+  +   ++IG+G++G+V+     ++++  A+K +  +N  D E     ND+   + +LK   H++I++Y+G I K+  LY+ +EY   GS+ + + +    +  +E   Y  Q   G+ +LH + +IHRDIK AN+L+  +N VKL DFG+  I+  +      A T  GT  +M PE+   +  S  +DI+SLGAT+  M+T N P     + +++  ++        S  +   +F+ K  V  +   RPTA +L+
Sbjct:   19 SEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYEN--DEEL----NDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSS------ALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVK-NMYKRPTADQLL 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 159.073 bits (401), Expect = 1.265e-43
Identity = 91/257 (35.41%), Postives = 149/257 (57.98%), Query Frame = 2
Query: 1766 FQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDS---ETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIP----DPEKDLFKVIQEGFSQSVKS-IQQKKFEFILKWTVNPDASMRPTAQKLM 2512
            ++ G+++G GAFG V++    ++ RE A+K I    ++ S   E K +E ++  ++   +++ I+QYYG+      +Y+FMEYL GGSI + +K+   +       YS+Q+  GI +LH  RI+HRDIK AN+L D   NVKL DFG  + L+  R++T F R+  GTP +M PEV N + Y   AD++S+G T+  M+T   P    +P   LFK+  +     + S +     EF+ + T+  ++  RP+A +L+
Sbjct:    4 WRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIE-FMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGF-RSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVEFV-RSTLRMNSKSRPSADELL 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 139.043 bits (349), Expect = 1.303e-36
Identity = 79/253 (31.23%), Postives = 138/253 (54.55%), Query Frame = 2
Query: 1775 GEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANG-LYVFMEYLDGGSIEKRMKKEKLIPLDE--IIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMT----GNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLM 2512
            G+ IG+G++G VF+ K     +++ +K + +      E K  E +    +  L+H +I+ Y        G LY+ M + +GG +  R+K +K IPLDE  I+ +  Q+   + ++HEK I+HRD+K  N+ + K+  +K+ D GI R+LE + +    A T  GTP YM PE+F+ KPY+  +D+++LG  +Y M T     N  D    ++K+++ G +  +          I+K  ++ D   RP+A +L+
Sbjct:    9 GKCIGKGSYGEVFLSKHKKDKKQYVLKKVDLQKASVRERKAAELEAKL-LSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSD---MATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILK-GKTPPLPKQYSTDLCSIIKSMLDQDPDKRPSASRLL 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 131.724 bits (330), Expect = 4.187e-34
Identity = 65/193 (33.68%), Postives = 113/193 (58.55%), Query Frame = 2
Query: 1784 IGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPL--DEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMT 2356
            IG+G+FG   +VK  N  + + +K I I  +   E +    ++   +  LKH +I+ Y     ++  LY+ M+Y DGG + K++  ++ I    D+++ +  Q+  G+  +H+++I+HRDIK  N+ + ++  +K+ DFGI R+L  T      ARTC GTP Y+ PE+   +PY+  +DI+SLG  +Y M+T
Sbjct:   10 IGEGSFGKALLVKKRNDGKHYVIKEINICRMKPREREESRKEVKV-LSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHST---VELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLT 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 130.183 bits (326), Expect = 2.231e-33
Identity = 75/261 (28.74%), Postives = 140/261 (53.64%), Query Frame = 2
Query: 1763 TFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNN-----NVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIP---DPEKDLFKVIQEG---FSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLM 2512
             ++ G+++G+G+FG+V   K   +   +A+K +  +    S  K +E ++     I  H+H+I    +   +  +Y+ ME  D G ++K ++++K     E     KQ+ S +A+LH+  I+HRD+K  N+L+         NVK+ DFG+  I++G        ++ CGTP YM PEV ++  YS   D++S+G  +Y + TG  P   D E+ L+++I++G   FS     +  +  + +L   +  D + R TA++++
Sbjct:   26 VYEFGQVLGRGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAVKLLEREVMIMKKIY-HEHLIHLEEIYETSKRMYLVMELCDAGGLDKMLERKKRFTEKETWTVIKQLVSAVAYLHDLDIVHRDLKLENILLSHPTGNELLNVKITDFGLS-IVKGGVGSDSMMQSVCGTPMYMAPEVIDDLGYSQQCDVWSIGVIMYTLFTGRPPFMADTEEKLYEIIKKGIVDFSDPCWEVCHESAKNLLLGMLKVDPAHRRTAKEVL 284          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 126.331 bits (316), Expect = 2.336e-32
Identity = 72/253 (28.46%), Postives = 134/253 (52.96%), Query Frame = 2
Query: 1766 FQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKE-KLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIP---DPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLM 2512
            +Q  +IIG+G FG  ++V+   S R +A+K +    +   +     N++   +  LKH +I++Y     +    Y+ MEY +GG +  ++K+  +    + I+++  Q+   +  +H + I+HRD+K  N+ + K++ VK+ DFGI RIL+ T +    ART  GTP Y+ PE+   +PY+  +DI++LG  +Y + T   P   D   +L   I  G    +        E ++   +  + + RP+A++L+
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKI-LSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDH---ARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLI 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 220.705 bits (561), Expect = 6.190e-59
Identity = 119/438 (27.17%), Postives = 209/438 (47.72%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A   GH  + K L+D       R      P+H AC+K     + LL+ +    E    +    PLH+A + GH + VK L++   + NA +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L+D   + ++    G  P+H+A   GH+   +IL+D     +    KK   P+H A   G V++ E+L+ +  N  A  +    P+H+A    + ++V++L+ +     +    N Y P+H A K     +  +L+               P+H A + G  ++  +LI ++ ++  G   N   P+H   + GH  IA  LV +   V A     + P+  A   G I++VK L+ Q+  ++A  R  + PLH A ++GHT+IV LL + G     +T    SP+ +A
Sbjct:  340 LHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT-ESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARA-KDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQ-QVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHST-ARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIA 772          

HSP 2 Score: 219.55 bits (558), Expect = 1.322e-58
Identity = 122/438 (27.85%), Postives = 221/438 (50.46%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +++A    HLE+VKFL+++  +  +  E    P+  A ++G   +V LLI+         G+     LH+A       T  +L++++ N +   +   +P++ A    ++ +A+LL+++  ++  F  KN   P+H+    G+  +V++L+D    I+   KD   P+H A  NGHV I +IL++    I+A   K    PIH A  G H++ +  L+  N  I+    +   P+H+A   G   + ++L+D+     A   +N + P+H ACK  H   + +L+     +EA  E    P+H A   GH NI K L+ R     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L++ K + D+       PLH A   GH   +++L  AG     +T++ ++P+ +A
Sbjct:  113 LYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVN-FTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKT-KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANA-RALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNA-SNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVA 541          

HSP 3 Score: 200.675 bits (509), Expect = 1.694e-52
Identity = 112/442 (25.34%), Postives = 212/442 (47.96%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDN--KIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+A    H++ V+ L+ +N +I+        P+H A   G   + K+L+D   K +     G     PLH+AC + H  ++ +L++ + ++ A  E   +P++ A   GH+ I K L+ +         K +  P+HM    GH ++ + L+     ++   KD + P+H A   GH  + K+L+D   N D   +AG     P+H A   GH+  + +L+          ++ + P+H+A + G  ++  +L++R  +  A  G N   P+H A    +  +V++L+ +     +   + + P+H A ++    +A +L+         + L    P+H A + G  D+  +L+ ++ +VN   +N   P+   ++ G++ I   L+ Q   + A  R  + PLH AC  G+ ++VK L Q    + A TR  Y+P+  A
Sbjct:  307 IHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGF---TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVET-PLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHT---PLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAA-GKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCES-LQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQA 739          

HSP 4 Score: 189.889 bits (481), Expect = 4.545e-49
Identity = 106/409 (25.92%), Postives = 191/409 (46.70%), Query Frame = 2
Query:  158 IRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKIL 1384
            +RS    L +   L+   E    PL H+A   GHL IVK L+         +     P+H A   G  E+ + L+ N    +    + +Q PLH A   GHK+ VK+L++   N ++      +P++ A + GH+   ++L+D     QV   K    P+H+    G  D+ ++L++   +     K+G  P+H+A  + ++ + K+L+       ++A +    P+H A     +E+  VL+    +   E  +   P+HLA ++G  ++V MLI ++ ++      N   P+H   + GH  I   L+ +   + A     + P+H AC  G+  + K L+ ++  + A   +  + P+H A ++GH DI  LL+      N    N   P+  A   GYI ++ +L
Sbjct:  382 MRSMDLLLKHSASLEAVTESGLTPL-HVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARA-KDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQ-QVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTA-RNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLG-NKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMG-YTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 5 Score: 144.05 bits (362), Expect = 1.621e-34
Identity = 104/457 (22.76%), Postives = 186/457 (40.70%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI-------------DQRCDIQVFGGKNKR-------------------HPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDL----------------NCDIEASA------------GKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEA----------CVGMNNY----------------------RPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            A   G+ D     I++  NIN  ++   + ++ A K GHV++   L+             +    I    G+ K                     P++M   E H ++VK L++   +     +DG  P+ +A + GH  +  +LI+                 N D   +A             K    P+H A    ++ + ++L+++  N+    +    P+H+A  +G+  +VR+L+DR   I+A          C   N +                       PIH A +  H   VR L+    +I+    D+  P+H A   GH  +AK+L+D+     A A LN + P+H AC++ H     LL+     + A  E+   P+  A+  G++ IVK L+ +    +A +     PLH A   GH E+ + L Q    ++A  +++ +P+
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARA-LNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPL 472          

HSP 6 Score: 130.183 bits (326), Expect = 3.344e-30
Identity = 73/290 (25.17%), Postives = 149/290 (51.38%), Query Frame = 2
Query:  683 IDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI--DRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            I    +I   +++G   +HLA + GHV +   L+    ++EA+  KK    +H A + G  +++  L++   N+ A+  + + P+++A ++   E+V+ L++   + ++    + + P+  A + GH  +V +L++     +  +      +H A        A +L+  D   D+ +  G   + P+H A    +  +A+LL++R  +VN   +N   P+  AS RG + +V++L+++   IDA  + +  PLH A   GH  I+++L + G  I+A T+   SP+ +A
Sbjct:   30 IKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATT-KKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPA----LHIAARNDDTRTAAVLLQNDPNPDVLSKTG---FTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMA 310          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 207.608 bits (527), Expect = 9.689e-55
Identity = 121/473 (25.58%), Postives = 225/473 (47.57%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQ--RCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWR---------------------------------PIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A  + +L + + L++   + E+       P+H A   G   I+++L+DN    +    +    P+H+A    H D VK L++ N  I+     + +P++ A   GH  +AK+L+D+  + + +   G     P+H+ C + H  ++ +L+  +  IE   + G  P+H+A   GH+ I KIL+       AS   K   P+H A   GH E+ E L+     ++A+ ++   P+H A   G KE+V++L++ K +  +      + P+H A + GH   VR+L+D +       +  + P+H A + G  ++A+LL++R  +  A AG N   P+H A    + D+  LLV +    ++   N +                                  P+  AS+ G  +IV +LI+++ +++  ++    PLH   + GH  I  +L + G  + A TR  Y+P+ +A
Sbjct:  187 LHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQA-KTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFT---PLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSAS-NVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTT-TAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVA 646          

HSP 2 Score: 204.527 bits (519), Expect = 9.621e-54
Identity = 114/464 (24.57%), Postives = 215/464 (46.34%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGA--------------------------------GLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEY 1528
            +H A   GH  I++ L+D+   I+ + +    PIH A +    + VK L+    + +      +  PLH+A   GH    K+L++     N+      +P++ ACK+ H+ +  LL+     I+    ++   P+H+  F GH +IVK+L+ +       +   + P+H+A  +GH  +A+ L+     ++A A K  + P+H A   GH E++++L+    N  +       P+H+A  +G  + VR+L+D +   +  +    + P+H A K+G   +  +L++R  +  A  ++   P+H A    + ++  LL+ +     + A                                 L    P+H A + G  DI  LL+ ++ +VN   ++   P+   ++ G++ I  IL+ Q   + A  R  + PLH AC  G+ ++VK L Q   ++ + TR EY
Sbjct:  214 LHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLD-HLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVT-ESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKA-KDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQ-QTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEY 673          

HSP 3 Score: 199.519 bits (506), Expect = 3.735e-52
Identity = 119/448 (26.56%), Postives = 213/448 (47.54%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLID----------QRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V  L+ + + +E   +     +H A   GQ ++V  L++   +      Q    PL++A  E H + VK L+E+  N +   E   +P+  A ++GH  +  LLI              D   F       P+H+     + ++ ++L++   + E        P+H A  NGH  I +IL+D    I+A   K    PIH A  G H++ ++ L+  N  I+    +   P+H+A   G   + ++L+D+     +   +N + P+H ACK  H  ++ +L+     IEA  E    P+H A   GH NI K+L+ +     A + +    P+H A   GH ++A+ L+     V+A  ++D  P+  A+  G+ E+VK+L+  K + ++       PLH A   GH + V+LL         +T++ ++P+ +A
Sbjct:   44 LHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNA-QSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKT-KNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSR-ALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSA-SNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVA 481          

HSP 4 Score: 196.438 bits (498), Expect = 4.157e-51
Identity = 109/416 (26.20%), Postives = 197/416 (47.36%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG--AGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWA---CERGHT 1465
            +H+A   GH  + K L+D       R      P+H AC+K    ++ LL+ +    E    +    PLH+A + GH + VKIL++   + +A +    +P++ A + GH E+A+ L+     +     K+ + P+H     GH ++VK+L++   +  +    G  P+H+A   GHV   ++L+D+    +    KK   P+H A   G V++ E+L+ +  N  A  +    P+H+A    + ++V +L+ +     +    N Y  +H A K     +   L+       A       P+H A + G  +I  LLI ++ ++  G  +GL    P+H   + GH  IA +LV +   V A     + P+  A   G I++VK L+ Q+ ++++  R ++   H+    CE  HT
Sbjct:  280 LHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVT-ESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDA-KAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQ-QTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA-ARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLT---PLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHT 688          

HSP 5 Score: 188.734 bits (478), Expect = 1.290e-48
Identity = 114/468 (24.36%), Postives = 226/468 (48.29%), Query Frame = 2
Query:  176 ELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILI----ESNCNINACDE-------VNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            EL +   + E   +K    +H+A   G  ++V  L+++  ++  + +    P++ A ++   E+VK L++N  +  I   +    PL +A  +GH++ V +LI    +    + A  +          +P++ A    ++ +A+LL+++       G  ++  P+H     GH  I+++L+D    I+   K+G  PIH+A +  H+   K L+  N +I+         P+H A   GH  + +VL+ K     +     + P+H+AC+K    ++ +L+     IEA V  +   P+H A   GH  IV++L+ +     A       P+H A   GH  +A+ L+     ++A A  ++  P+H A   GHK++ KLL++ K + N+       P+  A+  G+++ V++L++ +       +  + PLH A + G  ++ +LL + G +  A  +   +P+ +A
Sbjct:   58 ELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSI-PTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNR-------GANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEID-DITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEA-VTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAK-DDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVA 514          

HSP 6 Score: 134.42 bits (337), Expect = 1.588e-31
Identity = 91/402 (22.64%), Postives = 168/402 (41.79%), Query Frame = 2
Query:  542 ACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDR----KCDIEAC------VGMNNYRPIHFACKW---------------------------GHNVIVRMLMDRKCDIEACIEDNWRPIHFACER---------------------------------GHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            A + G+++ A   I    DI     +N  + +H+   EGH  +V  L+     +ET  K G   +H+A   G   +   L++   ++ A + +K   P++ A    H+E+++ L+    N     E+ + P+ +A ++G + +V +LI      K  + A       + +  + P+H A  +                           GH  I+ +L+D    I+A  ++   PIH A +                                  GH  +AK+L+D+     + A LN + P+H AC++ H  +  LL+     + A  E+   P+  AS  G++ IVKIL+ +     A +     PLH A   GH E+ + L Q    ++A  +++ +P+
Sbjct:   14 AARSGNLDKALEHIKNGIDINT-ANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQS-QKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRA-LNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPL 412          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 200.29 bits (508), Expect = 2.720e-52
Identity = 116/440 (26.36%), Postives = 216/440 (49.09%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V+ L+D    ++   +     +H +   GQAE+VK L+    D      Q    PL++A  E H D V+ L+E+  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+  D N D+++  K G  P+H+A   G+V +A +L++    ++ +A +    P+H A   G+  ++ +L+ +   I+A+  +   P+H A   G +  V +L+++   + A    N   P+H A +  H   V+ L+  K  ++    D    +H A   GH  + KLL+D++ +  A A LN + P+H AC++    + +LLV     + A  E+   PI  A+  G++ IV +L+      D  +      LH A   G  E+V+ L + G  ++A  RE+ +P+ +A
Sbjct:   69 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINA-QSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS--KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-LNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIA 497          

HSP 2 Score: 189.504 bits (480), Expect = 7.139e-49
Identity = 114/476 (23.95%), Postives = 213/476 (44.75%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQC------PLHLACWEGHKDTVKILIESNC-----------------------------NINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +K    +H++   G  E+VK L+    DI  + +    P++ A ++   ++V+ L++N       GG  +        PL +A  +GH   V IL+E++                              N +   +   +P++ A   G+V +A LL+++   +  F  +N   P+H+    G+ ++V++L+D    I+   +DG  P+H A  +GH A  ++L++    + A   K    P+H A  G HVE ++ L+     ++    +    +H+A   G   + ++L+D++ +  A   +N + P+H ACK     ++ +L+     I+A  E    PIH A   GH NI  LL+      +  + +     +H A   G  ++ + L+     V+A    D  P+  AS  G  EIV++L+      DA     + PLH +   G  E   +L +AG      T++ ++P+
Sbjct:   96 KKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLEN-------GGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD-FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA-RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV-SNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPL 560          

HSP 3 Score: 189.119 bits (479), Expect = 8.451e-49
Identity = 109/458 (23.80%), Postives = 211/458 (46.07%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            L N+    ++  R     +H+A   G+  +V+ L+D    I+ +      P+H A   G    V++L++      +   +    PLH+A    H + VK L++    ++       + ++ A   GH  + KLL+D+R +       N   P+H+ C +    ++++L+     I+   + G  PIH+A   GH+ I  +L+    + D+    G+ S   +H A   G  E++  L+     ++A   E   P+H+A   G  EIV++L+      +A    N Y P+H + + G      +L++         +  + P+H   + G  ++AKLL+ R+   ++ AG N   P+H A    ++ +A LL+D+    +   +N + P+  A+++  ++I  +L+    + +A  +    PLH A + GH ++  LL   G  I   T+   + + LA
Sbjct:  245 LLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPL-LARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR-ALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDS-AGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLA 695          

HSP 4 Score: 182.185 bits (461), Expect = 1.571e-46
Identity = 101/440 (22.95%), Postives = 204/440 (46.36%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H+E VK L+ H   ++         +H A   G   + KLL+D + +           PLH+AC +     +++L++   +I A  E   +PI+ A   GH+ I  LL+      D+    G+     +HM    G A++V+ L+     ++   ++ + P+H+A   G   I ++L+      +A A      P+H +   G +E   VL+    +     ++ + P+H+  + G  ++ ++L+ R+   ++  G N   P+H A  + +  +  +L+D+        ++ + P+H A ++   +IA +L+    +  A        P+H A + GH D+A LL+ +   +N   ++    +  A++   + + +IL+    ++D   +  + PL  AC  G+ ++V  L Q G  + A T+  Y+P+  A
Sbjct:  329 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGF-TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDA-ATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSA-GKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTK-QGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQA 761          

HSP 5 Score: 175.637 bits (444), Expect = 2.079e-44
Identity = 93/430 (21.63%), Postives = 204/430 (47.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALT 1516
            +H+A   GH  + K L+D   +   R      P+H AC+K + ++++LL+      +    +    P+H+A + GH + V +L+++  + +  +    + ++ A + G  E+ + L+     +     +  + P+H+    G  +IV++L+      +    +G  P+H++   G +  A +L++      + A KK   P+H     G +++ ++L+ +    ++  +    P+H+A    ++++  +L+D+          N Y P+H A K     I  +L+    +  A  +    P+H A + GH ++A LL+ +  + ++   +GL     +H A +     +A++LV    +++   +  + P+I A   G  ++V  L+     ++A  +  + PLH A ++G+T I+ +L Q G    A+T
Sbjct:  362 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARA-REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS-HSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPH-TTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLT---ALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT 784          

HSP 6 Score: 157.147 bits (396), Expect = 1.402e-38
Identity = 88/397 (22.17%), Postives = 188/397 (47.36%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNC-----------------------------NIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D V   ++   +I+ C++   + ++ A K GH+++ + L+D+   +     K     +H+    G A++VK L+    DI    ++G  P+++A +  H+ + + L++ N   +++A +    P+  A   GH +++ +L+  +                              N + + +  + P+H+A   G+  +  +L++R   ++     N   P+H A K G+  +VR+L+DR   I+A   D   P+H A   GH    ++L+++   + A    N   P+H A +  H +  K L+  K  V+    +    +  A+  G+  + K+L++++ + +A     + PLH AC++   ++++LL + G  I+A+T    +P+ +A
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDS-STKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLE-NGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD-FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTK-NGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVA 431          

HSP 7 Score: 147.517 bits (371), Expect = 1.189e-35
Identity = 81/325 (24.92%), Postives = 160/325 (49.23%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI 1186
            + E  +H+A   G  E+V+ L+ +   ++ R    + P+H A   G+ EIV+LL+ +    D     G     PLH++  EG  +T  +L+E+  + +   +   +P++   K G +++AKLL+ QR       GKN   P+H+     +  +  +L+D+     T  K+G  P+H+A +   + IA +L+    +  A   K+   P+H A   GH ++  +L+SK   I    +     +HLA ++    +  +L+    +++    +  Y P+  AC +G+  +V  L+     + A  ++ + P+H A ++G+ +I  +L+
Sbjct:  456 RGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNG---YTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLL-QRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT-KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKL-GYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLL 774          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 199.519 bits (506), Expect = 3.906e-52
Identity = 116/440 (26.36%), Postives = 216/440 (49.09%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLI--DENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +HLA   GH+++V+ L+D    ++   +     +H +   GQAE+VK L+    D      Q    PL++A  E H D V+ L+E+  N +   E   +P+  A ++GH ++  +L++         GK +   +H+   +       +L+  D N D+++  K G  P+H+A   G+V +A +L++    ++ +A +    P+H A   G+  ++ +L+ +   I+A+  +   P+H A   G +  V +L+++   + A    N   P+H A +  H   V+ L+  K  ++    D    +H A   GH  + KLL+D++ +  A A LN + P+H AC++    + +LLV     + A  E+   PI  A+  G++ IV +L+      D  +      LH A   G  E+V+ L + G  ++A  RE+ +P+ +A
Sbjct:   84 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINA-QSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK-----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQS--KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA-RNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-LNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIA 512          

HSP 2 Score: 189.119 bits (479), Expect = 1.014e-48
Identity = 114/476 (23.95%), Postives = 213/476 (44.75%), Query Frame = 2
Query:  215 RKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQC------PLHLACWEGHKDTVKILIESNC-----------------------------NINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 1537
            +K    +H++   G  E+VK L+    DI  + +    P++ A ++   ++V+ L++N       GG  +        PL +A  +GH   V IL+E++                              N +   +   +P++ A   G+V +A LL+++   +  F  +N   P+H+    G+ ++V++L+D    I+   +DG  P+H A  +GH A  ++L++    + A   K    P+H A  G HVE ++ L+     ++    +    +H+A   G   + ++L+D++ +  A   +N + P+H ACK     ++ +L+     I+A  E    PIH A   GH NI  LL+      +  + +     +H A   G  ++ + L+     V+A    D  P+  AS  G  EIV++L+      DA     + PLH +   G  E   +L +AG      T++ ++P+
Sbjct:  111 KKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLEN-------GGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD-FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLART-KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNA-RALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV-SNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPL 575          

HSP 3 Score: 188.734 bits (478), Expect = 1.420e-48
Identity = 109/458 (23.80%), Postives = 211/458 (46.07%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILID--LNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            L N+    ++  R     +H+A   G+  +V+ L+D    I+ +      P+H A   G    V++L++      +   +    PLH+A    H + VK L++    ++       + ++ A   GH  + KLL+D+R +       N   P+H+ C +    ++++L+     I+   + G  PIH+A   GH+ I  +L+    + D+    G+ S   +H A   G  E++  L+     ++A   E   P+H+A   G  EIV++L+      +A    N Y P+H + + G      +L++         +  + P+H   + G  ++AKLL+ R+   ++ AG N   P+H A    ++ +A LL+D+    +   +N + P+  A+++  ++I  +L+    + +A  +    PLH A + GH ++  LL   G  I   T+   + + LA
Sbjct:  260 LLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPL-LARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNAR-ALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDS-AGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLA 710          

HSP 4 Score: 181.415 bits (459), Expect = 2.588e-46
Identity = 101/440 (22.95%), Postives = 204/440 (46.36%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRC--DIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +H+A    H+E VK L+ H   ++         +H A   G   + KLL+D + +           PLH+AC +     +++L++   +I A  E   +PI+ A   GH+ I  LL+      D+    G+     +HM    G A++V+ L+     ++   ++ + P+H+A   G   I ++L+      +A A      P+H +   G +E   VL+    +     ++ + P+H+  + G  ++ ++L+ R+   ++  G N   P+H A  + +  +  +L+D+        ++ + P+H A ++   +IA +L+    +  A        P+H A + GH D+A LL+ +   +N   ++    +  A++   + + +IL+    ++D   +  + PL  AC  G+ ++V  L Q G  + A T+  Y+P+  A
Sbjct:  344 LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGF-TPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS---LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDA-ATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSA-GKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTK-QGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQA 776          

HSP 5 Score: 174.866 bits (442), Expect = 3.021e-44
Identity = 93/430 (21.63%), Postives = 204/430 (47.44%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDR--KCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALT 1516
            +H+A   GH  + K L+D   +   R      P+H AC+K + ++++LL+      +    +    P+H+A + GH + V +L+++  + +  +    + ++ A + G  E+ + L+     +     +  + P+H+    G  +IV++L+      +    +G  P+H++   G +  A +L++      + A KK   P+H     G +++ ++L+ +    ++  +    P+H+A    ++++  +L+D+          N Y P+H A K     I  +L+    +  A  +    P+H A + GH ++A LL+ +  + ++   +GL     +H A +     +A++LV    +++   +  + P+I A   G  ++V  L+     ++A  +  + PLH A ++G+T I+ +L Q G    A+T
Sbjct:  377 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVT-ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARA-REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGAS-HSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPH-TTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLT---ALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVT 799          

HSP 6 Score: 156.762 bits (395), Expect = 1.780e-38
Identity = 88/397 (22.17%), Postives = 188/397 (47.36%), Query Frame = 2
Query:  443 ACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNC-----------------------------NIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G+ D V   ++   +I+ C++   + ++ A K GH+++ + L+D+   +     K     +H+    G A++VK L+    DI    ++G  P+++A +  H+ + + L++ N   +++A +    P+  A   GH +++ +L+  +                              N + + +  + P+H+A   G+  +  +L++R   ++     N   P+H A K G+  +VR+L+DR   I+A   D   P+H A   GH    ++L+++   + A    N   P+H A +  H +  K L+  K  V+    +    +  A+  G+  + K+L++++ + +A     + PLH AC++   ++++LL + G  I+A+T    +P+ +A
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDS-STKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLE-NGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD-FTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTK-NGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVA 446          

HSP 7 Score: 147.132 bits (370), Expect = 1.560e-35
Identity = 81/325 (24.92%), Postives = 160/325 (49.23%), Query Frame = 2
Query:  218 KDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKI--DFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLI 1186
            + E  +H+A   G  E+V+ L+ +   ++ R    + P+H A   G+ EIV+LL+ +    D     G     PLH++  EG  +T  +L+E+  + +   +   +P++   K G +++AKLL+ QR       GKN   P+H+     +  +  +L+D+     T  K+G  P+H+A +   + IA +L+    +  A   K+   P+H A   GH ++  +L+SK   I    +     +HLA ++    +  +L+    +++    +  Y P+  AC +G+  +V  L+     + A  ++ + P+H A ++G+ +I  +L+
Sbjct:  471 RGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNG---YTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLL-QRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT-KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKL-GYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLL 789          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 4.459e-48
Identity = 110/426 (25.82%), Postives = 208/426 (48.83%), Query Frame = 2
Query:  242 ACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGK---RPIHLACENGHVAIAKILI--DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNW-RPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCD 1501
            A   G+LE     + + VDI I ++     +H A ++G  E+V  LI    + +    + N   LH+A   G  + VK L+ +  N+NA  +   +P+Y A +  H+++ +LL++     Q    ++   P+ +   +GH  +V +L++        D  GK     +H+A        A +L+  D N D+E+ +G     P+H A   G++ +  +L+++   ++ +      P+H+A ++G+  +VR+L++R   I+A    +   P+H A + GH  +V ML++R   I +  ++   P+H A +  H N  +LL+    D+      N++   +H A   GH  +AK++VD+K + NA   N + P+  A ++  ++++++L+     I A       P+H A   GH  IV  L   G  
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTA-LHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSS-QSIATEDGFTPLAVALQQGHDQVVSLLLEN-------DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSG---FTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDART-KDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHH--DVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGAS 434          

HSP 2 Score: 174.866 bits (442), Expect = 5.588e-47
Identity = 99/402 (24.63%), Postives = 196/402 (48.76%), Query Frame = 2
Query:  341 ACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            A   G  E     + N +D  I   Q     LHLA  EGH + V  LI+   N++A  +   + ++ A   G  E+ K L+    ++     +N   P++M   E H D+V++L++         +DG  P+ +A + GH  +  +L++       + GK     +H A      +   +L+  + N + E +  + P+H+A   G+  +  +L++R   ++     N+  P+H A K G++ +VR+L++R   I+A  +D   P+H A   GH  + ++L++R   I +    N   P+H A +  H +  +LL+     V+    +    +  A+  G+ ++ K+++++K + +A     + PLH AC++   ++++LL + G  I+A+T    +P+ +A
Sbjct:   24 AARAGNLEKALDYLQNGVDINICN-QNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNA-QSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD-FKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTK-NGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVA 416          

HSP 3 Score: 77.7962 bits (190), Expect = 1.389e-14
Identity = 48/214 (22.43%), Postives = 100/214 (46.73%), Query Frame = 2
Query:  170 APELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEAS 811
            A  L N+    ++  R D   +H+A   G+  +V+ L++    I+ R +    P+H A   G  ++V++L++      +   +    PLH+A    H + V++L+  +  ++       + ++ A   GH ++AK+++D++ +       N   P+H+ C +    ++++L+     I+   + G  PIH+A   GH  I   LI+       S
Sbjct:  227 ATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPI-LSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNA-KALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTS 438          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017258.1 (SMESG000017258.1)

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 602/669 (89.99%), Postives = 631/669 (94.32%), Query Frame = 2
Query:  530 PIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAXXXXXXXXXXXXXXVKSERKGEKRLTWKYKTPKDQTFEEQEEKNLARMISLMGLKCQMNCDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFINYSN 2536
            PI++AC+ GH E+ K LI+++C+I+   G N + PIH  C  GH DI+K+L+D+ CDIE CD++  RPIH ACE GH  I K+L+D +C+IEA A +   RPIH AC  GH +IL++L+   C+IEA +++SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTWKYKTPKDQTFEEQEEKNLARMISLMGLKCQMNCDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFINYSN
Sbjct:   39 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEA-ADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTWKYKTPKDQTFEEQEEKNLARMISLMGLKCQMNCDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFINYSN 706          

HSP 2 Score: 391.349 bits (1004), Expect = 3.546e-124
Identity = 195/435 (44.83%), Postives = 273/435 (62.76%), Query Frame = 2
Query:  128 MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWR 1432
            MD FE  +  I+  + E   ++   EYLE+K+  L                           +W   PIH ACE G +E+ K LI+ K + E   G  N+ P+H AC  GHKD +KIL++  C+I ACD+ N  PI+FAC+ GH +I K+L+D  C+I+    +++  PIH+ C  GH DI+KML+D  CDIE C++D  RPIHLACE G   I ++LID  CDIEA  G  + RPIHFAC  GH  I+ +L+ + C+IEA  E++WRPIH ACE+G + I ++LIDRKCDIEA  G+NN+RPIHFAC+ GH  I ++L+DRKCD+ AC+E++WRPI +A ERG+  I K+LI++KCDI+A      WRP+H+ACERGH +I KLL    CD+ A    ++ P+  A  + + EI++I+   K +     R  W+
Sbjct:    1 MDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGIL---------------------------QW--HPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEA-ADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDA-CDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTWK 404          

HSP 3 Score: 248.825 bits (634), Expect = 5.318e-71
Identity = 115/209 (55.02%), Postives = 155/209 (74.16%), Query Frame = 2
Query:  923 SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDAC-DRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
             W PIH ACE G  E+ + LI+RKC+IEA  G NN RPIH+AC+ GH  I+++L+D+KCDIEAC ++NWRPIHFACE GH++I K+L+D  C+IEA A  + WRPIH ACERGHKDI K+L+D +CD+ AC ++ WRPI  A E+G  EIV++LI++KCDI+AC     +RP+H+AC+ GH  IV++L    CDIEA   + + P+  A
Sbjct:   36 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEA-ADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFA 243          

HSP 4 Score: 127.872 bits (320), Expect = 3.791e-30
Identity = 58/116 (50.00%), Postives = 85/116 (73.28%), Query Frame = 2
Query: 1202 IEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACV-ENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +E   G+  W PIH+ACE GH ++ K L++RKC++ A    N+ RPI +A ERG+ +I+KIL++QKCDI+ACD+  WRP+H+ACE GH +IVK+L    C+IEA  ++E+ P+ LA
Sbjct:   28 LEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIHFACEMGHKDIVKMLLDHHCNIEAADQDEWRPIHLA 143          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017260.1 (SMESG000017260.1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 421/813 (51.78%), Postives = 574/813 (70.60%), Query Frame = 2
Query:  128 MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPL----IHLACDFGHLEIVKFLIDHNVDIE-IRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAXXXXXXXXXXXXXXVKSERKGEKRLTWKYKTPKDQTFEEQ---EEKNLARMISLMGLKCQMN-CDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDS-ETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPEKDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFINYSN 2536
            MDEFE  I  +++ + EL NKY  ++YLE++        IHLAC+ G  EI + L+    +++ +   + R PIH  C+KGQA+ VKLLID K D E    + N   +H AC+EGH D VK+LI   CN   C E N+ PI+ AC++G+ +I K+LI+Q+CD + +   N R PIH  C  GH ++VK+LI++ C++E CDK+ +RP+HLACE GH  I ++LID  C+I+A+  + S RPIH AC  GH++I++ L ++ CNIEA ++ +WRPIH AC KG KEIV +LI +KCDIEA     N RPIH AC  GH  IV +L++ KCDIEAC +D WR IH ACE+G+ +IA+LLID  CDIE    ++  RPIH+ACE GH +I +LL+D  C++ AC + + RPI +ASE G++E  KIL+ +KCDI+AC + + R +H ACE+GH EIVKLL +A C+ EALT +  SP+KLAE    +EIIE++ +  ++R+ +     + + P ++   E    EE +L ++IS MGL+C  + CDH LCPTSLK+KTF NGEIIGQG FG VF  K SN  REFA+KFIG D +++  ++K +END+N YVDIL+H++IIQY+G+I K++ LYVFMEY+ G S++KR+K E+ +P DE IHYSKQM SG+AFLH KRIIHRDIKPANVLIDK+NNVKL DFG+GR+L G  ++T FA T CG+P++M PE+   KPYSF ADIYSLG TIY+MMTGNIP   K++ K I+  F  ++   ++K+FE I+K  VN D S RPTAQ+LMN  I +SN
Sbjct:    1 MDEFELFISAVKAGSKELFNKYFKEKYLEQRFGIFQWLPIHLACEEGQAEIAEMLLTRKCNVDALAGLFNRCPIHLVCQKGQADFVKLLIDYKCDIEACDLK-NWRAIHFACFEGHADIVKMLINQKCNFETCAEKNQRPIHLACEKGYEKIVKILIEQKCDTEAYDENNCR-PIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLHLACEKGHTDIVRLLIDQKCNIDAN-DQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIHFACWKGQKEIVNILITKKCDIEA-PEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIHLACEKGYADIAQLLIDNNCDIEVCDQISK-RPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPIKLAEKSKKQEIIELLKQTPTKRQSD---VMQDEIPHEEEKSEPKTPEEIHLEKLISTMGLQCLGSPCDHKLCPTSLKSKTFANGEIIGQGGFGTVFRSKASNITREFAIKFIGHDKLEEVLDSKCIENDINEYVDILQHENIIQYFGIIRKSDDLYVFMEYVQGLSLDKRIKSERFLPFDEAIHYSKQMISGLAFLHGKRIIHRDIKPANVLIDKDNNVKLADFGLGRLLMGPNDRTQFAMTFCGSPSFMAPEINKNKPYSFPADIYSLGVTIYNMMTGNIPSCTKEIVKKIKVDFDPTLSESKRKEFENIVKNMVNRDVSKRPTAQQLMNSEIFFSN 805          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017035.1 (SMESG000017035.1)

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 363/508 (71.46%), Postives = 400/508 (78.74%), Query Frame = 2
Query:  128 MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACE---------------------------------RGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDW--RPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            MDEFETLIGTIRSQAPELC+KY+LDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLI+QRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGG ++I+EVL SKNCNIEAEDE+  RPIHLACE G   I ++LID  CDIEA  G  + RPIHFAC  GH  I+ +L+ + C+IEA  E++WRPIH AC+                                  G+  I +LLI   CDIEA  G     PIHFAC RG+  I  +L+ + C++ AC E  W  RPI  A   G IEIVK+LI QKCDI++CDR++ RP+H ACE G+ E+ KLL    CDI+A T   + P+ LA
Sbjct:    1 MDEFETLIGTIRSQAPELCSKYNLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLINQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIDIVEVLTSKNCNIEAEDEDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEAC-EISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLA 507          

HSP 2 Score: 372.859 bits (956), Expect = 1.959e-116
Identity = 223/507 (43.98%), Postives = 295/507 (58.19%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACE---------------------------------NGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESW--RPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEA-----------------------CIEDN---------W--RPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            IH+ C  GH +IVK LID N DIE  D+  +RPIH ACE G   I K+LID   D E   G+ ++ P+H AC  G  D V++L   NCNI A DE  + PI+ AC+ GHV IAK+LID  CDI+   GK  R PIH  C  GH +I+++LI +NC+IE  D++  RPIHLAC+                                 NG+V I ++LI  NCDIEA  GK  R PIHFAC  G+++I+ VLI +NCN+EA  E SW  RPIH+AC  G  EIV++LI++KCDIE+C      RPIH AC+ G+  + ++L+  KCDI+A                        IE+N         W  RPIHFAC +G  +I K+LID  CDIE      N +PIH AC  GH +I K+L+++ CD+ +C E   RPI  A E G+ EIVK+LI+  CDI+A D+ +  P+H +C +G+ EI K+L    CDIEAL   + SP+ LA
Sbjct:  170 IHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIDIVEVLTSKNCNIEAEDEDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEA-CEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKR-RPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKVLIDHHCDIEAQDKRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLA 674          

HSP 3 Score: 364.385 bits (934), Expect = 3.833e-113
Identity = 213/471 (45.22%), Postives = 293/471 (62.21%), Query Frame = 2
Query:  194 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACD-EVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEE-SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWR--PIIWASERGYIEIVKILIN---------------QKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEAL-TREEYSPMKLA 1546
            D++    +K    IH AC  GH+EI++ LI  N +IE  DE   RPIH AC+     IV LL+ N  + E      N CP+H AC  G+ + V++LI  NC+I A   +  RSPI+FAC RG+++I  +LI Q C+++         PIH+ C++G  +IVK+LI++ CDIE+CD+  +RPIHLACE G++ +AK+LI   CDI+A  G+ + RPIH A    H EI+++LI +NC++ A   +   RPIH AC KGD +IV++LID  CDIE      N +PIH AC  GH  I+++L+++ CDIE+C E   RPIH ACE GH  I K+LID  CDIEA        PIH +C +G+ +I K+L+D++CD+ A   +DW+  PI  A E G+ EIVK+LIN               Q CDI+ACD  + RP+H ACE+GHTEIVK+L    CDI A   R   SP+ LA
Sbjct:  291 DIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTND-NMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKVLIDHHCDIEAQDKRKRC-PIHISCVKGYMEITKILLDQRCDIEAL--DDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLA 756          

HSP 4 Score: 363.229 bits (931), Expect = 7.650e-113
Identity = 207/478 (43.31%), Postives = 285/478 (59.62%), Query Frame = 2
Query:  194 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEV---------------------------------NRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKD-GKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIED-NWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNW--RPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALT 1516
            D++    +K    IH AC  G ++IV+ L   N +IE  DE  +RPIH ACE G   I K+LID   D E   G+ ++ P+H AC  GH + +++LI  NCNI A DE                                  N  PI++AC  G+VEI +LLI   CDI+ FGGK KR PIH  C  G+  IV +LI +NC++E C+     RPIH+AC +G + I K+LI+  CDIE S  +  RRPIH AC  G++E+ ++LI+  C+I+A+   ++RPIHLA +   +EIV++LI+  CD+ A  G  + RPIHFAC  G   IV++L+D  CDIE      N +PIH AC  GH  I K+L+++ CDIE+    + W  RPIH ACE GH +I K+L+D  CD+ A  +    PI  +  +GY+EI KIL++Q+CDI+A D W+  P+H ACE GHTEIVK+L    CDIEA+ 
Sbjct:  224 DIEASAGKKSRRPIHFACIGGRIDIVEVLTSKNCNIEAEDEDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIE-SCDRFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIES---CDEWKRRPIHLACENGHTEIVKVLIDHHCDIEAQDKRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAIN 697          

HSP 5 Score: 342.043 bits (876), Expect = 7.482e-105
Identity = 194/438 (44.29%), Postives = 272/438 (62.10%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACD-EVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEE-SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWR--PIHFACERGHKDIAKLL---------------VDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACD-RWQWRPLHWACERGHTEIVKLLT 1486
            IHLAC   +  IV  L+ +N +IE R      PIH AC  G  EIV+LLI +  D E FGG+W + P+H AC  G+   V +LI  NCN+ AC+      PI+ AC  G +EI K+LI+Q+CDI+    + KR PIH+ C  G+ ++ K+LI   CDI+       RPIHLA +N H  I K+LI+ NCD+ A  GK  RRPIHFAC+ G ++I++VLI  NC+IE  + + + +PIH+AC  G  EI+++L+++ CDIE+C      RPIH AC+ GH  IV++L+D  CDIEA  +    PIH +C +G+  I K+L+D++CDIEA   L++W+  PIH ACE GH +I K+L               V++ CD+ AC     RPI  A E+G+ EIVK+LI+  CDI AC  R+   P+H A +   TE+++LLT
Sbjct:  337 IHLACQIDNPLIVTLLLGNNCEIESRTNDNMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRSPIHFACSRGYIKIVIVLIRQNCNLEACEISWFHRPIHVACWDGSIEIVKVLIEQKCDIESCD-RFKRRPIHLACEAGYLEVAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKR-RPIHLACENGHTEIVKVLIDHHCDIEAQDKRKRCPIHISCVKGYMEITKILLDQRCDIEA---LDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKVLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLLT 769          

HSP 6 Score: 265.388 bits (677), Expect = 1.992e-76
Identity = 147/303 (48.51%), Postives = 190/303 (62.71%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIE-IRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRML 1084
            + +K D+D    R   P IHLA D  H EIVK LI+ N D+  I  +W RRPIH AC KG  +IVK+LID+  D E+   +WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EI K+LID  CDI+    K KR PIH+ C +G+ +I K+L+D+ CDIE  D     PIHLACENGH  I K+LI+ +CDIEA   K                   VL+ +NC+IEA D    RPIHLACEKG  EIV++LID  CDI AC G  N  PIH A K     ++++L
Sbjct:  487 ITHKCDIDAKTGRNFRP-IHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKVLIDHHCDIEA-QDKRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDK-------------------VLVEQNCDIEACDHLKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIHLARKNNFTELIQLL 768          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 346/492 (70.33%), Postives = 378/492 (76.83%), Query Frame = 2
Query:  128 MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNA-----------------CVENDW--RPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEI                 WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEI KLLIDQRCDIQVFGGK KRHPIHMGC EGHADIVKMLIDENCDIETCDKDGKR IHLACENGHV IAKILIDLNCDIEASAGKKSRRPIHFACIGG +EI+EVLISKNCNIEAEDE+  RPIHLACE G  EI ++LID  CDIEA  G  + RPIHFAC  GH  IV +L+ + C+IEA  E++WRPIH AC+ G+  I  LL+D  C+IE+     N  PIH+AC  G+ +I +LL+   CD+ A                   E  W  RPI  A     IEIVK+LI QKCDI++CDR++ RP+H ACE GH EI KLL    CDI+A T   + P+ LA
Sbjct:    1 MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEI-----------------WNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIVKLLIDQRCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTN-ENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLA 474          

HSP 2 Score: 403.29 bits (1035), Expect = 1.899e-127
Identity = 228/490 (46.53%), Postives = 298/490 (60.82%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQW-----------NQC-------PLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCD-KDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAG------------------------------AGLNNWR--PIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEAL-TREEYSPMKLA 1546
            IHLAC  G+  IV  L+D+N +IE R      PIH AC  G  EIV+LLI +  D E FGG+W           + C       P+H+ACW+   + VK+LIE  C+I +CD   R PI+ AC+ GH+EIAKLLI  +CDI    G+N R PIH+     H +IVK+LI+ENCD+     K  +RPIH AC  G + I K+LID NCDIE    K +++PIH AC  GH+EIL+VL+ KNC+IE+ DE   RPIHLACE G  EIV+ LI+  CDIEA +  N +RPIHF C  GH+  V++L+++ CDIEAC     RPIH ACE+GH  I K+LID  CDIEA                                 L++W+  PIH ACE GH +I K+L++  CD+ A  +  WRPI +   +G+++IVK+L+ Q CDI+ACD  + RP+H ACE+GHTEIVK+L    CDI A   R   SP+ LA
Sbjct:  320 IHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFR-PIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLA 807          

HSP 3 Score: 387.111 bits (993), Expect = 3.211e-121
Identity = 221/536 (41.23%), Postives = 307/536 (57.28%), Query Frame = 2
Query:  194 DLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEV---------------------------------NRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKR------------------HPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILI---------------------------------DLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEE-SWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            D++    +K    IH AC  G +EIV+ LI  N +IE  DE  +RPIH ACE G  EI K+LID   D E   G+ ++ P+H AC+ GH + V++LI  NCNI A DE                                  N  PI++AC  G+VEI +LLI   CDI+ FGGK KR                   PIH+ C++   +IVK+LI++ CDIE+CD+  +RPIHLACE GH+ IAK+LI                                 + NCD+ A  GK  RRPIHFAC+ G ++I++VLI  NC+IE  + + + +PIH+AC  G  EI+++L+++ CDIE+C      RPIH AC+ GH  IV+ L++  CDIEA  ++ WRPIHF C +GH +  K+L+++ CDIEA   +   RPIH ACE+GH +I K+L+D  CD+ A  +    PI  +  +GY+EI KIL++Q+CDI+A D W+  P+H ACE GHTEIVK+L    CDIEA+  + + P+   
Sbjct:  207 DIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIESRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKR-RPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKR-RPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFG 740          

HSP 4 Score: 383.259 bits (983), Expect = 9.628e-120
Identity = 222/506 (43.87%), Postives = 297/506 (58.70%), Query Frame = 2
Query:  188 KYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEA-----------------EDEESW--RPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVD----------------------------------RKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            + D+  +  +K    IH+ C  GH +IVK LID N DIE  D+  +R IH ACE G  EI K+LID   D E   G+ ++ P+H AC  G  + V++LI  NCNI A DE  + PI+ AC+ GHVEIAK+LID  CDI+   GK  R PIH  CF GH +IV++LI +NC+IE  D++  RPIHLAC+ G+  I  +L+D NC+IE S   ++  PIH+AC+ G+VEI+E+LI  NC+IEA                   E SW  RPIH+AC     EIV++LI++KCDIE+C      RPIH AC+ GH  I ++L+  KCDI+A    N+RPIH A +  HR I KLLI+  CD+ A  G  + RPIHFAC +G  DI K+L+D                                  + CD+ +C E   RPI  A E G+ EIVK LIN  CDI+A +   WRP+H+ C +GH++ VK+L +  CDIEA    +  P+ LA
Sbjct:  138 RCDIQVFGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRSIHLACENGHVEIAKILIDLNCDIEASAGKKSRRPIHFACIGGRIEIVEVLISKNCNIEAEDEDGKRPIHLACENGHVEIAKILIDLNCDIEARAGKKSRRPIHFACFGGHVEIVEVLISKNCNIEAEDEESWRPIHLACQIGNPLIVTLLLDNNCEIE-SRTNENMCPIHYACLNGNVEIVELLIRHNCDIEAFGGKWKRFPIHFACLRDSCEISWFHRPIHVACWDDSIEIVKLLIEQKCDIESCDRFKR-RPIHLACEAGHLEIAKLLITHKCDIDAKTGRNFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLA 641          

HSP 5 Score: 382.874 bits (982), Expect = 1.058e-119
Identity = 214/422 (50.71%), Postives = 286/422 (67.77%), Query Frame = 2
Query:  233 IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACD-EVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWR--PIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACD-RWQWRPLHWACERGHTEIVKLLT 1486
            IH+AC    +EIVK LI+   DIE  D +KRRPIH ACE G  EI KLLI +K D +   G+ N  P+HLA    H++ VK+LIE NC++NA   + +R PI+FAC +G ++I K+LID  CDI+V   K  + PIHM C++GH +I+K+L+++NCDIE+CD+  +RPIHLACENGH  I K LI+L+CDIEA     + RPIHF C  GH + ++VL+ +NC+IEA      RPIHLACEKG  EIV++LID  CDIEA        PIH +C  G+  I ++L+D++CDIEA   D+W+  PIH ACE GH  I K+LI+  CDIEA      WRPIHF C +GH DI K+LV++ CD+ AC     RPI  A E+G+ EIVK+LI+  CDI AC  R+   P++ A ++  TE+++LLT
Sbjct:  405 IHVACWDDSIEIVKLLIEQKCDIESCDRFKRRPIHLACEAGHLEIAKLLITHKCDIDAKTGR-NFRPIHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEA-INDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEA-QDDRKRCPIHISCVKGYMEITKILLDQRCDIEAL--DDWKMSPIHLACENGHTEIVKVLINHHCDIEA-INDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLT 820          

HSP 6 Score: 352.058 bits (902), Expect = 4.275e-108
Identity = 185/371 (49.87%), Postives = 248/371 (66.85%), Query Frame = 2
Query:  179 LCNKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIE-IRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLV 1288
            + +K D+D    R   P IHLA D  H EIVK LI+ N D+  I  +W RRPIH AC KG  +IVK+LID+  D E+   +WNQ P+H+ACW+GH + +K+L+E NC+I +CDE  R PI+ AC+ GH EI K LI+  CDI+     N   PIH GC++GH+D VK+L+++NCDIE C    +RPIHLACE GH  I K+LID +CDIEA   +K R PIH +C+ G++EI ++L+ + C+IEA D+    PIHLACE G  EIV++LI+  CDIEA +    +RPIHF C  GH  IV++L+++ CDIEAC     RPIH ACE+GH  I K+LID  CDI A  G  N  PI+ A ++   ++ +LL 
Sbjct:  454 ITHKCDIDAKTGRNFRP-IHLAFDNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIND-NAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRK-RCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEA-INDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDHMKRRPIHLACEKGHTEIVKVLIDHHCDISACGGRFNQSPIYLAHKKNFTELIQLLT 820          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 349/802 (43.52%), Postives = 487/802 (60.72%), Query Frame = 2
Query:  185 NKYDLDEYLERKDEPLIHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLAXXXXXXXXXXXXXXVKSE-----RKGEKRLTWKYKTPKDQTFEEQEEKNLARM------------ISLMGLKCQMNCDHSLCPTSLKNKTFQNGEIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVDILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHYSKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRNQTVFARTCCGTPAYMGPEVF---NEKPYSFSADIYSLGATIYHMMTGNIPDPEKDL----FKVIQ-EGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMN 2515
            NK D+ E L++++   IHL+C  GH E VK LI+HN DIE  D   RRPIH AC +G +E VKLLI+NK D E     WN+ P+HLAC +GH + VK+LIE  C+I A D+  + PI+ AC +GH E  KLLI+ +CDI+    K K+ PIH+ C++GH++ VK+LI+  CDIE  D+  +RPIHLAC+ GH    K+LI+  CDIEA   K ++RPIH AC  GH   +++LI   C+IEA DE+  RPIH AC +G  E V++LI+ KCDIEA +   N RPIH AC  GH+  V++L++ KCDIEA  E N RPIH AC++GH    KLLI+ KCDIEA     N RPIH AC++GH +  KLL++ KCD+ A  E + RPI  A   G  E VK+LI  KC I+A D+W  RP+H AC +GH+E VKLL +  CDIEAL +    P+ LA      +  +++ + K E       G   + +  K    +  +   E  L R             IS MGL C+  CDH LCPTSL++K+F  G +IG+GAFG V+ ++GS  +  FA+K +  + VD+   KY+E ++  ++  L H  I++Y+G I     L +FMEY   GS+   +  +  I  D +I YSKQ+  G+ FLH  +IIHRDIKP N+L+D+ NN+KL DFG+GR L  T  ++    T  GT  +  PEV    ++ PY  SADI+S+GAT+ +M++G  P     L    FKV+  +        +   + +  +K  +NP+   R +A +L+N
Sbjct:  157 NKCDI-EALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDW-WNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALD-KQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEA-LDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEA-LDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDD-RNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKWNQRPIHLACIQGHSEAVKLLIENKCDIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILNEARLERQRQQQLQQQLERQISKMGLTCESGCDHKLCPTSLRDKSFDKGSMIGRGAFGKVYKLQGSGISFVFAIKRMNSEGVDE---KYIEGNIYKFLPKLDHQRIVKYFGAIQTEKHLCLFMEYFPRGSLNTEISNKGSIETDNVIRYSKQILEGLKFLHGNKIIHRDIKPDNILLDEENNIKLADFGLGRSLMRTCGKSTRIDTTVGTANFTAPEVLEATDDAPYHESADIWSVGATVINMISGRPPYDNCPLCAVIFKVMTLKKLDLPEPQLMTAQIKSFIKEMLNPNPKKRSSAAQLLN 949          

HSP 2 Score: 448.743 bits (1153), Expect = 2.793e-143
Identity = 241/477 (50.52%), Postives = 313/477 (65.62%), Query Frame = 2
Query:  131 DEFETLIGTIRSQAPELCNKYDLDEYLERKDEPL---IHLACDFGHLEIVKFLIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQCPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKLLIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGKRPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILEVLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNW--RPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPMKLA 1546
            +EF+  I  I+S + EL  +Y  +E+LERKD  L   IH AC  GH EIVK LI+H  DIE  D+   RPIH AC +G +E VKLLI+NK D E    Q  Q P+HLAC +GH + VK+LIE  C+I A D+ N+ PI+ +C +GH E  KLLI+ +CDI+    +N R PIH+ C +GH++ VK+LI+ NCDIE  D   +RPIH+AC  GH    K+LI+  CDIEA     +RRPIH AC  GH E +++LI   C+IEA D++  RPIHLAC +G  E V++LI+ KCDIEA +     RPIH AC  GH+  V++L++ KCDIE   E N RPIH AC++GH    KLLI+ KCDIEA   L+ W  RPIH AC++GH    KLL++ KCD+ A  E   RPI  A  +G+ E VK+LI  KCDI+A D+W  RP+H AC +GH+E VKLL +  CDIEAL      P+ LA
Sbjct:    3 EEFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQ-KQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWR-PIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEA-LDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEA-LDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEA---LDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLA 472          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK18.481e-5827.05ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK18.875e-5827.05ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.069e-5727.05ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK26.467e-5524.66ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK34.576e-5426.14ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.422e-5325.45AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.422e-5325.45AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.487e-5325.45AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.487e-5325.45AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.980e-5325.45AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.688e-5727.63gene:FBgn0261788 transcript:FBtr0334062[more]
Ank24.231e-5627.63gene:FBgn0261788 transcript:FBtr0303120[more]
Ank23.072e-5527.63gene:FBgn0261788 transcript:FBtr0303119[more]
Ank26.422e-5527.63gene:FBgn0261788 transcript:FBtr0334061[more]
Ank29.398e-5027.63gene:FBgn0261788 transcript:FBtr0303118[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b1.488e-6127.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b8.196e-6127.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX640476.12.023e-6027.40ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.12.323e-6027.40ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1a4.450e-6027.85ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK17.553e-5726.48ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK18.461e-5726.48ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK19.760e-5726.48ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.040e-5627.21ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.260e-5626.48ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank11.358e-5527.27ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank15.877e-5527.27ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank11.231e-5427.27ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank11.237e-5427.27ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank11.293e-5427.27ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN4.262e-5727.05Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q02357|ANK1_MOUSE7.492e-5427.27Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|G5E8K5|ANK3_MOUSE1.290e-5225.91Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q5URB9|YR840_MIMIV8.152e-4931.14Putative ankyrin repeat protein R840 OS=Acanthamoe... [more]
sp|Q5UR04|YR911_MIMIV5.929e-4828.71Putative ankyrin repeat protein R911 OS=Acanthamoe... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|164889096.234e-10037.37tr|A0A182GGY8|A0A182GGY8_AEDAL ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|218731251.382e-9141.24tr|A0A1X7T5B0|A0A1X7T5B0_AMPQE ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|168475317.976e-9133.19tr|Q16FI9|Q16FI9_AEDAE AAEL014742-PA (Fragment) OS... [more]
gnl|BL_ORD_ID|218673731.141e-9041.14tr|A0A1X7T1N6|A0A1X7T1N6_AMPQE ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|1564349066.603e-9032.88tr|A0A2P1P9J0|A0A2P1P9J0_9RICK Ankyrin 2,3/unc44 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a4.905e-6027.27ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.903e-5827.40ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a4.770e-5425.34ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b1.455e-5324.20ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a2.091e-5225.61ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.11.262e-5926.26pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.11.956e-5826.23pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.18.840e-5325.12pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000002048.11.779e-5127.51pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000007449.18.736e-5024.82pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK23.104e-3332.41cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK16.316e-3332.84cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.750e-3228.85cAMP-dependent protein kinase catalytic subunit; p... [more]
MKK21.165e-2829.06MAPKK involved in the protein kinase C signaling p... [more]
CDC151.848e-2830.15Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.265e-4335.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496901.303e-3631.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498224.187e-3433.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407032.231e-3328.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491382.336e-3228.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b6.190e-5927.17ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a9.689e-5525.58ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039458.12.720e-5226.36ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.13.906e-5226.36ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000040233.14.459e-4825.82pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017258.13.546e-12489.99SMESG000017258.1[more]
SMESG000017260.10.000e+051.78SMESG000017260.1[more]
SMESG000017035.11.959e-11671.46SMESG000017035.1[more]
SMESG000018225.11.899e-12770.33SMESG000018225.1[more]
SMESG000017277.12.793e-14343.52SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034296 ID=SMED30034296|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2615bp
TAATCAATTATTTTATTAATCAAGTGAATTGACTCAGTTTATTATTTCAA
TTTTCATAATTTGCGGAAATATTTATTAATTTGTTTCATTTGTTTTCGGC
AAAAATTTTAACAGAACTTATTTTTGGATGGATGAATTCGAGACATTGAT
TGGAACCATCCGCAGCCAGGCCCCTGAATTGTGTAACAAATACGATCTAG
ATGAATATCTAGAAAGAAAAGATGAACCTCTAATCCATTTGGCTTGTGAT
TTTGGTCACTTGGAAATTGTAAAATTTCTGATTGATCATAACGTTGATAT
TGAGATACGTGATGAGTGGAAAAGACGTCCTATTCACTCAGCTTGTGAGA
AAGGACAAGCAGAAATTGTAAAATTGCTTATTGATAATAAAATCGATTTC
GAAATATTTGGGGGACAGTGGAATCAATGCCCATTGCATCTTGCTTGTTG
GGAAGGCCATAAGGACACTGTAAAGATTCTTATTGAAAGTAACTGTAACA
TTAATGCATGTGATGAGGTTAACCGAAGTCCAATTTATTTTGCGTGCAAG
AGAGGACACGTGGAAATTGCTAAACTTCTGATTGATCAAAGGTGCGATAT
TCAGGTATTCGGTGGCAAGAACAAAAGGCATCCTATTCATATGGGCTGCT
TTGAAGGCCATGCCGACATTGTAAAAATGCTAATAGATGAAAATTGTGAT
ATTGAAACCTGCGATAAAGATGGTAAGCGTCCAATCCATTTAGCTTGCGA
GAACGGCCATGTGGCGATTGCAAAGATCCTGATAGACCTCAATTGTGATA
TTGAAGCAAGTGCAGGCAAAAAAAGTAGGCGACCGATTCATTTTGCTTGT
ATTGGAGGCCATGTAGAAATCTTGGAAGTTCTAATCTCAAAGAATTGTAA
TATTGAAGCGGAGGATGAAGAGAGTTGGCGTCCGATTCATTTGGCCTGTG
AGAAAGGTGACAAAGAAATTGTTCGGATGCTAATAGACCGGAAATGCGAC
ATAGAAGCCTGCGTAGGAATGAACAATTATCGGCCGATTCATTTTGCGTG
CAAATGGGGTCACAATGTTATAGTGAGAATGCTGATGGACCGCAAGTGTG
ACATCGAGGCATGTATAGAGGATAATTGGCGGCCCATTCATTTTGCATGT
GAAAGAGGTCACAGAAATATTGCAAAGCTTCTAATTGATCGAAAATGTGA
TATTGAGGCTGGGGCAGGACTGAATAATTGGCGGCCGATTCATTTTGCAT
GTGAAAGGGGTCACAAGGATATTGCCAAATTGCTAGTGGACCGAAAATGT
GATGTCAATGCATGCGTTGAGAATGATTGGCGGCCAATTATTTGGGCATC
TGAGAGAGGCTACATTGAAATTGTTAAGATTCTTATCAATCAAAAATGTG
ACATTGACGCCTGTGATCGATGGCAATGGCGTCCGCTTCACTGGGCGTGC
GAAAGGGGCCACACGGAGATCGTGAAACTTTTGACGCAAGCTGGATGCGA
TATTGAGGCGCTTACTAGAGAAGAGTACTCGCCGATGAAATTGGCGGAAA
ATAAAAACTGGAAAGAAATAATTGAGATAATTAATAAAGTCAAATCAGAA
AGGAAAGGAGAAAAACGGTTGACCTGGAAATACAAAACACCGAAAGACCA
AACGTTTGAGGAACAAGAAGAGAAAAACCTGGCTCGCATGATCTCCTTAA
TGGGACTGAAATGCCAAATGAATTGTGACCACAGCCTCTGTCCGACATCT
CTTAAAAATAAGACATTCCAAAATGGAGAAATAATTGGACAAGGAGCATT
TGGAATGGTCTTTATTGTCAAAGGTTCCAATTCCAACCGAGAGTTCGCCA
TGAAATTCATTGGGATAGATAACGTTGATGATTCTGAAACTAAATACGTT
GAAAACGACATGAACACCTATGTCGACATCCTCAAACATGATCATATCAT
TCAGTATTATGGAGTCATTGGGAAGGCTAATGGTTTGTACGTGTTCATGG
AATATCTGGACGGAGGATCCATAGAGAAGAGAATGAAAAAAGAAAAATTA
ATTCCGTTAGATGAAATTATTCATTATAGCAAGCAAATGACCAGCGGAAT
CGCATTTCTGCACGAAAAGAGAATTATTCATAGAGATATAAAACCTGCCA
ATGTGTTGATAGATAAGAACAATAATGTCAAATTAGTAGATTTCGGAATA
GGTCGGATATTGGAGGGTACTAGAAATCAAACAGTTTTTGCACGTACATG
CTGTGGGACACCTGCCTACATGGGACCAGAAGTTTTTAACGAAAAACCAT
ATTCATTTTCGGCAGATATTTATTCTCTTGGAGCTACAATTTATCATATG
ATGACAGGAAATATCCCAGACCCAGAGAAGGATTTGTTCAAAGTGATACA
AGAAGGTTTCTCCCAGTCTGTCAAATCTATCCAACAAAAGAAATTCGAAT
TCATTTTAAAATGGACAGTAAACCCAGATGCGTCCATGCGACCAACGGCC
CAAAAATTGATGAATGAGTTCATCAACTATTCCAATTAAATGTTCCCAGG
ATCATTTATTGAGAAACTCTGATAAAATGTTTGAGCATACTTAACTTTGA
TTTGAAATTAAAGCT
back to top

protein sequence of SMED30034296-orf-1

>SMED30034296-orf-1 ID=SMED30034296-orf-1|Name=SMED30034296-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=804bp
MDEFETLIGTIRSQAPELCNKYDLDEYLERKDEPLIHLACDFGHLEIVKF
LIDHNVDIEIRDEWKRRPIHSACEKGQAEIVKLLIDNKIDFEIFGGQWNQ
CPLHLACWEGHKDTVKILIESNCNINACDEVNRSPIYFACKRGHVEIAKL
LIDQRCDIQVFGGKNKRHPIHMGCFEGHADIVKMLIDENCDIETCDKDGK
RPIHLACENGHVAIAKILIDLNCDIEASAGKKSRRPIHFACIGGHVEILE
VLISKNCNIEAEDEESWRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNN
YRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIHFACERGHRNIAK
LLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVEND
WRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVK
LLTQAGCDIEALTREEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTW
KYKTPKDQTFEEQEEKNLARMISLMGLKCQMNCDHSLCPTSLKNKTFQNG
EIIGQGAFGMVFIVKGSNSNREFAMKFIGIDNVDDSETKYVENDMNTYVD
ILKHDHIIQYYGVIGKANGLYVFMEYLDGGSIEKRMKKEKLIPLDEIIHY
SKQMTSGIAFLHEKRIIHRDIKPANVLIDKNNNVKLVDFGIGRILEGTRN
QTVFARTCCGTPAYMGPEVFNEKPYSFSADIYSLGATIYHMMTGNIPDPE
KDLFKVIQEGFSQSVKSIQQKKFEFILKWTVNPDASMRPTAQKLMNEFIN
YSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005198structural molecule activity
GO:0005200structural constituent of cytoskeleton
GO:0008093cytoskeletal adaptor activity
GO:0019899enzyme binding
GO:0030507spectrin binding
GO:0051117ATPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR000719Prot_kinase_dom
IPR020683Ankyrin_rpt-contain_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006887exocytosis
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0010638positive regulation of organelle organization
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:0072661protein targeting to plasma membrane
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030673axolemma
GO:0031430M band
GO:0031672A band
GO:0042383sarcolemma
GO:0043005neuron projection
GO:0045211postsynaptic membrane