Clusterin-associated protein 1

Overview
NameClusterin-associated protein 1
Smed IDSMED30034295
Length (bp)1597
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Clusterin-associated protein 1 (SMED30034295) t-SNE clustered cells

Violin plots show distribution of expression levels for Clusterin-associated protein 1 (SMED30034295) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Clusterin-associated protein 1 (SMED30034295) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Clusterin-associated protein 1 (SMED30034295) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034295

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034295h1SMcG0020873 SmedASXL_000204SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30034295h1SMcG0020873 Contig49493uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034295h1SMcG0020873 Contig49493newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30034295h1SMcG0020873 dd_Smed_v6_8287_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034295h1SMcG0020873 dd_Smed_v4_8287_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Match: CLUAP1 (clusterin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19009])

HSP 1 Score: 318.931 bits (816), Expect = 4.130e-104
Identity = 161/302 (53.31%), Postives = 220/302 (72.85%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD---SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+       ++N       +K+ ++K  RQLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL  F+N  +LE Q ED  + + +R ++ + TL  + ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Match: CLUAP1 (clusterin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19009])

HSP 1 Score: 318.931 bits (816), Expect = 1.748e-103
Identity = 161/302 (53.31%), Postives = 220/302 (72.85%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD---SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+       ++N       +K+ ++K  RQLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL  F+N  +LE Q ED  + + +R ++ + TL  + ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Match: CLUAP1 (clusterin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19009])

HSP 1 Score: 318.161 bits (814), Expect = 2.345e-103
Identity = 161/302 (53.31%), Postives = 220/302 (72.85%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD---SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+       ++N       +K+ ++K  RQLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL  F+N  +LE Q ED  + + +R ++ + TL  + ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Match: CLUAP1 (clusterin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19009])

HSP 1 Score: 214.157 bits (544), Expect = 4.202e-66
Identity = 119/257 (46.30%), Postives = 153/257 (59.53%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYL 860
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM+              AD  A R                                           QLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMI--------------ADLKAAR-------------------------------------------QLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYL 200          
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Match: CLUAP1 (clusterin associated protein 1 [Source:HGNC Symbol;Acc:HGNC:19009])

HSP 1 Score: 160.614 bits (405), Expect = 7.903e-47
Identity = 70/104 (67.31%), Postives = 85/104 (81.73%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKS 434
            MMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ 
Sbjct:    1 MMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEG 104          
BLAST of Clusterin-associated protein 1 vs. Ensembl Celegans
Match: dyf-3 (Clusterin-associated protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q6I6D4])

HSP 1 Score: 234.572 bits (597), Expect = 1.104e-71
Identity = 123/298 (41.28%), Postives = 195/298 (65.44%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADV-SQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELN-VHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLR 977
            M+YRE+RN  EM RSL Y RL+S+ENFRTPNFQL AE+L+W+V +++  +++ +  + TE DRV FIK     M+  + IK+N K+LYQADG+AV+ELL    +LY +  ++    +S +   V + L ++K++E++ TRQL+S +   GA L++LL R+  + +    A S  + +AE E+ +Q  ++N+  E E+    LNN+ASDE  LD K+E+K+ E E+ QKR + LQS RP YMDEYE+ EE L  LY  Y+ +FRN ++L   ++D+ + +  R ++ E  ++   +++R
Sbjct:    1 MSYRELRNLCEMTRSLRYPRLMSIENFRTPNFQLVAELLEWIVKKFEPESNLDAHEVQTEADRVAFIKNAVLLMLQNSRIKMNPKKLYQADGHAVQELLPAMKILYQAKAEDPNTDNSPKWTQVKNKL-SSKMQEVRITRQLSSQLPETGALLSELLSRQEFISQQHERAASRAVPLAEAEKVLQATVQNIAQETEQLSNKLNNVASDEAELDEKIERKKREYEQLQKRFAKLQSFRPQYMDEYERFEERLKKLYEVYVLNFRNLSYLRKVHDDLARSERQRQEELEKAMRMAVEKMR 297          
BLAST of Clusterin-associated protein 1 vs. Ensembl Celegans
Match: dyf-3 (Clusterin-associated protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q6I6D4])

HSP 1 Score: 218.009 bits (554), Expect = 1.795e-65
Identity = 116/287 (40.42%), Postives = 186/287 (64.81%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADV-SQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELN-VHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLR 977
            M RSL Y RL+S+ENFRTPNFQL AE+L+W+V +++  +++ +  + TE DRV FIK     M+  + IK+N K+LYQADG+AV+ELL    +LY +  ++    +S +   V + L ++K++E++ TRQL+S +   GA L++LL R+  + +    A S  + +AE E+ +Q  ++N+  E E+    LNN+ASDE  LD K+E+K+ E E+ QKR + LQS RP YMDEYE+ EE L  LY  Y+ +FRN ++L   ++D+ + +  R ++ E  ++   +++R
Sbjct:    1 MTRSLRYPRLMSIENFRTPNFQLVAELLEWIVKKFEPESNLDAHEVQTEADRVAFIKNAVLLMLQNSRIKMNPKKLYQADGHAVQELLPAMKILYQAKAEDPNTDNSPKWTQVKNKL-SSKMQEVRITRQLSSQLPETGALLSELLSRQEFISQQHERAASRAVPLAEAEKVLQATVQNIAQETEQLSNKLNNVASDEAELDEKIERKKREYEQLQKRFAKLQSFRPQYMDEYERFEERLKKLYEVYVLNFRNLSYLRKVHDDLARSERQRQEELEKAMRMAVEKMR 286          
BLAST of Clusterin-associated protein 1 vs. Ensembl Celegans
Match: dyf-3 (Clusterin-associated protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q6I6D4])

HSP 1 Score: 153.295 bits (386), Expect = 7.627e-42
Identity = 85/225 (37.78%), Postives = 142/225 (63.11%), Query Frame = 3
Query:  306 MMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNEL-NVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLR 977
            M+  + IK+N K+LYQADG+AV+ELL    +LY +  ++    +S +   V + L ++K++E++ TRQL+S +   GA L++LL R+  + +    A S  + +AE E+ +Q  ++N+  E E+    LNN+ASDE  LD K+E+K+ E E+ QKR + LQS RP YMDEYE+ EE L  LY  Y+ +FRN ++L   ++D+ + +  R ++ E  ++   +++R
Sbjct:    1 MLQNSRIKMNPKKLYQADGHAVQELLPAMKILYQAKAEDPNTDNSPKWTQVKNKL-SSKMQEVRITRQLSSQLPETGALLSELLSRQEFISQQHERAASRAVPLAEAEKVLQATVQNIAQETEQLSNKLNNVASDEAELDEKIERKKREYEQLQKRFAKLQSFRPQYMDEYERFEERLKKLYEVYVLNFRNLSYLRKVHDDLARSERQRQEELEKAMRMAVEKMR 224          
BLAST of Clusterin-associated protein 1 vs. Ensembl Fly
Match: Cluap1 (gene:FBgn0031196 transcript:FBtr0077363)

HSP 1 Score: 145.206 bits (365), Expect = 2.565e-37
Identity = 87/291 (29.90%), Postives = 158/291 (54.30%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENF-----RTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNE-------LNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLD 926
            M+++++R+  E ++ LG+ R+  +++         +F + AE+LQWL    +  A +   +++E+ RV+ ++    F +TKA I++N ++LY A      EL KVT LL  S  QN   +D  +       LN  D+ D  K++E+++ R+LA+ +  +G T+ ++L +E+  +E+        LE+  VER +++AI+  +   +  +  L     +   L  K++++R+ELER ++RL  L  +RPA+M E+E  E+EL  L+  Y        FL     D +K QLD
Sbjct:    1 MSFKDVRDLGEHLKLLGFPRVFPLQSLANQHGSLASFHIVAELLQWLAGLIEPGATLPGGVESEEQRVLLVRSATEFFVTKAAIRINPRKLYAAAAVTAAELQKVTRLL-TSPGQNEADNDEEDQRDQYRSLNPVDIGD--KIEELRKARELATDLTQRGTTICEMLSKELLHKESLMSQAQRPLELLSVERTLKSAIQANQVRLQSSRAQLEAAKVELNALGSKLQRRRAELERTRQRLEALHRIRPAHMAEFEDCEKELQELFQRY--------FLRLHVRDALKSQLD 280          
BLAST of Clusterin-associated protein 1 vs. Ensembl Zebrafish
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:406281])

HSP 1 Score: 320.087 bits (819), Expect = 3.575e-104
Identity = 160/302 (52.98%), Postives = 222/302 (73.51%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMK--QNRMKSDSNELNVHDLLD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY RLISMENFR+PNF L AEIL WLV RY+   ++  ++DTE DRV FIK VA FM TKAH+KLN KRLYQADGYAV+E+LK+T++LYN+MK  +N     +N+ N     D  +K+ ++K  RQL S I +KGA L DLL +E DLRE+R+ A++  LEI E ERAI+ A+++V    +  +  LNN++SDE +L+ K+EKK+ +LERNQKRL TLQSVRPA+MDEYE++EE+L   Y  Y+  +RN +FLE Q +D  + + +R ++ EM +K   ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEILIWLVKRYEPQMEIPSDVDTESDRVFFIKAVAQFMATKAHVKLNLKRLYQADGYAVKEMLKITSILYNAMKTKENAGGDQNNDENSKFKFDLGSKIADLKLARQLGSEITAKGAALFDLLGQEEDLRESRTAAIARPLEITETERAIRAAVKDVTESIQMTKDLLNNVSSDEASLEAKIEKKKQDLERNQKRLQTLQSVRPAFMDEYEKIEEDLEKQYQTYVEKYRNLSFLEQQLDDYHRVEQERFEEAEMAMKMRQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. Ensembl Xenopus
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:549723])

HSP 1 Score: 332.798 bits (852), Expect = 2.163e-109
Identity = 166/303 (54.79%), Postives = 225/303 (74.26%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKS---DSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
            M+YR++RNFTEMMR+LGY RLISMENFR+PNF L AE+L WLV RY+ + D+  ++DTEQDRV FIK VA FM TKAHIKLNT++LYQADGY+V+ELLK+TT+LYN+MK   M+S   +  E +       +K+ ++K  RQLAS I SKGATL DLL +E DLRE R+ A++  LE+ + E+ ++ +I+ V  + +K +  L+N+ASDE NL+ K+EK++ ELERN+KRL TLQ+VRPA+MDEYE++EEEL   Y  YL  FRN  +LE Q ED  + + +R ++ E TL+ M  +LR+ EN
Sbjct:    1 MSYRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEVLIWLVKRYEPHTDIPVDVDTEQDRVFFIKAVAQFMATKAHIKLNTRKLYQADGYSVKELLKITTVLYNAMKSKGMESTQLEDQETSTFKFNLGSKISDLKMARQLASEITSKGATLYDLLGKEADLREQRTAAIARPLEMNDTEKVLRTSIKEVLEQVQKMKDLLSNVASDEQNLEAKIEKRKQELERNRKRLQTLQTVRPAFMDEYEKIEEELQKHYETYLDKFRNVCYLEQQLEDYHRVEQERFEEAENTLRLMQSKLREEEN 303          
BLAST of Clusterin-associated protein 1 vs. Ensembl Xenopus
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:549723])

HSP 1 Score: 332.028 bits (850), Expect = 1.158e-108
Identity = 166/303 (54.79%), Postives = 225/303 (74.26%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKS---DSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
            M+YR++RNFTEMMR+LGY RLISMENFR+PNF L AE+L WLV RY+ + D+  ++DTEQDRV FIK VA FM TKAHIKLNT++LYQADGY+V+ELLK+TT+LYN+MK   M+S   +  E +       +K+ ++K  RQLAS I SKGATL DLL +E DLRE R+ A++  LE+ + E+ ++ +I+ V  + +K +  L+N+ASDE NL+ K+EK++ ELERN+KRL TLQ+VRPA+MDEYE++EEEL   Y  YL  FRN  +LE Q ED  + + +R ++ E TL+ M  +LR+ EN
Sbjct:    1 MSYRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEVLIWLVKRYEPHTDIPVDVDTEQDRVFFIKAVAQFMATKAHIKLNTRKLYQADGYSVKELLKITTVLYNAMKSKGMESTQLEDQETSTFKFNLGSKISDLKMARQLASEITSKGATLYDLLGKEADLREQRTAAIARPLEMNDTEKVLRTSIKEVLEQVQKMKDLLSNVASDEQNLEAKIEKRKQELERNRKRLQTLQTVRPAFMDEYEKIEEELQKHYETYLDKFRNVCYLEQQLEDYHRVEQERFEEAENTLRLMQSKLREEEN 303          
BLAST of Clusterin-associated protein 1 vs. Ensembl Xenopus
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:549723])

HSP 1 Score: 317.005 bits (811), Expect = 1.006e-103
Identity = 159/296 (53.72%), Postives = 216/296 (72.97%), Query Frame = 3
Query:  111 NFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKS---DSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
             F +MMR+LGY RLISMENFR+PNF L AE+L WLV RY+ + D+  ++DTEQDRV FIK VA FM TKAHIKLNT++LYQADGY+V+ELLK+TT+LYN+MK   M+S   +  E +       +K+ ++K  RQLAS I SKGATL DLL +E DLRE R+ A++  LE+ + E+ ++ +I+ V  + +K +  L+N+ASDE NL+ K+EK++ ELERN+KRL TLQ+VRPA+MDEYE++EEEL   Y  YL  FRN  +LE Q ED  + + +R ++ E TL+ M  +LR+ EN
Sbjct:    2 TFRQMMRALGYPRLISMENFRSPNFPLVAEVLIWLVKRYEPHTDIPVDVDTEQDRVFFIKAVAQFMATKAHIKLNTRKLYQADGYSVKELLKITTVLYNAMKSKGMESTQLEDQETSTFKFNLGSKISDLKMARQLASEITSKGATLYDLLGKEADLREQRTAAIARPLEMNDTEKVLRTSIKEVLEQVQKMKDLLSNVASDEQNLEAKIEKRKQELERNRKRLQTLQTVRPAFMDEYEKIEEELQKHYETYLDKFRNVCYLEQQLEDYHRVEQERFEEAENTLRLMQSKLREEEN 297          
BLAST of Clusterin-associated protein 1 vs. Ensembl Xenopus
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:549723])

HSP 1 Score: 318.546 bits (815), Expect = 1.693e-103
Identity = 161/295 (54.58%), Postives = 217/295 (73.56%), Query Frame = 3
Query:  114 FTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKS---DSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
            FTEMMR+LGY RLISMENFR+PNF L AE+L WLV RY+ + D+  ++DTEQDRV FIK VA FM TKAHIKLNT++LYQADGY+V+ELLK+TT+LYN+MK   M+S   +  E +       +K+ ++K  RQLAS I SKGATL DLL +E DLRE R+ A++  LE+ + E+ ++ +I+ V  + +K +  L+N+ASDE NL+ K+EK++ ELERN+KRL TLQ+VRPA+MDEYE++EEEL   Y  YL  FRN  +LE Q ED  + + +R ++ E TL+ M  +LR+ EN
Sbjct:   13 FTEMMRALGYPRLISMENFRSPNFPLVAEVLIWLVKRYEPHTDIPVDVDTEQDRVFFIKAVAQFMATKAHIKLNTRKLYQADGYSVKELLKITTVLYNAMKSKGMESTQLEDQETSTFKFNLGSKISDLKMARQLASEITSKGATLYDLLGKEADLREQRTAAIARPLEMNDTEKVLRTSIKEVLEQVQKMKDLLSNVASDEQNLEAKIEKRKQELERNRKRLQTLQTVRPAFMDEYEKIEEELQKHYETYLDKFRNVCYLEQQLEDYHRVEQERFEEAENTLRLMQSKLREEEN 307          
BLAST of Clusterin-associated protein 1 vs. Ensembl Mouse
Match: Cluap1 (clusterin associated protein 1 [Source:MGI Symbol;Acc:MGI:1924029])

HSP 1 Score: 323.939 bits (829), Expect = 8.009e-106
Identity = 166/304 (54.61%), Postives = 229/304 (75.33%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  +I+TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LEI E E+ ++ AI+++  + +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRPA+MDEYE++EE+L   Y  YL  FRN A+LE Q ED  + + +R ++ E TL+ M ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDLLAQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLQTLQSVRPAFMDEYEKVEEDLQKQYDVYLEKFRNLAYLEQQLEDHHRMEQERFEEAENTLRLMQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. Ensembl Mouse
Match: Cluap1 (clusterin associated protein 1 [Source:MGI Symbol;Acc:MGI:1924029])

HSP 1 Score: 223.787 bits (569), Expect = 7.118e-70
Identity = 114/208 (54.81%), Postives = 155/208 (74.52%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKV 731
            MMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  +I+TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LEI E E+ ++ AI+++  + +K +  LNN+ASDE NL+ K+
Sbjct:    1 MMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDLLAQVQKTKDLLNNVASDEANLEAKI 206          
BLAST of Clusterin-associated protein 1 vs. Ensembl Mouse
Match: Cluap1 (clusterin associated protein 1 [Source:MGI Symbol;Acc:MGI:1924029])

HSP 1 Score: 204.527 bits (519), Expect = 8.470e-63
Identity = 104/189 (55.03%), Postives = 141/189 (74.60%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEK 674
            MMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  +I+TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LEI E E+ ++ AI+++  + +K
Sbjct:    1 MMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDLLAQVQK 187          
BLAST of Clusterin-associated protein 1 vs. Ensembl Mouse
Match: Gm20695 (predicted gene 20695 [Source:MGI Symbol;Acc:MGI:5313142])

HSP 1 Score: 202.601 bits (514), Expect = 1.045e-60
Identity = 106/187 (56.68%), Postives = 138/187 (73.80%), Query Frame = 3
Query:   81 ILSM-TYREMR----NFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLE 611
            ILS+   +E R    +FTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  +I+TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LE
Sbjct:   98 ILSLGVVKEFRKHGIDFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLE 282          
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8R3P7|CLUA1_MOUSE (Clusterin-associated protein 1 OS=Mus musculus OX=10090 GN=Cluap1 PE=1 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 5.602e-105
Identity = 166/304 (54.61%), Postives = 229/304 (75.33%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  +I+TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LEI E E+ ++ AI+++  + +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRPA+MDEYE++EE+L   Y  YL  FRN A+LE Q ED  + + +R ++ E TL+ M ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDIETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDLLAQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLQTLQSVRPAFMDEYEKVEEDLQKQYDVYLEKFRNLAYLEQQLEDHHRMEQERFEEAENTLRLMQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q7ZVC2|CLUA1_DANRE (Clusterin-associated protein 1 homolog OS=Danio rerio OX=7955 GN=cluap1 PE=2 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 1.015e-102
Identity = 159/302 (52.65%), Postives = 222/302 (73.51%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMK--QNRMKSDSNELNVHDLLD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY RLISMENFR+PNF L AEIL WLV RY+   ++  ++DTE DRV FIK VA FM TKAH+KLN KRLYQADGYAV+E+LK+T++LYN+MK  +N     +N+ N     D  +K+ ++K  RQL S I +KGA L DLL +E DLRE+R+ A++  LEI E ERA++ A+++V    +  +  LNN++SDE +L+ K+EKK+ +LERNQKRL TLQSVRPA+MDEYE++EE+L   Y  Y+  +RN +FLE Q +D  + + +R ++ EM +K   ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEILIWLVKRYEPQMEIPSDVDTESDRVFFIKAVAQFMATKAHVKLNLKRLYQADGYAVKEMLKITSILYNAMKTKENAGGDQNNDENSKFKFDLGSKIADLKLARQLGSEITAKGAALFDLLGQEEDLRESRTAAIARPLEITETERAMRAAVKDVTESIQMTKDLLNNVSSDEASLEAKIEKKKQDLERNQKRLQTLQSVRPAFMDEYEKIEEDLEKQYQTYVEKYRNLSFLEQQLDDYHRVEQERFEEAEMAMKMRQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q96AJ1|CLUA1_HUMAN (Clusterin-associated protein 1 OS=Homo sapiens OX=9606 GN=CLUAP1 PE=1 SV=4)

HSP 1 Score: 318.161 bits (814), Expect = 1.126e-102
Identity = 161/302 (53.31%), Postives = 220/302 (72.85%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD---SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+       ++N       +K+ ++K  RQLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL  F+N  +LE Q ED  + + +R ++ + TL  + ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDTYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q4R6Y7|CLUA1_MACFA (Clusterin-associated protein 1 OS=Macaca fascicularis OX=9541 GN=CLUAP1 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 6.052e-101
Identity = 159/302 (52.65%), Postives = 219/302 (72.52%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD---SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M++R++RNFTEMMR+LGY R ISMEN RTPNF L +E+L WLV RY+   D+  ++DTEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+       ++N       +K+ ++K  RQLAS I SKGA+L DLL  EV+LRE R+ A++  LEI E E+ ++ AI+ + T+ +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRP +MDEYE+ EEEL   Y  YL  F+N  +LE Q E+  + + +R ++ + TL  + ++L++ E
Sbjct:    1 MSFRDLRNFTEMMRALGYPRHISMENLRTPNFGLVSEVLLWLVKRYEPQTDIPPDVDTEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGASLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYDIYLEKFQNLTYLEQQLEEHHRMEQERFEEAKNTLCLIQNKLKEEE 302          
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6AYJ5|CLUA1_RAT (Clusterin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cluap1 PE=1 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 2.902e-98
Identity = 159/293 (54.27%), Postives = 217/293 (74.06%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-SDSNELNV----HDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            MMR+LGY R ISMENFRTPNF L +E+L WLV RY+   D+  + +TEQDRV FIK +A FM TKAHIKLNTK+LYQADGYAV+ELLK+T++LYN+MK   M+ S+  E ++     DL   +K+ ++K  RQLAS I +KGA+L DLL +EV+LRE R+ A++  LEI E E+ ++ AI+++  + +K +  LNN+ASDE NL+ K+EK++ ELERN+KRL TLQSVRPA+MDEYE++EEEL   Y  YL  FRN A+LE Q ED  + + +R ++ E TL+ M ++L++ E
Sbjct:    1 MMRALGYPRHISMENFRTPNFGLVSEVLLWLVKRYEPQTDIPSDTETEQDRVFFIKAIAQFMATKAHIKLNTKKLYQADGYAVKELLKITSVLYNAMKTKGMEGSNVGEEDISKFKFDL--GSKIADLKAARQLASEITAKGASLYDLLGKEVELRELRTEAIARPLEINETEKVMRIAIKDILAQVQKTKDLLNNVASDEANLEAKIEKRKLELERNRKRLQTLQSVRPAFMDEYEKVEEELQKQYDVYLEKFRNLAYLEQQLEDHHRMEQERFEEAENTLRLMQNKLKEEE 291          
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Match: K1Q635 (Clusterin-associated protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10014475 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 2.319e-115
Identity = 178/304 (58.55%), Postives = 237/304 (77.96%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQN---RMKSDSNELNVHDLLD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
            M+YR++RNFTEMMR+LGY RLISMENFR PNF L AE+++WLV RYD NAD+  +IDT+QDRVIFIK VA FM TKAHIK+NTK+LYQ+DGYAV+E+LKVT++LYN+MK N   + ++D+ + + H   D ++K+ ++KE R+LAS I +KGATL DLL +EVDLRE RSI ++  LEI EVE  I  +I+ VE E +K  + L+N+ASDE NL+ K+EKK++ELERN KRL TLQSVRPAYMDEYE+LEE+L  LY  Y+  FRN  +LE+Q E+  + + D+ ++ E  LK+MAD+L+  E+
Sbjct:    1 MSYRDLRNFTEMMRALGYPRLISMENFRNPNFPLVAEVMRWLVKRYDPNADIHCDIDTDQDRVIFIKTVAEFMHTKAHIKMNTKKLYQSDGYAVKEMLKVTSMLYNAMKTNSSSQSETDNEDDSSHLSFDISSKINDLKEARRLASEITTKGATLYDLLGKEVDLREQRSIVIAKSLEINEVEGGITGSIKGVENEIKKYLMQLDNVASDEANLEAKIEKKKNELERNNKRLQTLQSVRPAYMDEYEKLEEDLQKLYEVYMEKFRNLTYLEAQQEEYNRAEQDKFEETEEKLKQMADRLKSEEH 304          
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Match: A0A2C9JGW4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056248 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 5.351e-113
Identity = 176/302 (58.28%), Postives = 232/302 (76.82%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQN---RMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M+YR++RNFTEMMR+LG+ RLISMENFRTPNF+L  E L WL+ RYD NAD++ +IDTEQDRVIFIK VA F+ TKAHIKLNTK+LY ADGYAV+E+LKVT +LYN+ K N   +++S + +++      ++++ E+KE R+LAS I  KGA L DLL +EVDLRE R++ ++  LEI EVE  +Q +IE V  E +K +  L+N+ASDE NL++K+EKK+SELERN KRL TLQSVRPAYMDEYE+LEE+L  LY AY+  FRN AFLE+Q E+  K + D+ ++ E  LK MAD+++  E
Sbjct:    1 MSYRDLRNFTEMMRALGFHRLISMENFRTPNFKLVYECLIWLMKRYDPNADLAIDIDTEQDRVIFIKTVAEFLATKAHIKLNTKKLYGADGYAVKEMLKVTNVLYNATKSNVAGKLESGAGDISSVAFDVSSRINELKEARRLASEITVKGAQLYDLLGKEVDLREQRAMVVAKALEINEVEHGLQASIEAVRNEIQKTKTMLDNVASDEANLEIKIEKKKSELERNNKRLQTLQSVRPAYMDEYERLEEDLEKLYDAYMIKFRNLAFLETQLEEQNKVEQDKLEETEQQLKVMADKIKTEE 302          
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Match: A0A2C9JGU5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056248 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 6.139e-113
Identity = 176/302 (58.28%), Postives = 232/302 (76.82%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQN---RMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE 986
            M+YR++RNFTEMMR+LG+ RLISMENFRTPNF+L  E L WL+ RYD NAD++ +IDTEQDRVIFIK VA F+ TKAHIKLNTK+LY ADGYAV+E+LKVT +LYN+ K N   +++S + +++      ++++ E+KE R+LAS I  KGA L DLL +EVDLRE R++ ++  LEI EVE  +Q +IE V  E +K +  L+N+ASDE NL++K+EKK+SELERN KRL TLQSVRPAYMDEYE+LEE+L  LY AY+  FRN AFLE+Q E+  K + D+ ++ E  LK MAD+++  E
Sbjct:    1 MSYRDLRNFTEMMRALGFHRLISMENFRTPNFKLVYECLIWLMKRYDPNADLAIDIDTEQDRVIFIKTVAEFLATKAHIKLNTKKLYGADGYAVKEMLKVTNVLYNATKSNVAGKLESGAGDISSVAFDVSSRINELKEARRLASEITVKGAQLYDLLGKEVDLREQRAMVVAKALEINEVEHGLQASIEAVRNEIQKTKTMLDNVASDEANLEIKIEKKKSELERNNKRLQTLQSVRPAYMDEYERLEEDLEKLYDAYMIKFRNLAFLETQLEEQNKVEQDKLEETEQQLKVMADKIKTEE 302          
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Match: A0A210QV56 (Clusterin-associated protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05858 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 6.323e-113
Identity = 177/309 (57.28%), Postives = 235/309 (76.05%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQN---RMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAE---NVVT 998
            M+++++RNFTEM R+LGY RLISMENFRTPNF L AE+L+WLV RYD NAD   + DTEQDRVIF+K VA FM TKAHIKLNTK+LYQADGYAV+ELLKVT++LYN+MK N   ++ +  ++++      ++++ E+KE R+LAS I +KGATL DLL REVDLRE RS+ ++  LEI EVE  + ++I+ VE E +K    L+N+ASDE NL+ K++KKR+EL+RN KRL TLQSVRPAYMDEYE+LEE+L  LY  Y+  FRN  +LESQ ED  + + D+ ++ E  LK+MA +L+  E   +V+T
Sbjct:    1 MSFKDLRNFTEMTRALGYPRLISMENFRTPNFPLVAEVLKWLVKRYDPNADTHGDTDTEQDRVIFVKSVAEFMATKAHIKLNTKKLYQADGYAVKELLKVTSVLYNAMKTNVIDQLDNPDDDMSHLSFDVSSRISELKEARRLASEITTKGATLYDLLGREVDLREQRSMVIAKSLEINEVESGMAHSIKAVEGEVKKTLHMLDNVASDEANLEAKIDKKRNELDRNNKRLQTLQSVRPAYMDEYEKLEEDLQKLYEIYMNKFRNLTYLESQLEDYNRAEQDKFEETEEKLKQMAQRLKDEEMKRDVIT 309          
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Match: A0A2G8K391 (Putative clusterin-associated protein 1-like OS=Stichopus japonicus OX=307972 GN=BSL78_20729 PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 5.202e-112
Identity = 178/305 (58.36%), Postives = 231/305 (75.74%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNE---LNVHDL-LD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN 989
            M+YR++RNFTEMMR+LGY RLISMENFRTPNF L AE+L WLV RYD N+D+  + DTEQDRVIFIK VA FM TKAHIKLNTKRLYQADGYAV+EL+KVT++LYN+MK N    D  E    N   L  D ++K+ ++K +RQLAS I SKGA+L DLL +EV+LRE R+ A++  LEI E+E+ ++ +I+ VE   +K Q  L N+ASDE NL+ K+EKK+SELERNQKRL TLQSVRPA+MDEYE+LE +L+  Y  ++  +RN   LE Q E+I + + DR ++ E +LKKM  +L++ E+
Sbjct:    1 MSYRDLRNFTEMMRALGYPRLISMENFRTPNFSLVAEVLIWLVQRYDPNSDIPTDTDTEQDRVIFIKSVAQFMATKAHIKLNTKRLYQADGYAVKELIKVTSVLYNAMKTNTTSKDGEEEANSNASSLSFDLSSKISDLKSSRQLASLITSKGASLYDLLGKEVELREIRTTAINRPLEINEIEKGLRGSIKAVEQNIDKTQKMLENVASDEANLEAKIEKKKSELERNQKRLQTLQSVRPAFMDEYEKLETDLSKYYEEFIEKYRNLTSLEHQLEEISRAEQDRFEETENSLKKMQTRLKEEED 305          
BLAST of Clusterin-associated protein 1 vs. Ensembl Cavefish
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:103026037])

HSP 1 Score: 307.76 bits (787), Expect = 2.067e-99
Identity = 165/303 (54.46%), Postives = 221/303 (72.94%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELN------VHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRK 980
            M++R++R+FTEMMR+LGY RLISMENFR PNF L AEIL WLV RY+   D+  ++DTE DRV FIK VA FM TKAHIKLN KRLYQADGYAV+E+LK+T++LYN+MK  +   D   L+        DL   +K+ ++K  RQL S I + GA+L DLL  E DLRE+R+ A++  LEIAE ERA++ AI++V    +K +  LNNI+SDE +L+ K+EKK+ ELERNQKRL TLQSVRPA+M+EYE++EEEL   Y  Y+  FRN +FLE Q ED  + + +R ++ E +++ M ++LR+
Sbjct:    1 MSFRDLRSFTEMMRALGYPRLISMENFRAPNFPLVAEILIWLVKRYEPQMDIPSDVDTESDRVFFIKAVAQFMATKAHIKLNLKRLYQADGYAVKEMLKITSVLYNAMKTKQNADDDQNLDEGSSKFKFDL--GSKIADLKAARQLGSEITAMGASLYDLLGHEEDLRESRTAAIARPLEIAETERALRAAIKDVMENVQKTKEQLNNISSDEASLEAKIEKKKQELERNQKRLQTLQSVRPAFMEEYEKIEEELQKQYETYVEKFRNLSFLEQQLEDHHRVEQERFEEAENSIRMMQNKLRE 301          
BLAST of Clusterin-associated protein 1 vs. Ensembl Cavefish
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:103026037])

HSP 1 Score: 305.834 bits (782), Expect = 1.293e-98
Identity = 165/303 (54.46%), Postives = 221/303 (72.94%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELN------VHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRK 980
            M++R++R+FTEMMR+LGY RLISMENFR PNF L AEIL WLV RY+   D+  ++DTE DRV FIK VA FM TKAHIKLN KRLYQADGYAV+E+LK+T++LYN+MK  +   D   L+        DL   +K+ ++K  RQL S I + GA+L DLL  E DLRE+R+ A++  LEIAE ERA++ AI++V    +K +  LNNI+SDE +L+ K+EKK+ ELERNQKRL TLQSVRPA+M+EYE++EEEL   Y  Y+  FRN +FLE Q ED  + + +R ++ E +++ M ++LR+
Sbjct:    1 MSFRDLRSFTEMMRALGYPRLISMENFRAPNFPLVAEILIWLVKRYEPQMDIPSDVDTESDRVFFIKAVAQFMATKAHIKLNLKRLYQADGYAVKEMLKITSVLYNAMKTKQNADDDQNLDEGSSKFKFDL--GSKIADLKAARQLGSEITAMGASLYDLLGHEEDLRESRTAAIARPLEIAETERALRAAIKDVMENVQKTKEQLNNISSDEASLEAKIEKKKQELERNQKRLQTLQSVRPAFMEEYEKIEEELQKQYETYVEKFRNLSFLEQQLEDHHRVEQERFEEAENSIRMMQNKLRE 301          
BLAST of Clusterin-associated protein 1 vs. Ensembl Sea Lamprey
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:406281])

HSP 1 Score: 310.842 bits (795), Expect = 2.319e-101
Identity = 159/305 (52.13%), Postives = 215/305 (70.49%), Query Frame = 3
Query:  111 NFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSD-SNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKST 1022
            +FTEMMR+LGY RLISMENFR PNF L AE+L WLV RY+  +D+  +IDTE DRV FIK VA FM TKAH+KLNTKRLYQADGYAV+ELLK+T++LY++   +  + D   E         +++ + K +RQLAS I  KGA L DLL REVDLR+ R+ A++  LE+AE E+ ++ AI+ V  E EK +  L N+ASDE NLD K+EK+R+ELER+ KRL TL +VRPA+MDEYE +E EL   Y+A++  FRN AFLE Q  +  + + ++ ++ E TLK M  +L++ E  +   +NE+ +
Sbjct:    2 DFTEMMRALGYPRLISMENFRQPNFPLVAEVLAWLVKRYEPQSDIPADIDTEHDRVFFIKAVAEFMATKAHVKLNTKRLYQADGYAVKELLKLTSVLYHASNVHASQGDLPQEEPTFSFQLGSRITDFKLSRQLASDITRKGAALYDLLGREVDLRDLRTSAIARPLEMAETEKTLRAAIKGVVDEVEKTKRMLENVASDEANLDSKIEKRRAELERSHKRLQTLHTVRPAFMDEYEAVEAELQVNYTAFVEKFRNLAFLEQQLNEQRRAEQEKFEEAENTLKLMQSKLKEEEKRLLKHHNEEDS 306          
BLAST of Clusterin-associated protein 1 vs. Ensembl Nematostella
Match: EDO37973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE98])

HSP 1 Score: 295.819 bits (756), Expect = 1.188e-95
Identity = 156/287 (54.36%), Postives = 215/287 (74.91%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDL-LD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKE 944
            M+YR++RNFTEMMRSLGY RLISMENFR+PNF L AE+L WLV RYD N ++  +++TEQDRV+FIK VA FM TKAHIKLNTK+LY ADGYAV+ELLKVT++LYN+MK N    ++   +V  L  D ++++ ++K +RQLAS I ++GA L DLL  EV+LR+ R+ A++  LE+ E+E  I+ +I   + +  K    L+NIASDE NL+ K++KK+ ELERNQKRL +L+SVRPA+MDEYE+LEEEL  +Y  Y+   RN +++E   +D+ + + DR ++ E
Sbjct:    1 MSYRDLRNFTEMMRSLGYPRLISMENFRSPNFALVAEVLIWLVKRYDPNVELPMDVETEQDRVLFIKAVAQFMATKAHIKLNTKKLYGADGYAVKELLKVTSVLYNAMKSNVTDDEAEPSDVTSLTFDISSRISDLKASRQLASEITTRGAALYDLLGHEVELRDIRTRAIAKPLEVNELENGIKKSISLAQDDIRKTTQMLDNIASDEANLEAKIDKKKQELERNQKRLRSLESVRPAFMDEYEKLEEELKKVYETYMEKHRNLSYMEQLLDDVNRAEQDRFEETE 287          
BLAST of Clusterin-associated protein 1 vs. Ensembl Nematostella
Match: EDO32576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUP1])

HSP 1 Score: 178.333 bits (451), Expect = 7.150e-53
Identity = 104/208 (50.00%), Postives = 150/208 (72.12%), Query Frame = 3
Query:  312 TKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDL-LD-ANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDR 929
            TKAHIKLNTK+LY ADGYAV+ELLKVT++LYN+MK N    ++   +V  L  D ++++ ++K +RQLAS I ++GA L DLL  EV+LR+ R+ A++  LE+ E+E  I+ +I   + +  K    L+NIASDE NL+ K++KK+ ELERNQKRL +L+SVRPA+MDEYE+LEEEL  +Y  Y+   RN +++E   +D+ + + DR
Sbjct:    3 TKAHIKLNTKKLYGADGYAVKELLKVTSVLYNAMKSNVTDDEAEPSDVTSLTFDISSRISDLKASRQLASEITTRGAALYDLLGHEVELRDIRTRAIAKPLEVNELENGIKKSISLAQDDIRKTTQMLDNIASDEANLEAKIDKKKQELERNQKRLRSLESVRPAFMDEYEKLEEELKKVYETYMEKHRNLSYMEQLLDDVNRAEQDR 210          
BLAST of Clusterin-associated protein 1 vs. Ensembl Medaka
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:101161625])

HSP 1 Score: 303.138 bits (775), Expect = 1.188e-96
Identity = 155/310 (50.00%), Postives = 220/310 (70.97%), Query Frame = 3
Query:   66 LFHFLILSMTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-----SDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRK 980
            +F FL   M++R++RNF E + +LGY R IS ENFRTPNF L AEIL WLV RY+ + ++  ++DTE DR+ FIK VA FM  KAHIKLNTKRLYQADGYAV+E+LK++++L+++MK   M       D N+    D+   +++ ++K  RQLAS + + GA+L DLL +EVDLRE R++A++  L+I E E+A++ A ++V     K +  LNN+ SDE +LD K+E+K+ +LER+QKRL TLQSVRPA+MDEYE++EEEL   Y  Y   FRN +FLESQ E+  + + +R ++ E TL+ M  +LR+
Sbjct:   84 IFFFLNPKMSFRDLRNFIETLTALGYPRRISTENFRTPNFPLVAEILIWLVKRYEPHNEIPTDVDTEADRIFFIKTVAQFMAAKAHIKLNTKRLYQADGYAVKEMLKISSVLHSAMKTKEMALEDRAEDDNKFR-SDI--GSRISDLKAARQLASEVTTTGASLYDLLGKEVDLRERRTVAIARPLDINETEKALRAATKDVLENVAKTKDMLNNVVSDEASLDAKIERKKQDLERHQKRLQTLQSVRPAFMDEYEKIEEELKKQYDLYEKKFRNLSFLESQLEEHHRLEKERFEEAENTLRIMQHKLRE 390          
BLAST of Clusterin-associated protein 1 vs. Ensembl Medaka
Match: cluap1 (clusterin associated protein 1 [Source:NCBI gene;Acc:101161625])

HSP 1 Score: 288.5 bits (737), Expect = 2.918e-91
Identity = 148/297 (49.83%), Postives = 211/297 (71.04%), Query Frame = 3
Query:  105 MRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMK-----SDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRK 980
            +++F E + +LGY R IS ENFRTPNF L AEIL WLV RY+ + ++  ++DTE DR+ FIK VA FM  KAHIKLNTKRLYQADGYAV+E+LK++++L+++MK   M       D N+    D+   +++ ++K  RQLAS + + GA+L DLL +EVDLRE R++A++  L+I E E+A++ A ++V     K +  LNN+ SDE +LD K+E+K+ +LER+QKRL TLQSVRPA+MDEYE++EEEL   Y  Y   FRN +FLESQ E+  + + +R ++ E TL+ M  +LR+
Sbjct:   71 LKDFIETLTALGYPRRISTENFRTPNFPLVAEILIWLVKRYEPHNEIPTDVDTEADRIFFIKTVAQFMAAKAHIKLNTKRLYQADGYAVKEMLKISSVLHSAMKTKEMALEDRAEDDNKFR-SDI--GSRISDLKAARQLASEVTTTGASLYDLLGKEVDLRERRTVAIARPLDINETEKALRAATKDVLENVAKTKDMLNNVVSDEASLDAKIERKKQDLERHQKRLQTLQSVRPAFMDEYEKIEEELKKQYDLYEKKFRNLSFLESQLEEHHRLEKERFEEAENTLRIMQHKLRE 364          
BLAST of Clusterin-associated protein 1 vs. Planmine SMEST
Match: SMESG000016963.1 (SMESG000016963.1)

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 467/468 (99.79%), Postives = 468/468 (100.00%), Query Frame = 3
Query:   90 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 1493
            MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETD+IDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD
Sbjct:    1 MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETDNIDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 468          
BLAST of Clusterin-associated protein 1 vs. Planmine SMEST
Match: SMESG000016963.1 (SMESG000016963.1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 462/463 (99.78%), Postives = 463/463 (100.00%), Query Frame = 3
Query:  105 MRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 1493
            MRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETD+IDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD
Sbjct:    1 MRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETDNIDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 463          
BLAST of Clusterin-associated protein 1 vs. Planmine SMEST
Match: SMESG000016963.1 (SMESG000016963.1)

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 456/457 (99.78%), Postives = 457/457 (100.00%), Query Frame = 3
Query:  123 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 1493
            MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETD+IDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD
Sbjct:    1 MMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNADVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKVTTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGATLADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVALNNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELTHLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAENVVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTRGGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETDNIDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEYNNKTSKTRSRIPSEPEDD 457          
The following BLAST results are available for this feature:
BLAST of Clusterin-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLUAP14.130e-10453.31clusterin associated protein 1 [Source:HGNC Symbol... [more]
CLUAP11.748e-10353.31clusterin associated protein 1 [Source:HGNC Symbol... [more]
CLUAP12.345e-10353.31clusterin associated protein 1 [Source:HGNC Symbol... [more]
CLUAP14.202e-6646.30clusterin associated protein 1 [Source:HGNC Symbol... [more]
CLUAP17.903e-4767.31clusterin associated protein 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dyf-31.104e-7141.28Clusterin-associated protein 1 homolog [Source:Un... [more]
dyf-31.795e-6540.42Clusterin-associated protein 1 homolog [Source:Un... [more]
dyf-37.627e-4237.78Clusterin-associated protein 1 homolog [Source:Un... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cluap12.565e-3729.90gene:FBgn0031196 transcript:FBtr0077363[more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cluap13.575e-10452.98clusterin associated protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cluap12.163e-10954.79clusterin associated protein 1 [Source:NCBI gene;A... [more]
cluap11.158e-10854.79clusterin associated protein 1 [Source:NCBI gene;A... [more]
cluap11.006e-10353.72clusterin associated protein 1 [Source:NCBI gene;A... [more]
cluap11.693e-10354.58clusterin associated protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cluap18.009e-10654.61clusterin associated protein 1 [Source:MGI Symbol;... [more]
Cluap17.118e-7054.81clusterin associated protein 1 [Source:MGI Symbol;... [more]
Cluap18.470e-6355.03clusterin associated protein 1 [Source:MGI Symbol;... [more]
Gm206951.045e-6056.68predicted gene 20695 [Source:MGI Symbol;Acc:MGI:53... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R3P7|CLUA1_MOUSE5.602e-10554.61Clusterin-associated protein 1 OS=Mus musculus OX=... [more]
sp|Q7ZVC2|CLUA1_DANRE1.015e-10252.65Clusterin-associated protein 1 homolog OS=Danio re... [more]
sp|Q96AJ1|CLUA1_HUMAN1.126e-10253.31Clusterin-associated protein 1 OS=Homo sapiens OX=... [more]
sp|Q4R6Y7|CLUA1_MACFA6.052e-10152.65Clusterin-associated protein 1 OS=Macaca fascicula... [more]
sp|Q6AYJ5|CLUA1_RAT2.902e-9854.27Clusterin-associated protein 1 OS=Rattus norvegicu... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q6352.319e-11558.55Clusterin-associated protein 1 OS=Crassostrea giga... [more]
A0A2C9JGW45.351e-11358.28Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JGU56.139e-11358.28Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210QV566.323e-11357.28Clusterin-associated protein 1 OS=Mizuhopecten yes... [more]
A0A2G8K3915.202e-11258.36Putative clusterin-associated protein 1-like OS=St... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cluap12.067e-9954.46clusterin associated protein 1 [Source:NCBI gene;A... [more]
cluap11.293e-9854.46clusterin associated protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cluap12.319e-10152.13clusterin associated protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO379731.188e-9554.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325767.150e-5350.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cluap11.188e-9650.00clusterin associated protein 1 [Source:NCBI gene;A... [more]
cluap12.918e-9149.83clusterin associated protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Clusterin-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016963.10.000e+099.79SMESG000016963.1[more]
SMESG000016963.10.000e+099.78SMESG000016963.1[more]
SMESG000016963.10.000e+099.78SMESG000016963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034295 ID=SMED30034295|Name=Clusterin-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1597bp
TTCAGATATGACCAAAATGCCGATATTATATATGTACCTTAGTAACATTT
GTATATTCAAAATTATTATTTCATTTTTTAATTTTATCAATGACTTACCG
TGAAATGAGAAATTTTACTGAGATGATGCGATCTCTCGGTTATAGTAGAT
TAATAAGCATGGAAAATTTTCGAACTCCAAATTTCCAGTTAACTGCAGAA
ATTTTGCAATGGCTCGTATTCAGATATGACCAAAATGCCGATGTATCTCA
AAATATCGACACTGAACAAGATCGTGTCATTTTCATCAAATTAGTTGCTC
ATTTCATGATGACCAAAGCTCACATAAAGCTAAATACAAAGCGTCTATAT
CAAGCTGACGGGTATGCCGTTAGAGAACTTTTAAAAGTCACAACATTACT
ATATAATTCAATGAAACAAAACAGAATGAAAAGCGATTCCAATGAACTCA
ATGTTCACGATTTGCTTGACGCAAATAAGCTCAAGGAAATCAAAGAAACT
CGTCAATTGGCCAGCAGTATAATCTCCAAAGGGGCAACTCTAGCGGATCT
TTTAAAACGAGAAGTTGATTTGCGAGAAGCCAGATCTATTGCACTCAGCA
ACCAACTGGAAATAGCTGAAGTTGAGAGAGCCATACAAAATGCTATTGAA
AACGTTGAAACCGAGAAAGAAAAGCAACAAGTAGCTCTCAATAACATCGC
ATCAGATGAAACGAATTTGGATTTAAAAGTCGAAAAGAAACGCAGCGAAT
TGGAAAGAAATCAAAAACGGTTGTCAACTTTACAGTCCGTAAGACCTGCC
TACATGGATGAGTATGAGCAACTGGAAGAAGAACTAACTCATCTTTATTC
AGCATACTTGACAAGTTTCCGAAATCAAGCATTTCTAGAAAGCCAGTATG
AAGATATAGTAAAACAGCAACTTGATAGGTCTGATGATAAAGAAATGACT
TTGAAAAAAATGGCTGACCAGTTGCGTAAAGCCGAAAATGTTGTCACTGG
TCAATACAATGAAAAATCTACGAATAAAAAAAATAAAGATGACTTTGAAA
ATCTTCTCGACGATGATGATGATGAAGACGAATCATCGGAAGAGGATATA
AATAATAACGATTTACAGGAAAATAAGCCACGAACGAGAGGTGGTGTACC
AGCGGCAGGGGGAGACATGAGAAATGGAGAAAAGCCCACAATGGGTTCTC
AACGAAATTTCGGCACAATGAGAGATGAAGAATCCGAAGATGAAGATGAA
GATGAAGATGATGAGGATGAATCCGAGGAAGAAACAGACGACATCGATGA
AAACTCGGAGGAATCGGAAAACAACCAATTAGAGAAAAAGCGCGCCAACG
GAATGAATCCATTGGACAGTAGTACTTACAGCAATAATCCCAACCTTGCA
GCACCGAATGCCTACTCCAGACCGAGAGGCGCCGAATATAACAATAAAAC
CAGCAAAACCAGAAGCCGAATTCCGAGTGAACCTGAGGACGATTTCTAAT
TTCTATGAATTATTCTTATTATTATTATATGATTTGCTGTTTTATATTTA
TATGCGGTGCGAGTATTAATTGATTTGTTCACCAGAACTCTGCGTTG
back to top

protein sequence of SMED30034295-orf-1

>SMED30034295-orf-1 ID=SMED30034295-orf-1|Name=SMED30034295-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=470bp
MTYREMRNFTEMMRSLGYSRLISMENFRTPNFQLTAEILQWLVFRYDQNA
DVSQNIDTEQDRVIFIKLVAHFMMTKAHIKLNTKRLYQADGYAVRELLKV
TTLLYNSMKQNRMKSDSNELNVHDLLDANKLKEIKETRQLASSIISKGAT
LADLLKREVDLREARSIALSNQLEIAEVERAIQNAIENVETEKEKQQVAL
NNIASDETNLDLKVEKKRSELERNQKRLSTLQSVRPAYMDEYEQLEEELT
HLYSAYLTSFRNQAFLESQYEDIVKQQLDRSDDKEMTLKKMADQLRKAEN
VVTGQYNEKSTNKKNKDDFENLLDDDDDEDESSEEDINNNDLQENKPRTR
GGVPAAGGDMRNGEKPTMGSQRNFGTMRDEESEDEDEDEDDEDESEEETD
DIDENSEESENNQLEKKRANGMNPLDSSTYSNNPNLAAPNAYSRPRGAEY
NNKTSKTRSRIPSEPEDDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR019366Clusterin-associated_protein-1
Vocabulary: biological process
TermDefinition
GO:0001843neural tube closure
GO:0001947heart looping
GO:0007224smoothened signaling pathway
GO:0021508floor plate formation
GO:0030030cell projection organization
GO:0035082axoneme assembly
GO:0042073intraciliary transport
GO:0060271cilium morphogenesis
GO:0060972left/right pattern formation
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005813centrosome
GO:0005929cilium
GO:0030992intraciliary transport particle B
GO:0042995cell projection
GO:0043231intracellular membrane-bounded organelle
GO:0097542ciliary tip
GO:0097546ciliary base
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 303..323
NoneNo IPR availableCOILSCoilCoilcoord: 236..270
NoneNo IPR availableCOILSCoilCoilcoord: 197..228
NoneNo IPR availableCOILSCoilCoilcoord: 414..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 402..430
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 438..461
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..360
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 321..491
NoneNo IPR availableTMHMMTMhelixcoord: 7..25
IPR019366Clusterin-associated protein-1PFAMPF10234Cluap1coord: 36..299
e-value: 4.0E-103
score: 344.5
IPR019366Clusterin-associated protein-1PANTHERPTHR21547CLUSTERIN ASSOCIATED PROTEIN 1coord: 23..440