UDENN domain-containing protein

Overview
NameUDENN domain-containing protein
Smed IDSMED30034267
Length (bp)2266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UDENN domain-containing protein (SMED30034267) t-SNE clustered cells

Violin plots show distribution of expression levels for UDENN domain-containing protein (SMED30034267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UDENN domain-containing protein (SMED30034267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UDENN domain-containing protein (SMED30034267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034267h1SMcG0004539 dd_Smed_v4_10290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034267h1SMcG0004539 dd_Smed_v4_10290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034267h1SMcG0004539 Contig52543newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034267h1SMcG0004539 Contig52543uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND1B (DENN domain containing 1B [Source:HGNC Symbol;Acc:HGNC:28404])

HSP 1 Score: 79.7221 bits (195), Expect = 3.682e-15
Identity = 91/408 (22.30%), Postives = 158/408 (38.73%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKIN---QQYLKCS--LKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMK-IRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE 1337
            +F D   L    +F FP D  R       + +T V+++  + + F  CR      + LCI SY PWFE+  K+L  L +    +  + ++  L+ +Y          P   +N  +N     Y         P I + + + EY  A+           L+++ SML ER ++ +S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP   + N+ S++   + +K +        G    +  F    A L G YR+ +    G    F    F ++ S +  +FL+  +N Q F  FID R+A +     F+D F+ E
Sbjct:   28 DFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLY--------NHPVPKANTPVNLSVHSYFIAPDVTGLPTIPESRNLTEYFVAVDVNN------MLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVMLNV-----DTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEE 375          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND1B (DENN domain containing 1B [Source:HGNC Symbol;Acc:HGNC:28404])

HSP 1 Score: 78.5666 bits (192), Expect = 2.854e-14
Identity = 96/441 (21.77%), Postives = 171/441 (38.78%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNS--NDKINQQ-YLKCS--------------------LKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMK-IRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDKRSFR 1376
            +F D   L    +F FP D  R       + +T V+++  + + F  CR      + LCI SY PWFE+  K+L  L +    +  + ++  L+ +Y         +P  N+  N  +NQ+ ++ C                        P I + + + EY  A+      +    L+++ SML ER ++ +S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP   + N+ S++   + +K +        G    +  F    A L G YR+ +    G    F    F ++ S +  +FL+  +N Q F  FID R+A +     F+D F+ E     F   + RS++
Sbjct:   38 DFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLY------NHPVPKANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYFVAV------DVNNMLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVMLNV-----DTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGNPRSYQ 420          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND1B (DENN domain containing 1B [Source:HGNC Symbol;Acc:HGNC:28404])

HSP 1 Score: 77.0258 bits (188), Expect = 3.630e-14
Identity = 93/426 (21.83%), Postives = 164/426 (38.50%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNS--NDKINQQ-YLKCS--------------------LKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMK-IRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE 1337
            +F D   L    +F FP D  R       + +T V+++  + + F  CR      + LCI SY PWFE+  K+L  L +    +  + ++  L+ +Y         +P  N+  N  +NQ+ ++ C                        P I + + + EY  A+           L+++ SML ER ++ +S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP   + N+ S++   + +K +        G    +  F    A L G YR+ +    G    F    F ++ S +  +FL+  +N Q F  FID R+A +     F+D F+ E
Sbjct:   38 DFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLY------NHPVPKANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYFVAVDVNN------MLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVMLNV-----DTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEE 405          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND1B (DENN domain containing 1B [Source:HGNC Symbol;Acc:HGNC:28404])

HSP 1 Score: 67.0106 bits (162), Expect = 4.120e-11
Identity = 56/231 (24.24%), Postives = 99/231 (42.86%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKIN---QQYLKCS--LKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCM 815
            +F D   L    +F FP D  R       + +T V+++  + + F  CR      + LCI SY PWFE+  K+L  L +    +  + ++  L+ +Y          P   +N  +N     Y         P I + + + EY  A+           L+++ SML ER ++ +S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +
Sbjct:   38 DFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLY--------NHPVPKANTPVNLSVHSYFIAPDVTGLPTIPESRNLTEYFVAVDVNN------MLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL 251          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND1A (DENN domain containing 1A [Source:HGNC Symbol;Acc:HGNC:29324])

HSP 1 Score: 67.3958 bits (163), Expect = 6.744e-11
Identity = 85/416 (20.43%), Postives = 168/416 (40.38%), Query Frame = 3
Query:  156 CLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQY-LKCSLKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKFTEY--NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
            C   +VDS ++SQ               + +T V+++  + + F  CR     K   CI SY PWFE+  K+L  L +       ++ +  L+ ++ L   D    P  + +  ++  + +  + + P I + + + EY  A+      +    L ++ SML ER ++ +  +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +   ++KV     ++ +++++D                         + T F ++ +  +D +S      ++N +  +     D     + + +  F               G YR  +  E E    F    F  +  +  + +FL+     Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   54 CFPFYVDSLTVSQV-------------GQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYKLLNILADYTTKRQENQWNELLETLHKLPIPD----PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRILIICSKLSTLTACIHGSAAMLYPMYWQHVYIPVLP---PHLLDYCCAPMPYLIGIHLSL---MEKVRNMALDDVVILNVDTNT----------------------LETPFDDLQSLPNDVIS-----SLKNRLKKVSTTTGDGVARAFLKAQAAF--------------FGSYRNALKIEPEEPITFCEEAFVSHYRSGAMRQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDK 399          
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Match: rme-4 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:G5ECW9])

HSP 1 Score: 53.5286 bits (127), Expect = 5.005e-7
Identity = 60/261 (22.99%), Postives = 114/261 (43.68%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPC---DCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSY----NPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLD--NKD-YVTLPACNSNDKIN-----QQYLKCSLKFPFI-YDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPK--------KSPELLGMNCCMLGIHRCMKPILDKVDYWNEALLVDLDE 875
            +F D   +    +F FPC   +   D  + ++ V++++ +  SF  CRY       +C  S     N +F+ L+ + L + +++  D    +++ L + Y  D  N D Y+     N  D  N      + +    + P +  DK+  E+  AI      + +  L IF S+L ER ++F  ++   L+  L A    ++P+ W    ++I+P+          P L+G+   +L   R        +    E ++VD+DE
Sbjct:   39 DFHDPAIVKSVQQFAFPCQLREVEVDAVQLFSFVLTDSNSKFSFGFCRYTPRTDTCICFLSGFFWPNVFFKALNDISLVIGSAQRED----VESVLTKFYHTDIPNIDEYLRFADSNQTDGHNYRVVFAEKIPDHTRLPTLGSDKFFLEFYNAI------DPRQMLAIFASLLKERRILFTGRKVGSLSSCLHAVSMLLYPMCWQSVFITILPESLVDMVMAPMPYLIGVPKTVLENARL------NIRDIGEVVIVDIDE 283          
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Match: rme-4 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:G5ECW9])

HSP 1 Score: 53.5286 bits (127), Expect = 5.005e-7
Identity = 60/261 (22.99%), Postives = 114/261 (43.68%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPC---DCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSY----NPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLD--NKD-YVTLPACNSNDKIN-----QQYLKCSLKFPFI-YDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPK--------KSPELLGMNCCMLGIHRCMKPILDKVDYWNEALLVDLDE 875
            +F D   +    +F FPC   +   D  + ++ V++++ +  SF  CRY       +C  S     N +F+ L+ + L + +++  D    +++ L + Y  D  N D Y+     N  D  N      + +    + P +  DK+  E+  AI      + +  L IF S+L ER ++F  ++   L+  L A    ++P+ W    ++I+P+          P L+G+   +L   R        +    E ++VD+DE
Sbjct:   39 DFHDPAIVKSVQQFAFPCQLREVEVDAVQLFSFVLTDSNSKFSFGFCRYTPRTDTCICFLSGFFWPNVFFKALNDISLVIGSAQRED----VESVLTKFYHTDIPNIDEYLRFADSNQTDGHNYRVVFAEKIPDHTRLPTLGSDKFFLEFYNAI------DPRQMLAIFASLLKERRILFTGRKVGSLSSCLHAVSMLLYPMCWQSVFITILPESLVDMVMAPMPYLIGVPKTVLENARL------NIRDIGEVVIVDIDE 283          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG18659 (gene:FBgn0027561 transcript:FBtr0339371)

HSP 1 Score: 88.5817 bits (218), Expect = 3.440e-18
Identity = 94/411 (22.87%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYN-------KQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC-MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN-SRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRS 1370
             F D   L+    F FPCD      + Y+ V +   +   F  CR        + + +Y PW +   K+L  L      D  +    +L + Y   N+    +P C  + K+   Y        F +++ +Q  L ++      N        +  + +F +ML ER +IF S+   +L+  + AA  F++P+ W H  + ++P +  + LG     ++G+    +P+L+ V           DE    ++  CD      K F+ P      F +V N   + VSQ     ++  +++   +I D+               S +F   +  LIG YR+ +   E    F+  KF E   + +  FL  +++ Q F  FID+R+ ++ +   F+D F+ E   +  + KR 
Sbjct:   50 GFRDQEVLTGIPSFAFPCDTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYLPWHDTFLKLLPVLAELRRTDP-NGFRTFLSEAY---NQG---IPDCGGSLKV---YYSAGQSH-FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGV---PEPVLETVTS---------DELGEVVILNCD-----TKIFESP------FDDVHNLPTEIVSQ-----LKKHLNHTHDHIGDR--------------ISKIFLNALVQLIGGYRDAVEYHENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRG 407          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG18659 (gene:FBgn0027561 transcript:FBtr0306381)

HSP 1 Score: 88.5817 bits (218), Expect = 3.440e-18
Identity = 94/411 (22.87%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYN-------KQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC-MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN-SRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRS 1370
             F D   L+    F FPCD      + Y+ V +   +   F  CR        + + +Y PW +   K+L  L      D  +    +L + Y   N+    +P C  + K+   Y        F +++ +Q  L ++      N        +  + +F +ML ER +IF S+   +L+  + AA  F++P+ W H  + ++P +  + LG     ++G+    +P+L+ V           DE    ++  CD      K F+ P      F +V N   + VSQ     ++  +++   +I D+               S +F   +  LIG YR+ +   E    F+  KF E   + +  FL  +++ Q F  FID+R+ ++ +   F+D F+ E   +  + KR 
Sbjct:   50 GFRDQEVLTGIPSFAFPCDTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYLPWHDTFLKLLPVLAELRRTDP-NGFRTFLSEAY---NQG---IPDCGGSLKV---YYSAGQSH-FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGV---PEPVLETVTS---------DELGEVVILNCD-----TKIFESP------FDDVHNLPTEIVSQ-----LKKHLNHTHDHIGDR--------------ISKIFLNALVQLIGGYRDAVEYHENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRG 407          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG18659 (gene:FBgn0027561 transcript:FBtr0306382)

HSP 1 Score: 88.9669 bits (219), Expect = 5.097e-18
Identity = 94/413 (22.76%), Postives = 173/413 (41.89%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYN-------KQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC-MLGIHRCMKPILDKV--DYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN-SRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRS 1370
             F D   L+    F FPCD      + Y+ V +   +   F  CR        + + +Y PW +   K+L  L      D  +    +L + Y   N+    +P C  + K+   Y        F +++ +Q  L ++      N        +  + +F +ML ER +IF S+   +L+  + AA  F++P+ W H  + ++P +  + LG     ++G+    +P+L+ V  D   E ++++           CD      K F+ P      F +V N   + VSQ     ++  +++   +I D+               S +F   +  LIG YR+ +   E    F+  KF E   + +  FL  +++ Q F  FID+R+ ++ +   F+D F+ E   +  + KR 
Sbjct:   50 GFRDQEVLTGIPSFAFPCDTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYLPWHDTFLKLLPVLAELRRTDP-NGFRTFLSEAY---NQG---IPDCGGSLKV---YYSAGQSH-FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGV---PEPVLETVTSDELGEVVILN-----------CDT-----KIFESP------FDDVHNLPTEIVSQ-----LKKHLNHTHDHIGDR--------------ISKIFLNALVQLIGGYRDAVEYHENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRG 407          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG18659 (gene:FBgn0027561 transcript:FBtr0302498)

HSP 1 Score: 88.1965 bits (217), Expect = 1.161e-17
Identity = 95/420 (22.62%), Postives = 175/420 (41.67%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYN-------KQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC-MLGIHRCMKPILDKV--DYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN-SRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRS--FRILK 1385
             F D   L+    F FPCD      + Y+ V +   +   F  CR        + + +Y PW +   K+L  L      D  +    +L + Y         +P C  + K+   Y        F +++ +Q  L ++      N        +  + +F +ML ER +IF S+   +L+  + AA  F++P+ W H  + ++P +  + LG     ++G+    +P+L+ V  D   E ++++           CD      K F+ P      F +V N   + VSQ     ++  +++   +I D+               S +F   +  LIG YR+ +   E    F+  KF E   + +  FL  +++ Q F  FID+R+ ++ +   F+D F+ E   +  + KR   + I+K
Sbjct:   50 GFRDQEVLTGIPSFAFPCDTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYLPWHDTFLKLLPVLAELRRTDP-NGFRTFLSEAYNQG------IPDCGGSLKV---YYSAGQSH-FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGV---PEPVLETVTSDELGEVVILN-----------CDT-----KIFESP------FDDVHNLPTEIVSQ-----LKKHLNHTHDHIGDR--------------ISKIFLNALVQLIGGYRDAVEYHENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRGRNYAIMK 414          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG18659 (gene:FBgn0027561 transcript:FBtr0302497)

HSP 1 Score: 87.0409 bits (214), Expect = 2.810e-17
Identity = 93/420 (22.14%), Postives = 173/420 (41.19%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYN-------KQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC-MLGIHRCMKPILDKV--DYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN-SRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRS--FRILK 1385
             F D   L+    F FPCD      + Y+ V +   +   F  CR        + + +Y PW +   K+L  L      D  +    +L + Y         +P C  + K+   Y        F +++ +Q  L ++      N        +  + +F +ML ER +IF S+   +L+  + AA  F++P+ W H  + ++P +  + LG     ++G+    +P+L+ V  D   E ++++           CD            K   + F +V N   + VSQ     ++  +++   +I D+               S +F   +  LIG YR+ +   E    F+  KF E   + +  FL  +++ Q F  FID+R+ ++ +   F+D F+ E   +  + KR   + I+K
Sbjct:   50 GFRDQEVLTGIPSFAFPCDTTSTSVQTYSFVHTTGDSKWRFGFCRQDPRTNTAMVLITYLPWHDTFLKLLPVLAELRRTDP-NGFRTFLSEAYNQG------IPDCGGSLKV---YYSAGQSH-FTFERPLQFQLPSMPENHNLNLYYNFVEPKEMIAVFAAMLAERRIIFTSRHLDRLSSCIQAANAFLYPMVWQHIFIPVLPWEFKDYLGAPMPYLIGV---PEPVLETVTSDELGEVVILN-----------CDT-----------KIFESPFDDVHNLPTEIVSQ-----LKKHLNHTHDHIGDR--------------ISKIFLNALVQLIGGYRDAVEYHENSKTFNSQKFIESRPAHLRPFLAKMMDLQIFAQFIDDRLTMLNSGLGFSDEFELETVRYAEKKKRGRNYAIMK 414          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd2b (DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-030131-2547])

HSP 1 Score: 68.9366 bits (167), Expect = 1.941e-11
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     ++ + CC    ++GI     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S  +            D++  T  N       V S  F       IGHY   +T+ E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  872 VRVFASLLLERRVIFVADKLSTLSSCVHAVVALLYPFSWQHTFIPVLPTS---MVDIVCCPTPFLVGILSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQSLEQRNDIINQDSDSE-----------SDEECSTSLN------SVVSEAFIRFFLETIGHYSLFLTQGERGERIFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1075          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd2b (DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-030131-2547])

HSP 1 Score: 68.9366 bits (167), Expect = 2.004e-11
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     ++ + CC    ++GI     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S  +            D++  T  N       V S  F       IGHY   +T+ E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  872 VRVFASLLLERRVIFVADKLSTLSSCVHAVVALLYPFSWQHTFIPVLPTS---MVDIVCCPTPFLVGILSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQSLEQRNDIINQDSDSE-----------SDEECSTSLN------SVVSEAFIRFFLETIGHYSLFLTQGERGERIFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1075          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd2b (DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-030131-2547])

HSP 1 Score: 68.5514 bits (166), Expect = 2.264e-11
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     ++ + CC    ++GI     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S  +            D++  T  N       V S  F       IGHY   +T+ E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  874 VRVFASLLLERRVIFVADKLSTLSSCVHAVVALLYPFSWQHTFIPVLPTS---MVDIVCCPTPFLVGILSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQSLEQRNDIINQDSDSE-----------SDEECSTSLN------SVVSEAFIRFFLETIGHYSLFLTQGERGERIFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1077          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd2b (DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-030131-2547])

HSP 1 Score: 68.5514 bits (166), Expect = 2.461e-11
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     ++ + CC    ++GI     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S  +            D++  T  N       V S  F       IGHY   +T+ E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  874 VRVFASLLLERRVIFVADKLSTLSSCVHAVVALLYPFSWQHTFIPVLPTS---MVDIVCCPTPFLVGILSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQSLEQRNDIINQDSDSE-----------SDEECSTSLN------SVVSEAFIRFFLETIGHYSLFLTQGERGERIFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1077          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-76b14.2 (si:dkey-76b14.2 [Source:ZFIN;Acc:ZDB-GENE-090313-329])

HSP 1 Score: 62.7734 bits (151), Expect = 1.467e-9
Identity = 58/231 (25.11%), Postives = 94/231 (40.69%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPRDKS----EEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-----KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCM 815
            +F D  S      F FP D  R K     + +T V+++    + F  CR   S +  LCI SY PWFE+  K+L NL         + +   L  +Y          P   +N  I  Q +   +       P I + + + E + A+           L+++ SML ER ++    +   LT  + A    + P+ W H  + ++P   P LL   C     ++GIH  +
Sbjct:   38 DFNDEESRKSLPRFCFPYDIERVKDSVAVQHFTFVLTDLEGCQRFGFCRLTSSSQTCLCILSYLPWFEVFYKLLNNLAECSSKGQTNEMTELLSALY--------KHPVPPANGSITLQMIPYFIAPDPKALPSIPESRNLTELVVAVDVGN------LLQLYASMLFERRILIYCSKLSTLTACVHACNGMLFPMYWQHIFIPVLP---PHLLDYCCAPMPYLIGIHSSL 251          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: dennd2c (DENN/MADD domain containing 2C [Source:NCBI gene;Acc:780108])

HSP 1 Score: 56.6102 bits (135), Expect = 1.399e-7
Identity = 55/238 (23.11%), Postives = 105/238 (44.12%), Query Frame = 3
Query:  606 LWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNE-YKKGFHVYSLLFRTLI---AILIGHYR-ECITESEGVCKFDRNKFTE-YNSRIS-EFLKLLVNSQCFNSFIDER 1286
            L +++F S+LLER VIF++     L+    A +  ++P +W H  + ++P     ++ + C     ++GI  C  P+L  +    E L+VDL          C N+                F+  L+  DD +    P K++  ++ I   ++ ++  M+ E   +   + SL+    +     ++GHY        +G   F R  F + + SR + +FL + + +Q F  F  +R
Sbjct:  696 LLIKVFASLLLERRVIFVADNLSTLSKCAHAVLAILYPFTWQHTYIPVLPAS---MIDIVCSPTPFLIGILSCSLPLLSDLPI-EEVLIVDL----------CGNK----------------FLQALSDEDDIL----PHKLQAALAQI---LEQRDHIMFQEQLTEEVTLNSLVSEAFVWFFVEIVGHYSLHMYVNEKGERVFQREPFRKCHTSRSTRQFLDVFMETQMFAGFTQDR 896          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: nectin3 (poliovirus receptor-related 3 [Source:Xenbase;Acc:XB-GENE-963226])

HSP 1 Score: 53.5286 bits (127), Expect = 5.537e-7
Identity = 72/347 (20.75%), Postives = 123/347 (35.45%), Query Frame = 3
Query:  315 KLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRISE-FLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE 1337
            +LY+   SY PWFEI  K+L                N L      +   Y   P       I +              + + EY  A+           L+I+ SML ER +IF S++   LT  + A+   ++P+ W H  + ++P   P LL   C     ++G+H  +                                    +R K         +NV N+  ++   +  +   ++++ +   +  +  +  +   + F       R   A L G YR+ +    G    F    F  + S   + FL+  VN Q F  FID R+  + +   F D F+ E
Sbjct:    3 ELYVYFSSYLPWFEIYYKLL----------------NTLADYLVKEQHSYFITPDVTGLPTIPE-------------SRNLTEYFVAVDVNN------MLQIYASMLHERRIIFTSRKLSTLTACVHASASLLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGVHLSL-----------------------------------MERVKSRSLDDVVILNVDNNSLETPFNDLCLLPSDVVATLKSKLKKQSTSTGDGVSRAF------LRAQ-ASLFGSYRDALRYKPGEPVTFCEESFVCHRSNTMKLFLETAVNLQLFKQFIDSRLEKLNSGRGFTDLFEEE 269          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: acsl4 (acyl-CoA synthetase long-chain family member 4 [Source:Xenbase;Acc:XB-GENE-5966957])

HSP 1 Score: 53.5286 bits (127), Expect = 1.558e-6
Identity = 57/234 (24.36%), Postives = 102/234 (43.59%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGM-NCCMLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSV---DDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT----ESEGVCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDER 1286
            L +F ++L E  V+F S  FQ+L+ +  A    I+PL + +  + I+P +  E+L      ++G+H  + P  ++ + W + ++ DLD       GG     E     ++P+ +       L+ V   D  V+  +   +R   +++P    DKE            V ++  R    I  G YR C+      +E V  F +  F      I ++FL  ++N   F  F+ ER
Sbjct:  209 LSLFCAVLTENKVLFHSSSFQRLSDACRALEALIYPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVVYPRFNQCNEWLDVIIADLD-------GGTIKIPECVHLSQIPEPLLHQTQAALSHVLHPDLEVADYAFAPLR---TSLP---HDKE------------VRAVFLRLFAQIFQG-YRSCLQLIRIHAEPVIHFHKAAFLGQRGLIENDFLTKVLNGMAFAGFVSER 416          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd1b (DENN/MADD domain containing 1B [Source:MGI Symbol;Acc:MGI:2447812])

HSP 1 Score: 86.2705 bits (212), Expect = 6.362e-17
Identity = 99/412 (24.03%), Postives = 161/412 (39.08%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-----KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKK-----GFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE 1337
            +F D   L    +F FP D  R       + +T V+++  + + F  CR     ++ LCI SY PWFE+  K+L  L +    +    ++  LK +Y          P   +N  +N     C +       P I + + + EY  A+      +    L ++ SML ER +I  S +   LT  L  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP    N +S++P ++      + N+ KK     G  V     R   A L G YR+ +    G    F    F ++ S +  +FL+  VN Q F  FID R+A +     F+D F+ E
Sbjct:   38 DFGDQEVLQSVPKFCFPFDVERVSQNQVGQHFTFVLTDMESKQRFGFCRLTSGGRICLCILSYLPWFEVYYKLLNTLADYLAKELEEDLNETLKSLY--------NHPVPKANTPVNLSVHSCFITPDITGLPTIPESRNLTEYFVAV------DVNNMLRLYASMLHERRIIITSSKLSTLTACLHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVVLNV-----DTNTLESPF---NDLSSLPSDV---VSALKNKLKKQSTATGDGVARAFLRAQ-AALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAVNLQLFKQFIDGRLAKLNAGRGFSDIFEEE 385          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd1b (DENN/MADD domain containing 1B [Source:MGI Symbol;Acc:MGI:2447812])

HSP 1 Score: 76.6406 bits (187), Expect = 6.651e-14
Identity = 93/383 (24.28%), Postives = 146/383 (38.12%), Query Frame = 3
Query:  285 FLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-----KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKK-----GFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDKRSFR 1376
            F  CR     ++ LCI SY PWFE+  K+L  L +    +    ++  LK +Y          P   +N  +N     C +       P I + + + EY  A+      +    L ++ SML ER +I  S +   LT  L  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP    N +S++P    D    + N+ KK     G  V     R   A L G YR+ +    G    F    F ++ S +  +FL+  VN Q F  FID R+A +     F+D F+ E     F     RS++
Sbjct:    7 FGFCRLTSGGRICLCILSYLPWFEVYYKLLNTLADYLAKELEEDLNETLKSLY--------NHPVPKANTPVNLSVHSCFITPDITGLPTIPESRNLTEYFVAV------DVNNMLRLYASMLHERRIIITSSKLSTLTACLHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVVLNV-----DTNTLESPF---NDLSSLP---SDVVSALKNKLKKQSTATGDGVARAFLRAQ-AALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAVNLQLFKQFIDGRLAKLNAGRGFSDIFEEEITSGGFCGGSPRSYQ 325          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd1b (DENN/MADD domain containing 1B [Source:MGI Symbol;Acc:MGI:2447812])

HSP 1 Score: 72.7886 bits (177), Expect = 3.352e-13
Identity = 59/231 (25.54%), Postives = 98/231 (42.42%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-----KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCM 815
            +F D   L    +F FP D  R       + +T V+++  + + F  CR     ++ LCI SY PWFE+  K+L  L +    +    ++  LK +Y          P   +N  +N     C +       P I + + + EY  A+           L ++ SML ER +I  S +   LT  L  +   ++P+ W H  + ++P   P LL   C     ++GIH  +
Sbjct:   38 DFGDQEVLQSVPKFCFPFDVERVSQNQVGQHFTFVLTDMESKQRFGFCRLTSGGRICLCILSYLPWFEVYYKLLNTLADYLAKELEEDLNETLKSLY--------NHPVPKANTPVNLSVHSCFITPDITGLPTIPESRNLTEYFVAVDVNN------MLRLYASMLHERRIIITSSKLSTLTACLHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL 251          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd1a (DENN/MADD domain containing 1A [Source:MGI Symbol;Acc:MGI:2442794])

HSP 1 Score: 67.781 bits (164), Expect = 4.033e-11
Identity = 87/416 (20.91%), Postives = 168/416 (40.38%), Query Frame = 3
Query:  156 CLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQY-LKCSLKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKFTEY--NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
            C   +VDS ++SQ               + +T V+++  + + F  CR     K   CI SY PWFE+  K+L  L +       S+ +  L+ ++ L   D    P  + +  ++  + +  S + P I + + + EY  A+      +    L ++ SML ER ++ +  +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +   ++KV     ++ +++++D                         + T F ++ +  +D +S      ++N +  +     D     + + +  F               G YR  +  E E    F    F  +  +  + +FL+     Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   54 CFPFYVDSLTVSQV-------------GQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYKLLNILADYTTKRQESQWNELLETLHRLPIPD----PGVSVHLSVHSYFTVPDSRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRILIICSKLSTLTACIHGSAAMLYPMYWQHVYIPVLP---PHLLDYCCAPMPYLIGIHLSL---MEKVRNMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVIS-----SLKNRLKKVSTTTGDGVARAFLKAQAAF--------------FGSYRNALKIEPEEPITFSEEAFVSHYRSGAMKQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDK 399          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd2d (DENN/MADD domain containing 2D [Source:MGI Symbol;Acc:MGI:2181193])

HSP 1 Score: 61.6178 bits (148), Expect = 2.178e-9
Identity = 60/233 (25.75%), Postives = 99/233 (42.49%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIH-RCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDD-KEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKFTEYNSRISE--FLKLLVNSQCFNSFIDE 1283
            ++IF S +LER +IF+++    L+  + AA   ++P SW H  + ++P+    LL   CC    M+G+  R ++ ++D      E LLV+L EG                         TF +    SV D      P    +I+ ++   I++ K     NE+  G       F       +GHY   I  E+ G   F    F +  +  ++  F+K  V +Q F+ FI E
Sbjct:  252 IQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYPFSWAHTYIPVVPES---LLATVCCPTPFMVGVQMRFLQEVMDSP--MEEVLLVNLCEG-------------------------TFLL----SVGDEKDILPPKLQDDILDSLGQGINELKTSEQINEHVSG------PFVQFFVKTVGHYASYIKREASGQGHFQERSFCKAVTSKTKRRFVKKFVKTQLFSLFIQE 444          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3U1T9|DEN1B_MOUSE (DENN domain-containing protein 1B OS=Mus musculus OX=10090 GN=Dennd1b PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 4.450e-16
Identity = 99/412 (24.03%), Postives = 161/412 (39.08%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-----KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKK-----GFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE 1337
            +F D   L    +F FP D  R       + +T V+++  + + F  CR     ++ LCI SY PWFE+  K+L  L +    +    ++  LK +Y          P   +N  +N     C +       P I + + + EY  A+      +    L ++ SML ER +I  S +   LT  L  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP    N +S++P ++      + N+ KK     G  V     R   A L G YR+ +    G    F    F ++ S +  +FL+  VN Q F  FID R+A +     F+D F+ E
Sbjct:   38 DFGDQEVLQSVPKFCFPFDVERVSQNQVGQHFTFVLTDMESKQRFGFCRLTSGGRICLCILSYLPWFEVYYKLLNTLADYLAKELEEDLNETLKSLY--------NHPVPKANTPVNLSVHSCFITPDITGLPTIPESRNLTEYFVAV------DVNNMLRLYASMLHERRIIITSSKLSTLTACLHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVVLNV-----DTNTLESPF---NDLSSLPSDV---VSALKNKLKKQSTATGDGVARAFLRAQ-AALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAVNLQLFKQFIDGRLAKLNAGRGFSDIFEEE 385          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P3S1|DEN1B_HUMAN (DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.370e-13
Identity = 96/441 (21.77%), Postives = 171/441 (38.78%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNS--NDKINQQ-YLKCS--------------------LKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMK-IRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNSRI-SEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDKRSFR 1376
            +F D   L    +F FP D  R       + +T V+++  + + F  CR      + LCI SY PWFE+  K+L  L +    +  + ++  L+ +Y         +P  N+  N  +NQ+ ++ C                        P I + + + EY  A+      +    L+++ SML ER ++ +S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +                                    +R K         +NV     D+ +  SP   + N+ S++   + +K +        G    +  F    A L G YR+ +    G    F    F ++ S +  +FL+  +N Q F  FID R+A +     F+D F+ E     F   + RS++
Sbjct:   38 DFGDQEILQSVPKFCFPFDVERVSQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKLLNTLADYLAKELENDLNETLRSLY------NHPVPKANTPVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEYFVAV------DVNNMLQLYASMLHERRIVIISSKLSTLTACIHGSAALLYPMYWQHIYIPVLP---PHLLDYCCAPMPYLIGIHSSL-----------------------------------IERVKNKSLEDVVMLNV-----DTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQLFKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGNPRSYQ 420          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K382|DEN1A_MOUSE (DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 2.821e-10
Identity = 87/416 (20.91%), Postives = 168/416 (40.38%), Query Frame = 3
Query:  156 CLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQY-LKCSLKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKFTEY--NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
            C   +VDS ++SQ               + +T V+++  + + F  CR     K   CI SY PWFE+  K+L  L +       S+ +  L+ ++ L   D    P  + +  ++  + +  S + P I + + + EY  A+      +    L ++ SML ER ++ +  +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +   ++KV     ++ +++++D                         + T F ++ +  +D +S      ++N +  +     D     + + +  F               G YR  +  E E    F    F  +  +  + +FL+     Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   54 CFPFYVDSLTVSQV-------------GQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYKLLNILADYTTKRQESQWNELLETLHRLPIPD----PGVSVHLSVHSYFTVPDSRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRILIICSKLSTLTACIHGSAAMLYPMYWQHVYIPVLP---PHLLDYCCAPMPYLIGIHLSL---MEKVRNMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVIS-----SLKNRLKKVSTTTGDGVARAFLKAQAAF--------------FGSYRNALKIEPEEPITFSEEAFVSHYRSGAMKQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDK 399          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TEH3|DEN1A_HUMAN (DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 5.359e-9
Identity = 89/418 (21.29%), Postives = 170/418 (40.67%), Query Frame = 3
Query:  156 CLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYS--RIDNYLKQIYCLDNKDYVTLPACNSNDKINQQY-LKCSLKFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKFTEY--NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
            C   +VDS ++SQ               + +T V+++  + + F  CR     K   CI SY PWFE+  K LLN+     L +Y+  R +N   ++    +K  +  P  + +  ++  + +  + + P I + + + EY  A+      +    L ++ SML ER ++ +  +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++GIH  +   ++KV     ++ +++++D                         + T F ++ +  +D +S      ++N +  +     D                +  F    A   G YR  +  E E    F    F  +  +  + +FL+     Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   54 CFPFYVDSLTVSQV-------------GQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYK-LLNI-----LADYTTKRQENQWNELLETLHKLPIPDPGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRILIICSKLSTLTACIHGSAAMLYPMYWQHVYIPVLP---PHLLDYCCAPMPYLIGIHLSL---MEKVRNMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVIS-----SLKNRLKKVSTTTGDG--------------VARAFLKAQAAFFGSYRNALKIEPEEPITFCEEAFVSHYRSGAMRQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDK 399          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H6A0|DEN2D_HUMAN (DENN domain-containing protein 2D OS=Homo sapiens OX=9606 GN=DENND2D PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 1.299e-8
Identity = 64/236 (27.12%), Postives = 99/236 (41.95%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIH-RCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDD-KEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKF-----TEYNSRISEFLKLLVNSQCFNSFIDE 1283
            L+IF S +LER +IF+++    L+  + AA   ++P SW H  + ++P+    LL   CC    M+G+  R  + ++D      E LLV+L EG                         TF    L SV D      P    +I+ ++   I++ K     NE+  G       F      ++GHY   I  E+ G   F    F     ++ N R   F+K  V +Q F+ FI E
Sbjct:  245 LQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYPFSWAHTYIPVVPES---LLATVCCPTPFMVGVQMRFQQEVMD--SPMEEVLLVNLCEG-------------------------TF----LMSVGDEKDILPPKLQDDILDSLGQGINELKTAEQINEHVSG------PFVQFFVKIVGHYASYIKREANGQGHFQERSFCKALTSKTNRR---FVKKFVKTQLFSLFIQE 437          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A4S2LRX5 (UDENN domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005264 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 8.575e-24
Identity = 103/384 (26.82%), Postives = 170/384 (44.27%), Query Frame = 3
Query:  189 SQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFL--DNYSRIDNYLKQIYCLDNK----DYVTLPACNSNDKINQQYLKCSLKFPFIYD------KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRC-MKPILDKVDYWNEALLVDLDEGESRMVGGCDN-EKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN--SRISEFLKLLVNSQCFNSFIDERI 1289
            S+  EF F C   +   E + IV ++   +  F+ C + ++ +L LCI S  PW      +L  +  +E      +     +L ++          DYVT   C     +N+      LKF           KY+ EY  A+      +  LW+ +F  ++LER V+F SKR  +LT  ++AA+  +HPL WVH    +IPKK  E+LG     + GIH C ++  ++ V+  +   +VDLD G   +    ++ E ++   F  PK +  F    L  +   +  NS M++ N  S+  W   D E   +      F   +  F  +IA L+G Y +CI  + G  + D +          +  F + L  +Q    F+D R+
Sbjct:   12 SRILEFGFSCCNEKKVGENFVIVFTDAQGTLEFVFCHWPNT-QLILCISSALPWCACFHGLLDIISRNELYRESRWPAFQPFLSRLLSTRPPPQPIDYVT---CQDPFSVNRH-----LKFRIPSSNSPHNLKYVMEYYNAL------DVSLWIHVFVCLILERSVLFYSKRLSRLTACVIAAVSLLHPLQWVHSFYPLIPKKVIEVLGCPAPFVAGIHSCNLQAAMEHVN--SGTCVVDLDAGRINLYQSSESTENDSDGEFATPKAVYEFLRRHLKDLQRQL--NSAMRL-NKASDSNWKRVDGEACQF------FEQLTKPFFYMIANLLGCYSDCIVNNRGSPEVDIDLLIARQKCPGLEPFFRTLCEAQAVQLFLDGRV 369          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A4S2LS09 (UDENN domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005264 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 9.894e-24
Identity = 103/384 (26.82%), Postives = 170/384 (44.27%), Query Frame = 3
Query:  189 SQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFL--DNYSRIDNYLKQIYCLDNK----DYVTLPACNSNDKINQQYLKCSLKFPFIYD------KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRC-MKPILDKVDYWNEALLVDLDEGESRMVGGCDN-EKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN--SRISEFLKLLVNSQCFNSFIDERI 1289
            S+  EF F C   +   E + IV ++   +  F+ C + ++ +L LCI S  PW      +L  +  +E      +     +L ++          DYVT   C     +N+      LKF           KY+ EY  A+      +  LW+ +F  ++LER V+F SKR  +LT  ++AA+  +HPL WVH    +IPKK  E+LG     + GIH C ++  ++ V+  +   +VDLD G   +    ++ E ++   F  PK +  F    L  +   +  NS M++ N  S+  W   D E   +      F   +  F  +IA L+G Y +CI  + G  + D +          +  F + L  +Q    F+D R+
Sbjct:   42 SRILEFGFSCCNEKKVGENFVIVFTDAQGTLEFVFCHWPNT-QLILCISSALPWCACFHGLLDIISRNELYRESRWPAFQPFLSRLLSTRPPPQPIDYVT---CQDPFSVNRH-----LKFRIPSSNSPHNLKYVMEYYNAL------DVSLWIHVFVCLILERSVLFYSKRLSRLTACVIAAVSLLHPLQWVHSFYPLIPKKVIEVLGCPAPFVAGIHSCNLQAAMEHVN--SGTCVVDLDAGRINLYQSSESTENDSDGEFATPKAVYEFLRRHLKDLQRQL--NSAMRL-NKASDSNWKRVDGEACQF------FEQLTKPFFYMIANLLGCYSDCIVNNRGSPEVDIDLLIARQKCPGLEPFFRTLCEAQAVQLFLDGRV 399          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A504YN36 (UDENN domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_05941 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.165e-23
Identity = 108/386 (27.98%), Postives = 176/386 (45.60%), Query Frame = 3
Query:  201 EFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDN--YSRIDNYLKQIYCLD----NKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRCMKPILDKVDYWNEA-LLVDLDEGESRMVGGCDNEKETA-KRFKVPKFIRTFFINVLNSVDDSVS---QNSPMKIRNIISNIPWNIDDKEETMY-NEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNS--RISEFLKLLVNSQCFNSFIDERIALILNNET 1313
            EF F C   +   EE+ IV ++   S  ++ C    +    LCI S  PW      +L  +  +E   +  +S ++  L ++        +  YVT P   + D+ + ++   + +FP    KY+ EY  ++      +  LW+ +F  +LLER V+F S R  +LT  +LAA+  ++PL WVH    IIP+K  ++L      + GIH C  P  D +D+ +    LVDLD+G+  +  G DN      + F  PK +  F  + L  V + +    Q+   K  N      W   D E   + ++  + F      FR LI  L+G Y +CI E+ G+ + D +      S   +  F++ L  SQ    F+D R   I +  T
Sbjct:   50 EFGFACCNEKRVGEEFVIVFTDQTGSLEYVFC-LCPNESYILCISSALPWCSCFRALLDIIWRNELYQDARWSTLETMLTRLMHTAPPPLSVSYVTCPDPFNIDR-DLKFRIPTPRFPHTL-KYVMEYYNSL------DTSLWIHVFVCLLLERSVLFFSDRLTRLTSCILAAVSLLYPLQWVHSFYPIIPRKVIQVLECPVPFVAGIHACSLP--DALDHLSSGTCLVDLDKGQMTIFRGPDNLHSVRLEDFSTPKAVYHFLSHQLKDVQNQLGDAMQSKKSKYAN------WKRVDGETCAFLDQLTRPF------FR-LIVNLLGCYPDCIVENLGIPEVDVDALVACQSCPGLESFMRNLCESQTVRLFLDNRARQIPDPST 411          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A4E0R7A3 (UDENN domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_006556 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.166e-23
Identity = 108/386 (27.98%), Postives = 176/386 (45.60%), Query Frame = 3
Query:  201 EFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDN--YSRIDNYLKQIYCLD----NKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRCMKPILDKVDYWNEAL-LVDLDEGESRMVGGCDNEKETA-KRFKVPKFIRTFFINVLNSVDDSVS---QNSPMKIRNIISNIPWNIDDKEETMY-NEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNS--RISEFLKLLVNSQCFNSFIDERIALILNNET 1313
            EF F C   +   EE+ IV ++   S  ++ C    +    LCI S  PW      +L  +  +E   +  +S ++  L ++        +  YVT P   + D+ + ++   + +FP    KY+ EY  ++      +  LW+ +F  +LLER V+F S R  +LT  +LAA+  ++PL WVH    IIPKK  ++L      + GIH C  P  + +D+ +    LVDLD+G+  +  G DN      + F  PK +  F  + L  V + +    Q+   K  N      W   D E   + ++  + F      FR LI  L+G Y +CI E+ G+ + D +      S   +  F++ L  SQ    F+D R   I +  T
Sbjct:   50 EFGFACCNEKRVGEEFVIVFTDQTGSLEYVFC-LCPNESYILCISSALPWCSCFRALLDIIWRNELYQDARWSTLETMLTRLMHTAPPPLSVSYVTCPDPFNIDR-DLKFRIPTPRFPHTL-KYVMEYYNSL------DTSLWIHVFVCLLLERSVLFFSDRLTRLTSCILAAVSLLYPLQWVHSFYPIIPKKVIQVLECPVPFVAGIHACSLP--EALDHLSSGTCLVDLDKGQMTIFRGPDNLHSVRLEDFSTPKAVYHFLSHQLKDVQNQLGDAMQSKKSKYAN------WKRVDGETCAFLDQLTRPF------FR-LIVNLLGCYPDCIVENLGIPEVDLDALVACQSCPGLESFMRNLCESQTVRLFLDNRARQIPDPST 411          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A075AJT1 (UDENN domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00359 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 5.555e-23
Identity = 97/363 (26.72%), Postives = 162/363 (44.63%), Query Frame = 3
Query:  222 CPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFL--DNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRC-MKPILDKVDYWNEALLVDLDEGESRMVGGCDN-EKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYN--SRISEFLKLLVNSQCFNSFIDERI 1289
            C +   E + IV ++   +  F+ C + ++ +L LCI S  PW      +L  +  +E      +     +L ++         T P     D     Y+ C   F  +  KY+ EY  A+      +  LW+ +F  ++LER V+F SKR  +LT  ++AA+  +HPL WVH    +IPKK  E+LG     + GIH C ++  ++ V+  +   +VDLD G   +    ++ E ++   F  PK +  F    L  +   +  NS M++ N   +  W   D E   +      F   +  F  +IA L+G Y +CI  + G  + D +          +  FL+ L  SQ    F+D R+
Sbjct:   38 CRKKVGENFVIVFTDAQGTLEFVFCHWPNT-QLILCISSALPWCACFHGLLDIISRNELYRESRWPAFQPFLSRLLS-------TRPPPQPID-----YVTCQDPF-SVNRKYVMEYYNAL------DVSLWIHVFVCLILERSVLFYSKRLSRLTACVIAAVSLLHPLQWVHSFYPLIPKKVIEVLGCPAPFVAGIHSCNLQAAMEHVN--SGTCVVDLDAGRINLYQSSESTENDSDGEFATPKAVYEFLRRHLKDLQRQL--NSAMRL-NKAPDSNWKRVDGEACQF------FEQLTKPFFYMIANLLGCYSDCIVNNGGSPEVDIDLLIARQKCPGLEPFLRTLCESQTVQLFLDGRV 369          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd1b (DENN domain containing 1B [Source:NCBI gene;Acc:103039833])

HSP 1 Score: 81.6481 bits (200), Expect = 1.503e-15
Identity = 96/420 (22.86%), Postives = 173/420 (41.19%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCD----CPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWN--EALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEY-NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKE--FVFQDKRSFR 1376
            +F D   L    +F FP      C     + +T V+++  + + F  CR     K+ +C+ SY PWFEI  K+L  L +       S +++ L++++ L     V  P    N  ++  ++   +   P I + + + EY  A+      +    L ++ SML ER +I  S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++G+H  +   L++V   +  + +++++D                               N L +  D +  N P    +++S +      K +        G  V     R+  A L G YR+ +    G    F    F  + +S +  FL++ VN Q F  FID R+A +     F D F+ E  E  F   + RS++
Sbjct:   38 DFGDQEVLQTVPKFCFPFAVERVCQNQVGQNFTFVLTDIDSKQRFGFCRLTSGCKVCICLLSYLPWFEIYYKLLNTLADYLTKQQESSLNDMLEKLHALP----VPKPNTPVNLSVHSYFIAPDINGLPTIPESRNLTEYFVAV------DVNNMLHLYASMLHERRIIITSSKLSTLTACVHGSAAMLYPMHWQHIYIPVLP---PHLLDYCCAPMPYLIGVHLSL---LERVKSRSLEDVVILNVD------------------------------TNTLETPTDDL-HNLPG---DVVSGL------KSKLKKQSTATGSGVARAFLRSQ-AALFGSYRDALRYKPGEPITFCEESFVAHRSSTMRTFLEMAVNLQLFKQFIDGRLAKLNAGRGFTDIFEEEITEGGFCGSNSRSYQ 400          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd1b (DENN domain containing 1B [Source:NCBI gene;Acc:103039833])

HSP 1 Score: 81.2629 bits (199), Expect = 1.859e-15
Identity = 96/420 (22.86%), Postives = 173/420 (41.19%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCD----CPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWN--EALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEY-NSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKE--FVFQDKRSFR 1376
            +F D   L    +F FP      C     + +T V+++  + + F  CR     K+ +C+ SY PWFEI  K+L  L +       S +++ L++++ L     V  P    N  ++  ++   +   P I + + + EY  A+      +    L ++ SML ER +I  S +   LT  +  +   ++P+ W H  + ++P   P LL   C     ++G+H  +   L++V   +  + +++++D                               N L +  D +  N P    +++S +      K +        G  V     R+  A L G YR+ +    G    F    F  + +S +  FL++ VN Q F  FID R+A +     F D F+ E  E  F   + RS++
Sbjct:   38 DFGDQEVLQTVPKFCFPFAVERVCQNQVGQNFTFVLTDIDSKQRFGFCRLTSGCKVCICLLSYLPWFEIYYKLLNTLADYLTKQQESSLNDMLEKLHALP----VPKPNTPVNLSVHSYFIAPDINGLPTIPESRNLTEYFVAV------DVNNMLHLYASMLHERRIIITSSKLSTLTACVHGSAAMLYPMHWQHIYIPVLP---PHLLDYCCAPMPYLIGVHLSL---LERVKSRSLEDVVILNVD------------------------------TNTLETPTDDL-HNLPG---DVVSGL------KSKLKKQSTATGSGVARAFLRSQ-AALFGSYRDALRYKPGEPITFCEESFVAHRSSTMRTFLEMAVNLQLFKQFIDGRLAKLNAGRGFTDIFEEEITEGGFCGSNSRSYQ 400          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd1a (DENN domain containing 1A [Source:NCBI gene;Acc:103038658])

HSP 1 Score: 72.7886 bits (177), Expect = 9.498e-13
Identity = 85/388 (21.91%), Postives = 159/388 (40.98%), Query Frame = 3
Query:  237 SEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLK-FPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKF-TEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
             + +T V+++  + + F  CR     +   CI SY PWFE+  K+L  L +       S+    L+ ++ L     +  P    +  ++  +    L+  P I + + + EY  A+      +    L ++ SML ER V+  S +   LT  +  A   ++P+ W H  + ++P+    LL   C     ++G+H  +   ++KV     ++ +++++D                         + T F ++ +  +D VS      ++N +  +     D                +  F    A L G YR  +  E E    F  + F T  +S + +FL+  +  Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   68 GQNFTFVLTDIDSKQRFGFCRLSSGVQSCYCILSYLPWFEVFYKLLNVLADYTIKGQESQWRELLESLHSLP----IPEPGVPVHLSVHAYFSVPDLRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRVLISSSKLSTLTACVHGAAAMLYPMYWQHVYIPVLPQ---HLLDYCCAPMPYLIGVHSSL---MEKVRGMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVVS-----SLKNRLKKVSTTTGDG--------------VARAFLKAQASLFGSYRSALRIEPEEPITFSEDAFITHRSSTMRQFLQNAIQLQLFKQFIDGRLELLNSGEGFSDVFEEEINMGEYAGSDK 398          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd1a (DENN domain containing 1A [Source:NCBI gene;Acc:103038658])

HSP 1 Score: 72.4034 bits (176), Expect = 1.155e-12
Identity = 85/388 (21.91%), Postives = 159/388 (40.98%), Query Frame = 3
Query:  237 SEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLK-FPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKF-TEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
             + +T V+++  + + F  CR     +   CI SY PWFE+  K+L  L +       S+    L+ ++ L     +  P    +  ++  +    L+  P I + + + EY  A+      +    L ++ SML ER V+  S +   LT  +  A   ++P+ W H  + ++P+    LL   C     ++G+H  +   ++KV     ++ +++++D                         + T F ++ +  +D VS      ++N +  +     D                +  F    A L G YR  +  E E    F  + F T  +S + +FL+  +  Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   68 GQNFTFVLTDIDSKQRFGFCRLSSGVQSCYCILSYLPWFEVFYKLLNVLADYTIKGQESQWRELLESLHSLP----IPEPGVPVHLSVHAYFSVPDLRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRVLISSSKLSTLTACVHGAAAMLYPMYWQHVYIPVLPQ---HLLDYCCAPMPYLIGVHSSL---MEKVRGMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVVS-----SLKNRLKKVSTTTGDG--------------VARAFLKAQASLFGSYRSALRIEPEEPITFSEDAFITHRSSTMRQFLQNAIQLQLFKQFIDGRLELLNSGEGFSDVFEEEINMGEYAGSDK 398          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd1a (DENN domain containing 1A [Source:NCBI gene;Acc:103038658])

HSP 1 Score: 72.0182 bits (175), Expect = 1.652e-12
Identity = 85/388 (21.91%), Postives = 159/388 (40.98%), Query Frame = 3
Query:  237 SEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLK-FPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVD--YWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECIT-ESEGVCKFDRNKF-TEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRE--RKEFVFQDK 1364
             + +T V+++  + + F  CR     +   CI SY PWFE+  K+L  L +       S+    L+ ++ L     +  P    +  ++  +    L+  P I + + + EY  A+      +    L ++ SML ER V+  S +   LT  +  A   ++P+ W H  + ++P+    LL   C     ++G+H  +   ++KV     ++ +++++D                         + T F ++ +  +D VS      ++N +  +     D                +  F    A L G YR  +  E E    F  + F T  +S + +FL+  +  Q F  FID R+ L+ + E F+D F+ E    E+   DK
Sbjct:   68 GQNFTFVLTDIDSKQRFGFCRLSSGVQSCYCILSYLPWFEVFYKLLNVLADYTIKGQESQWRELLESLHSLP----IPEPGVPVHLSVHAYFSVPDLRELPSIPENRNLTEYFVAV------DVNNMLHLYASMLYERRVLISSSKLSTLTACVHGAAAMLYPMYWQHVYIPVLPQ---HLLDYCCAPMPYLIGVHSSL---MEKVRGMALDDVVILNVDT----------------------NTLETPFDDLQSLPNDVVS-----SLKNRLKKVSTTTGDG--------------VARAFLKAQASLFGSYRSALRIEPEEPITFSEDAFITHRSSTMRQFLQNAIQLQLFKQFIDGRLELLNSGEGFSDVFEEEINMGEYAGSDK 398          
BLAST of UDENN domain-containing protein vs. Ensembl Nematostella
Match: EDO42638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0T9])

HSP 1 Score: 64.3142 bits (155), Expect = 7.868e-12
Identity = 57/199 (28.64%), Postives = 91/199 (45.73%), Query Frame = 3
Query:  246 YTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVL---LNLCNSEFLDNYSRIDNYLKQIYCLDNKDY-VTLPACNSNDKINQQYLKCS---LKFPFI-YDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIH 806
            YT V+++      F  CRY  + K  LCI SY PWFEI   +L    +L  S   +  S ++ ++K+        + +T P         +QY   S   +K P I  ++ + +Y  A++       Q  + +F SM  ER +I  SK+   LT     A+  ++P+ W H  V I+P   P LL   C     ++G+H
Sbjct:    3 YTFVLTDIQGQYRFGFCRYSPNVKSCLCILSYLPWFEIFYDLLNKISDLIRSSTDEVVSLLNAFVKEPLPKPGTPFTITAPG------TTKQYTYTSPDPMKLPTIPANRNLTDYYAAVE------PQNMITMFISMFFERRIIITSKKLNVLTACCYGAMSLLYPMHWQHMFVPIVP---PHLLDYCCAPMPFLVGVH 186          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd1b (DENN domain containing 1B [Source:NCBI gene;Acc:101167442])

HSP 1 Score: 73.9442 bits (180), Expect = 4.491e-13
Identity = 94/420 (22.38%), Postives = 167/420 (39.76%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSL-KFPFIYD-KYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML----GIHRCMKPILDKVDYWN--EALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNS-RISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKE--FVFQDKRSFR 1376
            +  D   L    +F FP D  R       + +T V+++  + + F  CR     ++ +C+ SY PWFEI  K+L  L +       + +++ L  +Y L     V  P    N  ++  ++   +   P I + + + EY  A+      +    L+++ SML ER +I  S +   LT  +  A   + P+ W H  + ++P   P LL   C  +    G+H     +L++V   +  + +++++D                               N L +  D         + N+ S++  ++  K +        G    +  F    A L G YR+ +    G    F    F  + S  +  FL + VN Q F  FID R+A +     F D F+ E  E  F   + RS++
Sbjct:   38 DHTDQEVLQTLPKFCFPFDVERVSQNQVGQNFTFVLTDIDSKQRFGFCRLTQGCRVCICLLSYLPWFEIYYKLLNTLADYLTKHQENDLNDMLNSLYELP----VPKPFTPVNLSVHSYFIAPDINGLPTIPESRNLTEYFVAV------DINNMLQLYASMLHERRIIITSSKLSTLTACVHGAAALLFPMYWQHIFIPVLP---PHLLDYCCAPMPYFVGVHLS---LLERVRSRSLEDVIILNVD------------------------------TNTLETPFDD--------LHNLPSDVMSSLKSKLKKQSTATGSGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVNHRSTTMKNFLSMAVNLQLFKQFIDGRLAKLNAGRGFTDVFEEEITEGGFCGSNSRSYQ 400          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd2b (DENN domain containing 2B [Source:NCBI gene;Acc:101161714])

HSP 1 Score: 72.0182 bits (175), Expect = 1.887e-12
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     +L + CC    ++G+     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S               D + +  YN       + S  F       IGHY   IT++E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  884 IRVFASLLLERRVIFVADKLSTLSSCMHAVVALLYPFSWQHTFIPVLPGS---MLDIVCCPTPFLVGLLSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQALEQRNDIINQDS---------------DSESDDEYNSLN---SLVSEAFIRFFLETIGHYSLFITQNERGERVFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1086          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd2b (DENN domain containing 2B [Source:NCBI gene;Acc:101161714])

HSP 1 Score: 72.0182 bits (175), Expect = 1.887e-12
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     +L + CC    ++G+     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S               D + +  YN       + S  F       IGHY   IT++E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  884 IRVFASLLLERRVIFVADKLSTLSSCMHAVVALLYPFSWQHTFIPVLPGS---MLDIVCCPTPFLVGLLSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQALEQRNDIINQDS---------------DSESDDEYNSLN---SLVSEAFIRFFLETIGHYSLFITQNERGERVFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1086          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd2b (DENN domain containing 2B [Source:NCBI gene;Acc:101161714])

HSP 1 Score: 72.0182 bits (175), Expect = 1.939e-12
Identity = 62/232 (26.72%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  612 LEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCC----MLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESE-GVCKFDRNKFTE--YNSRISEFLKLLVNSQCFNSFIDER 1286
            + +F S+LLER VIF++ +   L+  + A +  ++P SW H  + ++P     +L + CC    ++G+     P L ++    EAL+VDL  G  R +   D+E        +P+ ++      L   +D ++Q+S               D + +  YN       + S  F       IGHY   IT++E G   F R  F +   +  I  FL + + SQ F  FI +R
Sbjct:  862 IRVFASLLLERRVIFVADKLSTLSSCMHAVVALLYPFSWQHTFIPVLPGS---MLDIVCCPTPFLVGLLSSSLPKLKELPV-EEALMVDL--GTDRFIRQMDDEASL-----LPRKLQAALEQALEQRNDIINQDS---------------DSESDDEYNSLNS---LVSEAFIRFFLETIGHYSLFITQNERGERVFQREPFRKSVASKSIRRFLGVFMESQMFAGFIQDR 1064          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd1b (DENN domain containing 1B [Source:NCBI gene;Acc:101167442])

HSP 1 Score: 70.4774 bits (171), Expect = 4.843e-12
Identity = 98/440 (22.27%), Postives = 168/440 (38.18%), Query Frame = 3
Query:  165 NFVDSFSLSQYYEFIFPCDCPR----DKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQ-YLKCSL-------KFPFIY--------------DKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML----GIHRCMKPILDKVDYWN--EALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEG-VCKFDRNKFTEYNS-RISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKE--FVFQDKRSFR 1376
            +  D   L    +F FP D  R       + +T V+++  + + F  CR     ++ +C+ SY PWFEI  K+L  L +       + +++ L  +Y L     V  P    N  +N+Q Y+           K P  Y               + + EY  A+      +    L+++ SML ER +I  S +   LT  +  A   + P+ W H  + ++P   P LL   C  +    G+H     +L++V   +  + +++++D                               N L +  D         + N+ S++  ++  K +        G    +  F    A L G YR+ +    G    F    F  + S  +  FL + VN Q F  FID R+A +     F D F+ E  E  F   + RS++
Sbjct:   38 DHTDQEVLQTLPKFCFPFDVERVSQNQVGQNFTFVLTDIDSKQRFGFCRLTQGCRVCICLLSYLPWFEIYYKLLNTLADYLTKHQENDLNDMLNSLYELP----VPKPFTPVNLSVNEQLYIATGQVLRDQPSKEPHSYFIAPDINGLPTIPESRNLTEYFVAV------DINNMLQLYASMLHERRIIITSSKLSTLTACVHGAAALLFPMYWQHIFIPVLP---PHLLDYCCAPMPYFVGVHLS---LLERVRSRSLEDVIILNVD------------------------------TNTLETPFDD--------LHNLPSDVMSSLKSKLKKQSTATGSGV---ARAFLRAQAALFGSYRDALRYKPGEPITFCEESFVNHRSTTMKNFLSMAVNLQLFKQFIDGRLAKLNAGRGFTDVFEEEITEGGFCGSNSRSYQ 420          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000006606.1 (SMESG000006606.1)

HSP 1 Score: 1311.21 bits (3392), Expect = 0.000e+0
Identity = 664/667 (99.55%), Postives = 666/667 (99.85%), Query Frame = 3
Query:   72 MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDMFSKKLNTVINTKSEENLTRKGKISTMPAMKKNKIHKVSQMKKSSFYANPKAPXXXXXXXXXXXXXXXXXXXXXXFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE 2072
            MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCM+PIL KVDYWNEALLVDLDEGESRMVGGCDN+KETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDMFSKKLNTVINTKSEENLTRKGKISTMPAMKKNKIHKVSQMKKSSFYANPKAPSLSSSISSLNSLNSKNTKKKNSFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE
Sbjct:    1 MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCMEPILAKVDYWNEALLVDLDEGESRMVGGCDNQKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDMFSKKLNTVINTKSEENLTRKGKISTMPAMKKNKIHKVSQMKKSSFYANPKAPSLSSSISSLNSLNSKNTKKKNSFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE 667          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000006606.1 (SMESG000006606.1)

HSP 1 Score: 1234.17 bits (3192), Expect = 0.000e+0
Identity = 634/667 (95.05%), Postives = 636/667 (95.35%), Query Frame = 3
Query:   72 MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCMKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDMFSKKLNTVINTKSEENLTRKGKISTMPAMKKNKIHKVSQMKKSSFYANPKAPXXXXXXXXXXXXXXXXXXXXXXFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE 2072
            MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCM+PIL KVDYWNEALLVDLDEGESRMVGGCDN+KETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDM                              KNKIHKVSQMKKSSFYANPKAPSLSSSISSLNSLNSKNTKKKNSFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE
Sbjct:    1 MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCDCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCMEPILAKVDYWNEALLVDLDEGESRMVGGCDNQKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNSFIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDM------------------------------KNKIHKVSQMKKSSFYANPKAPSLSSSISSLNSLNSKNTKKKNSFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNSQITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGPPLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPLIPSEAYLLRTSPESKNE 637          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000026776.1 (SMESG000026776.1)

HSP 1 Score: 103.605 bits (257), Expect = 6.984e-23
Identity = 102/423 (24.11%), Postives = 192/423 (45.39%), Query Frame = 3
Query:  108 LFEGFSILQKSDDGIKCLFNFVDSFSLSQYYE--FIFPC-DCPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKVLLNLCNSEFL--DNYSRIDNYLKQIYCLDNKD---YVTLPACNSNDKINQQYLKCSLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRFQKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCML-GIHRC----MKPILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINVLNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFRTLIAILIGHYRECITESEGVCKFDRNKFTEYNSR---ISEFLKLLVNSQCFNSFIDERIALILNNETFNDRF 1328
            +F+ F IL +  +     F F +S S S   E  F+FPC +  + +   Y +V++    S++F+  RYI   ++ +   S +PWFEI+  ++ N+   +      + +++ YL  +  L + +      +PA N ND   +  +    +      K    +L ++  + +++   W+ +F  +LLER ++F S+   ++T  + A++  I PL WVH I   + + S   LG     + GIH C    + P+L+        L+V++DEG    V   D+     +   +P+ +  F     N  +  + Q   +K    ++N            ++    G       F   +A+L+G Y++C T +    ++  NK     SR   +  FL  L+ SQ  + F+D+RI  ++ N+T N  F
Sbjct:    1 MFKRFFILGRESENYD--FIFPNSISNSNILEQPFLFPCSNFEKYEHGTYVVVLTGISGSKNFITTRYIKEVQISIAFESDHPWFEIIYTIVNNVFKYQLYLRPKWGQLEKYLTDLLLLPHPEPGLVFYIPAANFNDTAVKIVVPMKSR-----QKPYSAFLKSLHKQLQFDD--WIIVFECLLLERWIVFHSRHLNRVTSCIFASLALIFPLEWVHLIFPCLSEGSINCLGCPSPFIAGIHSCFLDNVLPLLNP-----GTLIVNIDEGTLNFVA--DDNDVFNEDDHIPRSLANFLCRCYNDSESRLCQ--ALKYDKDLTN-----------AFDSVMNG-------FLNTMAVLLGKYKQCSTWNGD--RYVINKSILAQSRGDLLQPFLAKLIESQMVHQFLDDRINTVIPNKTENITF 385          
The following BLAST results are available for this feature:
BLAST of UDENN domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DENND1B3.682e-1522.30DENN domain containing 1B [Source:HGNC Symbol;Acc:... [more]
DENND1B2.854e-1421.77DENN domain containing 1B [Source:HGNC Symbol;Acc:... [more]
DENND1B3.630e-1421.83DENN domain containing 1B [Source:HGNC Symbol;Acc:... [more]
DENND1B4.120e-1124.24DENN domain containing 1B [Source:HGNC Symbol;Acc:... [more]
DENND1A6.744e-1120.43DENN domain containing 1A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rme-45.005e-722.99Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-45.005e-722.99Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG186593.440e-1822.87gene:FBgn0027561 transcript:FBtr0339371[more]
CG186593.440e-1822.87gene:FBgn0027561 transcript:FBtr0306381[more]
CG186595.097e-1822.76gene:FBgn0027561 transcript:FBtr0306382[more]
CG186591.161e-1722.62gene:FBgn0027561 transcript:FBtr0302498[more]
CG186592.810e-1722.14gene:FBgn0027561 transcript:FBtr0302497[more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd2b1.941e-1126.72DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
dennd2b2.004e-1126.72DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
dennd2b2.264e-1126.72DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
dennd2b2.461e-1126.72DENN domain containing 2B [Source:ZFIN;Acc:ZDB-GEN... [more]
si:dkey-76b14.21.467e-925.11si:dkey-76b14.2 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dennd2c1.399e-723.11DENN/MADD domain containing 2C [Source:NCBI gene;A... [more]
nectin35.537e-720.75poliovirus receptor-related 3 [Source:Xenbase;Acc:... [more]
acsl41.558e-624.36acyl-CoA synthetase long-chain family member 4 [So... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dennd1b6.362e-1724.03DENN/MADD domain containing 1B [Source:MGI Symbol;... [more]
Dennd1b6.651e-1424.28DENN/MADD domain containing 1B [Source:MGI Symbol;... [more]
Dennd1b3.352e-1325.54DENN/MADD domain containing 1B [Source:MGI Symbol;... [more]
Dennd1a4.033e-1120.91DENN/MADD domain containing 1A [Source:MGI Symbol;... [more]
Dennd2d2.178e-925.75DENN/MADD domain containing 2D [Source:MGI Symbol;... [more]
back to top
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3U1T9|DEN1B_MOUSE4.450e-1624.03DENN domain-containing protein 1B OS=Mus musculus ... [more]
sp|Q6P3S1|DEN1B_HUMAN1.370e-1321.77DENN domain-containing protein 1B OS=Homo sapiens ... [more]
sp|Q8K382|DEN1A_MOUSE2.821e-1020.91DENN domain-containing protein 1A OS=Mus musculus ... [more]
sp|Q8TEH3|DEN1A_HUMAN5.359e-921.29DENN domain-containing protein 1A OS=Homo sapiens ... [more]
sp|Q9H6A0|DEN2D_HUMAN1.299e-827.12DENN domain-containing protein 2D OS=Homo sapiens ... [more]
back to top
BLAST of UDENN domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LRX58.575e-2426.82UDENN domain-containing protein OS=Opisthorchis fe... [more]
A0A4S2LS099.894e-2426.82UDENN domain-containing protein OS=Opisthorchis fe... [more]
A0A504YN361.165e-2327.98UDENN domain-containing protein OS=Fasciola gigant... [more]
A0A4E0R7A33.166e-2327.98UDENN domain-containing protein OS=Fasciola hepati... [more]
A0A075AJT15.555e-2326.72UDENN domain-containing protein OS=Opisthorchis vi... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd1b1.503e-1522.86DENN domain containing 1B [Source:NCBI gene;Acc:10... [more]
dennd1b1.859e-1522.86DENN domain containing 1B [Source:NCBI gene;Acc:10... [more]
dennd1a9.498e-1321.91DENN domain containing 1A [Source:NCBI gene;Acc:10... [more]
dennd1a1.155e-1221.91DENN domain containing 1A [Source:NCBI gene;Acc:10... [more]
dennd1a1.652e-1221.91DENN domain containing 1A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO426387.868e-1228.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd1b4.491e-1322.38DENN domain containing 1B [Source:NCBI gene;Acc:10... [more]
dennd2b1.887e-1226.72DENN domain containing 2B [Source:NCBI gene;Acc:10... [more]
dennd2b1.887e-1226.72DENN domain containing 2B [Source:NCBI gene;Acc:10... [more]
dennd2b1.939e-1226.72DENN domain containing 2B [Source:NCBI gene;Acc:10... [more]
dennd1b4.843e-1222.27DENN domain containing 1B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000006606.10.000e+099.55SMESG000006606.1[more]
SMESG000006606.10.000e+095.05SMESG000006606.1[more]
SMESG000026776.16.984e-2324.11SMESG000026776.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034267 ID=SMED30034267|Name=UDENN domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2266bp
TTTTCTTTAAATTTTTTATTAGTAATTTATAAATAAAATAGAATTATTAT
AAAAGCCTGATTTTTGTACAAATGTTTCATTTAACATTAATGCAAAATAT
AACCCACCTGTTTGAGGGATTTTCAATTTTACAAAAATCTGACGATGGTA
TTAAATGCCTATTCAATTTCGTTGATAGTTTCAGTTTATCTCAATATTAC
GAATTTATTTTTCCATGCGATTGTCCAAGAGATAAATCAGAAGAATATAC
CATTGTTATCAGTAACACTTTTAACTCACGTTCTTTTCTCATTTGTCGTT
ATATTGATTCACATAAACTTTATTTGTGTATATATAGTTACAATCCGTGG
TTTGAAATTCTAAGTAAAGTCCTCTTGAATTTGTGTAACAGTGAATTTTT
GGATAATTATTCGCGAATTGATAATTATTTGAAACAAATTTATTGTCTCG
ATAACAAGGATTATGTAACATTGCCCGCTTGTAATTCGAATGATAAAATT
AATCAGCAATATCTCAAATGCAGCCTGAAATTTCCTTTCATTTACGACAA
ATATATACAAGAGTATTTGACTGCCATTAAGTCAAAGGCGAAATATAACA
AACAATTATGGCTGGAAATATTCTGGAGCATGTTATTGGAAAGACCTGTT
ATTTTCATGTCAAAAAGATTTCAGAAATTAACATACAGTTTATTAGCAGC
TATATTTTTTATTCATCCCCTCTCATGGGTTCACAAAATTGTTAGCATAA
TTCCAAAAAAGTCTCCTGAATTATTAGGAATGAATTGCTGTATGCTGGGC
ATTCATAGATGCATGAAACCTATTCTAGACAAAGTTGATTATTGGAATGA
AGCATTATTGGTTGATTTGGATGAAGGTGAATCGCGAATGGTTGGAGGGT
GCGACAATGAAAAGGAAACTGCAAAACGTTTCAAAGTCCCCAAATTTATA
AGAACTTTCTTTATAAATGTTCTCAACAGTGTTGATGACAGTGTTTCTCA
GAATTCCCCCATGAAAATCAGAAATATTATTTCCAATATTCCTTGGAACA
TTGATGACAAAGAAGAAACTATGTATAATGAATACAAGAAAGGATTTCAT
GTTTATTCATTATTATTTCGAACATTGATTGCAATTTTAATTGGTCACTA
TCGAGAATGCATTACGGAAAGTGAAGGAGTTTGTAAATTTGATAGGAATA
AGTTTACAGAATATAATTCAAGAATATCCGAATTTCTAAAACTGTTGGTC
AACAGTCAATGTTTCAATAGTTTCATTGATGAAAGAATAGCACTGATTTT
AAACAATGAAACATTTAATGACAGATTTGATCGCGAAAGAAAAGAATTTG
TGTTTCAGGACAAACGATCTTTCAGAATTCTTAAATTCGACATGTTTTCA
AAAAAATTAAATACTGTAATAAACACAAAATCAGAAGAAAATTTGACAAG
AAAAGGAAAAATATCTACGATGCCGGCGATGAAGAAAAATAAAATCCACA
AAGTCAGTCAAATGAAAAAATCAAGTTTCTATGCTAATCCCAAAGCGCCG
TCACTTTCTTCCAGCATTTCATCGCTTAACAGCTTGAATAGTAAAAATAC
CAAAAAGAAGAATTCATTCGATAATATATCAACTCAAAGTGAATCTCTCA
CATCCCAAGTGATCAAAGGTCTTCTGGATAAAAAAATATTTACACCATCC
AGTTTATTTAATCACAATTCTCAAATCACCCAAACTTCAATTACTGATAA
CAATTCAATCCCTAAAACTTCAGTAAATATTAATTCCAATGAAACAGTCA
AAAGAACTCCGGCAAGACCACCAGTTCCACCAATTATTAATAGATATTTT
CCAGAAAATAAACCCGGCCCACCTTTACCGAATAAATCCAAAGATATAAA
AAAAATTCCTACCGGATTGGTGAAAGATAGAATTCAAAATCTTAATAAAA
TTGACCAAGCAGTCAATTCAAATCGTCTACCATCACAGAGTGCAAGAGAA
AGATCACGCTCGATACCTTTGATACCTTCAGAGGCCTATTTATTAAGAAC
TTCGCCAGAATCTAAAAATGAAGGAAAAATATAAGTCTTTCAATTTATAA
TTTATAAACATTCTAATGAATGATAACAAGTACGATATGTAGTACATGAC
GCGTGGTTGAATGAAGCGAATGATAATTGCCTATGATAGAGATGTATTAG
AATGCCATATGAAATTTACCGTAATTCATGTGACACAATCCAATTGATGA
TGATGATGATGATGAT
back to top

protein sequence of SMED30034267-orf-1

>SMED30034267-orf-1 ID=SMED30034267-orf-1|Name=SMED30034267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=671bp
MFHLTLMQNITHLFEGFSILQKSDDGIKCLFNFVDSFSLSQYYEFIFPCD
CPRDKSEEYTIVISNTFNSRSFLICRYIDSHKLYLCIYSYNPWFEILSKV
LLNLCNSEFLDNYSRIDNYLKQIYCLDNKDYVTLPACNSNDKINQQYLKC
SLKFPFIYDKYIQEYLTAIKSKAKYNKQLWLEIFWSMLLERPVIFMSKRF
QKLTYSLLAAIFFIHPLSWVHKIVSIIPKKSPELLGMNCCMLGIHRCMKP
ILDKVDYWNEALLVDLDEGESRMVGGCDNEKETAKRFKVPKFIRTFFINV
LNSVDDSVSQNSPMKIRNIISNIPWNIDDKEETMYNEYKKGFHVYSLLFR
TLIAILIGHYRECITESEGVCKFDRNKFTEYNSRISEFLKLLVNSQCFNS
FIDERIALILNNETFNDRFDRERKEFVFQDKRSFRILKFDMFSKKLNTVI
NTKSEENLTRKGKISTMPAMKKNKIHKVSQMKKSSFYANPKAPSLSSSIS
SLNSLNSKNTKKKNSFDNISTQSESLTSQVIKGLLDKKIFTPSSLFNHNS
QITQTSITDNNSIPKTSVNINSNETVKRTPARPPVPPIINRYFPENKPGP
PLPNKSKDIKKIPTGLVKDRIQNLNKIDQAVNSNRLPSQSARERSRSIPL
IPSEAYLLRTSPESKNEGKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0017112Rab guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001194cDENN_dom
IPR005112dDENN_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane