slc17a-10

Overview
Nameslc17a-10 (AKN21533.1)
Smed IDSMED30034265
Length (bp)1644
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-10 (SMED30034265) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-10 (SMED30034265) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-10 (SMED30034265) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-10 (SMED30034265) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034265

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30034265SMESG000075620.1 dd_Smed_v4_13219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034265SMESG000075620.1 dd_Smed_v4_13219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034265SMESG000075620.1 dd_Smed_v6_13219_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034265SMESG000075620.1 OX_Smed_1.0.07938ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-10 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 302.368 bits (773), Expect = 2.853e-95
Identity = 156/443 (35.21%), Postives = 256/443 (57.79%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-QEIVKEM------KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            PRR+I+  +   G  I   +R N+G+ +V++++     + G    ++   + +W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+     E  K M        PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   60 PRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 300.827 bits (769), Expect = 2.446e-94
Identity = 155/447 (34.68%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V +++     + G    I    K  W+ + +G++H  F+ G+IITQIPGGYI+ +  + ++F   I+++  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W++   L+ YE+P+ HP+I++ E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  II  + G + + L +   +S T VRK+ N  GFG+E+ +   + +++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  ++   WQY F++   V   GV  +AIF  G++  W
Sbjct:   67 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGK--VIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYI---EESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPW 505          
BLAST of slc17a-10 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 292.738 bits (748), Expect = 2.883e-92
Identity = 152/431 (35.27%), Postives = 249/431 (57.77%), Query Frame = 3
Query:  252 GLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-QEIVKEM------KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            G  I   +R N+G+ +V++++     + G    ++   + +W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+     E  K M        PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:    5 GFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 430          
BLAST of slc17a-10 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 282.722 bits (722), Expect = 1.974e-87
Identity = 145/443 (32.73%), Postives = 249/443 (56.21%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCF--IRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH----QEIVK--EMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             P+R+I+  +   G  I   +R N+G+ +V +++       G     +   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++  LN+ +P     A  ++ C   +R+ QGL EG+ +PA + +   W P     +     F G YAG ++  PL G+++ Y  W  VFY++ + GIIW++   L  YE P+ HP+IS  E +Y+ +       +V   +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   ++ T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++  W
Sbjct:   72 LPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPE--IQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIP---SAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEW 509          
BLAST of slc17a-10 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 230.72 bits (587), Expect = 3.562e-68
Identity = 129/436 (29.59%), Postives = 221/436 (50.69%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCF--IRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             P+R+I+  +   G  I   +R N+G+ +V +++       G     +   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++  LN+ +P     A  ++ C   +R+ QGL EG+ +PA + +   W P     +     F G YAG ++  PL G+++ Y  W  VFY++ + GIIW++   L  YE P+ HP+IS  E +Y+        E  I       S +V                                   G+ SA+PH++  I+  + G L + L +   ++ T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++  W
Sbjct:   72 LPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPE--IQTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIP---SAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYI--------ETSIGEGANVVSLSV-----------------------------------GLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEW 459          
BLAST of slc17a-10 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 245.358 bits (625), Expect = 6.446e-74
Identity = 135/436 (30.96%), Postives = 225/436 (51.61%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILD--TDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEM-----KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGD 1502
            +R+++  L   G +I   +R N G     +    TD + KV        + +  W    + V+ S ++ G+++TQIP G+++ K    KLF  GI +   LN+LLP G +  + Y   FI++ QGL +G+ +PA++ +   W P     K     F G YAG ++G PL   ++ Y  W   FYL+ + G+IW IL + + +E P+ HP+IS+ E  ++      V         IPW  I +S  VWAII  NF +SW F L+L N+  Y+ +     + ++G+ +A+PH++   +  + G L + L +   +S T VRK+FN  GFG E+     + +  +   A++ L   +G SG A+SG+ +N LDIAP ++ ++ G S   GT  G+  P +    T   +   W   F+L   +   GV  +A++  G+
Sbjct:   47 KRWLLAILANMGFMISFGIRCNFGAAKTHMYKNYTDPYGKV-------HMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT-AHSKHGWTSVFLLASLIHFTGVTFYAVYASGE 474          
BLAST of slc17a-10 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 245.358 bits (625), Expect = 1.196e-73
Identity = 136/439 (30.98%), Postives = 227/439 (51.71%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILD--TDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL--------SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGD 1502
            +R+++  L   G +I   +R N G     +    TD + KV        + +  W    + V+ S ++ G+++TQIP G+++ K    KLF  GI +   LN+LLP G +  + Y   FI++ QGL +G+ +PA++ +   W P     K     F G YAG ++G PL   ++ Y  W   FYL+ + G+IW IL + + +E P+ HP+IS+ E  ++         +H  I     IPW  I +S  VWAII  NF +SW F L+L N+  Y+ +     + ++G+ +A+PH++   +  + G L + L +   +S T VRK+FN  GFG E+     + +  +   A++ L   +G SG A+SG+ +N LDIAP ++ ++ G S   GT  G+  P +    T   +   W   F+L   +   GV  +A++  G+
Sbjct:   68 KRWLLAILANMGFMISFGIRCNFGAAKTHMYKNYTDPYGKV-------HMHEFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVSNTHPTI---RSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDTTAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT-AHSKHGWTSVFLLASLIHFTGVTFYAVYASGE 495          
BLAST of slc17a-10 vs. Ensembl Celegans
Match: vglu-2 (Vesicular GLUtamate transporter [Source:UniProtKB/TrEMBL;Acc:G5EEK1])

HSP 1 Score: 204.527 bits (519), Expect = 1.736e-58
Identity = 141/447 (31.54%), Postives = 225/447 (50.34%), Query Frame = 3
Query:  222 RFIVVALCWSGLLIVHAMRVNVGITVVTILD--TDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYY-----FTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH--QEIVKEMKI---PWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVEN-GVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLAN---WQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            R+ +  L   G  I   +R N G+    +++  TDA+ +V  +       +  W    +G++ S F+ G+  +QIP G I+ K    KLF LGI+ + +LN++  I +   N++     F   I++ QGL+ G+ +PA++ +   W P     K     F G   G ++G P    ++ ++ W   FY+    GI+W IL   +   +P TH  IS +E  Y+        VK M +   PW  + +STAVWAII C+F +SW F L+L N+  Y+       ++N G+ +  P +   I+   SG L + L +  K+S   VRK  NT GF +E++M   L F    + AV FL I    +G  +SG+ +N  DIAP  + ++ GI+   G   G+      G++T+  T  N   WQ+ F+L  S+  FG+  F IF +GD L W
Sbjct:   47 RWQIALLAHFGFAISFGIRSNFGVAKNRMINNFTDAYGEVHEK-------EFFWTGTEVGMMESSFFYGYAASQIPAGVIAAKFAPNKLFMLGILFASLLNIVTAICL---NFHPFTDIFVMVIQVMQGLALGVCYPAMHGVWKYWAPPLERSKLATTTFTGASVGVMVGLPASAYLVSHFSWSTPFYVFGALGIVWSILWIYVSGTSPETHGYISADEKKYITEKVGSVAVKNMTLTTLPWRDMMTSTAVWAIIICSFCRSWSFFLLLGNQLTYMKDVLHIDIKNSGLIAIFPQLGMCIVTLTSGQLSDYLRSSGKMSTEAVRKSVNTFGFTVEAVMLGCLAFVRDPVIAVTFLIIACSGAGAVLSGFNVNHFDIAPRHAPILMGIANGLGAIAGV-----GGIVTNSLTYQNPDGWQWVFLLAMSIDIFGIIFFLIFAKGDVLPW 478          
BLAST of slc17a-10 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 201.06 bits (510), Expect = 4.373e-58
Identity = 126/435 (28.97%), Postives = 200/435 (45.98%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVEN-GVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            RR +V  L   G   ++AMR N+ I +V +         G+   +L   +  W     GV+ S F+ G+I++Q+PGGY++    +  +F  G   + +  +L P       Y    F R  +GL EG+ +PA++ I   W P     K   + F G Y G ++  PL   +  ++ WP +F+     G+IW ++ Y   ++ P   P IS +EL+ L           +PW +I  S  VWA+I  +  ++  F +MLTN P  L       VE  G+ S+LP+ L        G L + L          VRK+   LGF  +S+  + ++  +  +  V+F  I IG  G+   G+ +N LD+AP+++G +   S TF T  GI  P+LVG I    T+  W     +  S    G  IF  F       W +
Sbjct:   32 RRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKVNGTTLHVLGDFE-NWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTP-PFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAA 464          
BLAST of slc17a-10 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 200.675 bits (509), Expect = 6.806e-58
Identity = 126/435 (28.97%), Postives = 200/435 (45.98%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVEN-GVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            RR +V  L   G   ++AMR N+ I +V +         G+   +L   +  W     GV+ S F+ G+I++Q+PGGY++    +  +F  G   + +  +L P       Y    F R  +GL EG+ +PA++ I   W P     K   + F G Y G ++  PL   +  ++ WP +F+     G+IW ++ Y   ++ P   P IS +EL+ L           +PW +I  S  VWA+I  +  ++  F +MLTN P  L       VE  G+ S+LP+ L        G L + L          VRK+   LGF  +S+  + ++  +  +  V+F  I IG  G+   G+ +N LD+AP+++G +   S TF T  GI  P+LVG I    T+  W     +  S    G  IF  F       W +
Sbjct:   37 RRHVVAILALLGFANIYAMRANLSIAIVEMTSGTERKVNGTTLHVLGDFE-NWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTP-PFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSELALLQRDAVSQNHYIVPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLFLVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAA 469          
BLAST of slc17a-10 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0307078)

HSP 1 Score: 234.187 bits (596), Expect = 7.741e-69
Identity = 140/440 (31.82%), Postives = 218/440 (49.55%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL------SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYL-NQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P R+ +  +   G +I   MR N+         + A  K      +     + W   +   + S F+ G+++TQIPGG+I+ K  + K+F L IV S  L++ +P  +   + +    +R+ QGL EG+ +PA + I   W P     +     F G YAG ++G PL GL+     +   FY + + GIIW++    L +ENP  HP+IS  EL Y+       +H  +      PW ++  S  V+AII  NF +SW F L++  +  +L ++F F + E G   +LPH++   I    G L + L     +S TNVRKLFN  GFG+E L   F+  ++T   A+  L  G+ FSG A+SG+ +N LDIAP ++ ++ G+S   GT  GI+ P  +  +        W   F L   V   G   + IF  G+   W
Sbjct:   93 PARYTIATMACVGFMIAFGMRCNM---------SAAKLKGEHNGTVF----MNWTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPW 519          
BLAST of slc17a-10 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0331202)

HSP 1 Score: 234.187 bits (596), Expect = 7.741e-69
Identity = 140/440 (31.82%), Postives = 218/440 (49.55%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL------SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYL-NQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P R+ +  +   G +I   MR N+         + A  K      +     + W   +   + S F+ G+++TQIPGG+I+ K  + K+F L IV S  L++ +P  +   + +    +R+ QGL EG+ +PA + I   W P     +     F G YAG ++G PL GL+     +   FY + + GIIW++    L +ENP  HP+IS  EL Y+       +H  +      PW ++  S  V+AII  NF +SW F L++  +  +L ++F F + E G   +LPH++   I    G L + L     +S TNVRKLFN  GFG+E L   F+  ++T   A+  L  G+ FSG A+SG+ +N LDIAP ++ ++ G+S   GT  GI+ P  +  +        W   F L   V   G   + IF  G+   W
Sbjct:   93 PARYTIATMACVGFMIAFGMRCNM---------SAAKLKGEHNGTVF----MNWTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPW 519          
BLAST of slc17a-10 vs. Ensembl Fly
Match: VGlut (gene:FBgn0031424 transcript:FBtr0077769)

HSP 1 Score: 234.187 bits (596), Expect = 7.741e-69
Identity = 140/440 (31.82%), Postives = 218/440 (49.55%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL------SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYL-NQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P R+ +  +   G +I   MR N+         + A  K      +     + W   +   + S F+ G+++TQIPGG+I+ K  + K+F L IV S  L++ +P  +   + +    +R+ QGL EG+ +PA + I   W P     +     F G YAG ++G PL GL+     +   FY + + GIIW++    L +ENP  HP+IS  EL Y+       +H  +      PW ++  S  V+AII  NF +SW F L++  +  +L ++F F + E G   +LPH++   I    G L + L     +S TNVRKLFN  GFG+E L   F+  ++T   A+  L  G+ FSG A+SG+ +N LDIAP ++ ++ G+S   GT  GI+ P  +  +        W   F L   V   G   + IF  G+   W
Sbjct:   93 PARYTIATMACVGFMIAFGMRCNM---------SAAKLKGEHNGTVF----MNWTVAVESHVDSSFFWGYLVTQIPGGFIASKFPANKIFGLSIVSSATLHLFVPFAMTLMHGHVVICVRVLQGLFEGVTYPACHGIWRFWAPPMERSRLATLAFSGSYAGVVVGLPLSGLLADAVGYQAPFYAYGVFGIIWYMFWIWLCFENPRKHPAISIPELKYIEKSLGESAHPTMPSLKTTPWREMMRSMPVYAIIVANFCRSWNFYLLVLFQSSFLKHKFGFKVEEAGFVGSLPHLIMTTIVPFGGMLADHLRKNGILSTTNVRKLFNCGGFGMEGLFFLFVAHSSTATGAMFALTCGVAFSGFAISGYNVNHLDIAPRYASILMGLSNGIGTLAGIIVPYALDGLIQANPTGCWTTVFTLAACVHLVGCTFYGIFASGELQPW 519          
BLAST of slc17a-10 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083889)

HSP 1 Score: 220.32 bits (560), Expect = 6.380e-65
Identity = 137/466 (29.40%), Postives = 231/466 (49.57%), Query Frame = 3
Query:  126 SAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIV--KEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYL-NQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            S  NG+++ + + + +     E      +  +R+IVV L + G   V+++RVN+ + +V +  T+  +   ++  +       W+SK  G++ S F+ G+I+TQ  GGYI  K     +F  GI  + IL +L P+   ++   F  F+R+ +G  EG+ FP ++ +   W P     +     F G YAG ++  P  G +   + W  VFY+    G+IW+I   +     P      S+ E  Y+      V  K +K PW  IF+S   +AI+  +F ++W F  +LT  P +L +   F + + G+ SA+P++   I+ +VSGYL + L      + T VR+ FN   F  +++      +      +VV L I +G    A SG+ +N LDIAP+ + V+ GI  TF T  GI+SP+L G +   QT   W+  F ++  +   G  I+  +  GD   W
Sbjct:    6 SPKNGKHLEQVHQNNNEITESEPLTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAM--TENRTVFDADGNVSYQQDFPWDSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLEMF-LFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIGYVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEW 468          
BLAST of slc17a-10 vs. Ensembl Fly
Match: MFS9 (gene:FBgn0038799 transcript:FBtr0083888)

HSP 1 Score: 220.32 bits (560), Expect = 6.380e-65
Identity = 137/466 (29.40%), Postives = 231/466 (49.57%), Query Frame = 3
Query:  126 SAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIV--KEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYL-NQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            S  NG+++ + + + +     E      +  +R+IVV L + G   V+++RVN+ + +V +  T+  +   ++  +       W+SK  G++ S F+ G+I+TQ  GGYI  K     +F  GI  + IL +L P+   ++   F  F+R+ +G  EG+ FP ++ +   W P     +     F G YAG ++  P  G +   + W  VFY+    G+IW+I   +     P      S+ E  Y+      V  K +K PW  IF+S   +AI+  +F ++W F  +LT  P +L +   F + + G+ SA+P++   I+ +VSGYL + L      + T VR+ FN   F  +++      +      +VV L I +G    A SG+ +N LDIAP+ + V+ GI  TF T  GI+SP+L G +   QT   W+  F ++  +   G  I+  +  GD   W
Sbjct:    6 SPKNGKHLEQVHQNNNEITESEPLTWRFWRKQRYIVVLLAFFGFFNVYSLRVNLSVAIVAM--TENRTVFDADGNVSYQQDFPWDSKQKGLILSSFFYGYILTQFLGGYIGTKIGGNIVFGTGIGSTAILTLLTPMAASHSLEMF-LFVRIIEGFFEGVTFPGIHAVWARWSPPLERSRMASIAFAGNYAGTVVAMPCSGFLATKYGWESVFYVFGTIGVIWYITWLVFVKAGPELDRFCSKEECDYIQKTIGYVGSKHVKHPWRAIFTSMPFYAIMASHFSENWGFYTLLTQLPSFLRDTLNFDLGKTGILSAVPYLAMGILLAVSGYLADWLQVKGIWTTTQVRRNFNCGAFLAQTVFMMLTAYLLDPTWSVVSLTIAVGLGAFAWSGFAVNHLDIAPQHASVLMGIGNTFATIPGIVSPLLTGYVVTNQTSDEWRIIFFISAGIYLVGCVIYWFYCSGDLQEW 468          
BLAST of slc17a-10 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 310.071 bits (793), Expect = 5.216e-98
Identity = 163/497 (32.80%), Postives = 280/497 (56.34%), Query Frame = 3
Query:   84 EMGNPMTNEKENKPSAINGENISKDNH----------SAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            E+ N + +   N    I+G N++++++          +A  +            P+R+I+  L   G  I   +R N+G+ +V +++ +     G+  A++   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GIIW+I   LL Y +P+ HP+ISE E +Y+ +            ++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  II  + G L + L +   +S T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ+ F++   V   GV  +AIF  G++ +W
Sbjct:   19 ELKNNVGDSLGNLQKKIDGSNVTEEDNIELTEDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGT--AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIP---SAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDW 510          
BLAST of slc17a-10 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 309.686 bits (792), Expect = 6.525e-98
Identity = 163/497 (32.80%), Postives = 280/497 (56.34%), Query Frame = 3
Query:   84 EMGNPMTNEKENKPSAINGENISKDNH----------SAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            E+ N + +   N    I+G N++++++          +A  +            P+R+I+  L   G  I   +R N+G+ +V +++ +     G+  A++   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GIIW+I   LL Y +P+ HP+ISE E +Y+ +            ++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  II  + G L + L +   +S T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ+ F++   V   GV  +AIF  G++ +W
Sbjct:   19 ELKNNVGDSLGNLQKKIDGSNVNEEDNIELTEDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGT--AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIP---SAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDW 510          
BLAST of slc17a-10 vs. Ensembl Zebrafish
Match: slc17a7a (solute carrier family 17 member 7a [Source:ZFIN;Acc:ZDB-GENE-050105-5])

HSP 1 Score: 305.834 bits (782), Expect = 1.564e-96
Identity = 156/444 (35.14%), Postives = 256/444 (57.66%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ +V++++   H+    +  ++   + TW+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C I  R+CQGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HP+I+  E  Y+             +++ K PW   F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L   N ++ TNVRKL N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVND--HTVYSGKKPVIVAAQFTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIMVRVCQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGIFWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIAALVHYGGVIFYGLFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Zebrafish
Match: slc17a7a (solute carrier family 17 member 7a [Source:ZFIN;Acc:ZDB-GENE-050105-5])

HSP 1 Score: 305.834 bits (782), Expect = 1.564e-96
Identity = 156/444 (35.14%), Postives = 256/444 (57.66%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ +V++++   H+    +  ++   + TW+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C I  R+CQGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HP+I+  E  Y+             +++ K PW   F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L   N ++ TNVRKL N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVND--HTVYSGKKPVIVAAQFTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIMVRVCQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGIFWYLFWILVSYESPAAHPTITPEERKYIEDAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRTHNLMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIAALVHYGGVIFYGLFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 301.212 bits (770), Expect = 1.094e-94
Identity = 168/481 (34.93%), Postives = 271/481 (56.34%), Query Frame = 3
Query:  108 EKENKPSAINGENI--SKDNHSAXXXXXXXXXXXXLYF--PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-SHQEIVK------EMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            EK  KP    GENI  ++D   A   E K        F  PRR+I+  +   G  I   +R N+G+ +V++++ ++   +  +  I    K  W+ + +G++H  F+ G+I+TQIPGGYIS +  + ++F   I+++  LN+ +P   +  +Y    F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HP+I+  E  Y+  S  E  K      + K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L + N +S T VRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   31 EKRQKP----GENIELTEDGRPAQINERKAPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVN-NSTIHLNGKIIIKEKAKFNWDPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAAR-GHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGFGMEATLLLIVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPW 505          
BLAST of slc17a-10 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 305.449 bits (781), Expect = 2.616e-96
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   49 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 487          
BLAST of slc17a-10 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 304.679 bits (779), Expect = 2.947e-96
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   38 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 476          
BLAST of slc17a-10 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 304.679 bits (779), Expect = 3.233e-96
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   43 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 481          
BLAST of slc17a-10 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 305.064 bits (780), Expect = 4.412e-96
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 304.294 bits (778), Expect = 1.163e-95
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   76 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 514          
BLAST of slc17a-10 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 301.982 bits (772), Expect = 3.164e-95
Identity = 154/444 (34.68%), Postives = 255/444 (57.43%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++     + G    ++   +  W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+             V +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L + + +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 300.056 bits (767), Expect = 3.500e-94
Identity = 154/447 (34.45%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V +++     + G    I    K  W+ + +G++H  F+ G+IITQIPGGYI+ +  + ++F   I+++  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W++   L+ YE+P+ HP+I++ E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  II  + G + + L +   +S T VRK+ N  GFG+E+ +   + +++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  ++   WQY F++   V   GV  +A+F  G++  W
Sbjct:   67 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGK--VIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYI---EESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVFLIAALVHYGGVIFYALFASGEKQPW 505          
BLAST of slc17a-10 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 295.049 bits (754), Expect = 2.690e-92
Identity = 157/467 (33.62%), Postives = 257/467 (55.03%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVG-------------SEAAILSLPKVT----------WNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++     + G              EA   +L  +           W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+             V +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L + + +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 522          
BLAST of slc17a-10 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 285.034 bits (728), Expect = 2.439e-88
Identity = 144/442 (32.58%), Postives = 251/442 (56.79%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCF--IRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLS------HQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P+R+I+  +   G  I   +R N+G+ +V +++       G     +   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  ++++F   I ++  LN+ +P     A  ++ C   +R+ QGL EG+ +PA + +   W P     +     F G YAG ++  PL G+++ Y  W  VFY++ + GIIW++   L  YE P+ HP+IS  E +Y+ +      +   + +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   ++ T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++ +W
Sbjct:   86 PKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPE--IQTAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAASRVFGAAIFLTSTLNMFIP---SAARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDW 522          
BLAST of slc17a-10 vs. Ensembl Mouse
Match: Slc17a8 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [Source:MGI Symbol;Acc:MGI:3039629])

HSP 1 Score: 228.409 bits (581), Expect = 1.079e-68
Identity = 114/332 (34.34%), Postives = 191/332 (57.53%), Query Frame = 3
Query:  546 ANYYFTCF--IRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLS------HQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            A  ++ C   +R+ QGL EG+ +PA + +   W P     +     F G YAG ++  PL G+++ Y  W  VFY++ + GIIW++   L  YE P+ HP+IS  E +Y+ +      +   + +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   ++ T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++ +W
Sbjct:    7 ARVHYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNAERTYIETSIGEGANLASLSKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQNVFLIAALVHYSGVIFYGVFASGEKQDW 338          
BLAST of slc17a-10 vs. UniProt/SwissProt
Match: sp|Q1L8X9|VGLU3_DANRE (Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2)

HSP 1 Score: 310.071 bits (793), Expect = 3.938e-97
Identity = 163/497 (32.80%), Postives = 280/497 (56.34%), Query Frame = 3
Query:   84 EMGNPMTNEKENKPSAINGENISKDNH----------SAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            E+ N + +   N    I+G N++++++          +A  +            P+R+I+  L   G  I   +R N+G+ +V +++ +     G+  A++   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GIIW+I   LL Y +P+ HP+ISE E +Y+ +            ++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  II  + G L + L +   +S T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ+ F++   V   GV  +AIF  G++ +W
Sbjct:   19 ELKNNVGDSLGNLQKKIDGSNVTEEDNIELTEDGRPVAAPKRSPPLLDCGCFGLPKRYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGT--AVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIP---SAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDW 510          
BLAST of slc17a-10 vs. UniProt/SwissProt
Match: sp|Q05B21|VGLU1_XENTR (Vesicular glutamate transporter 1 OS=Xenopus tropicalis OX=8364 GN=slc17a7 PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.337e-95
Identity = 158/447 (35.35%), Postives = 257/447 (57.49%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++ +   K      ++   + TW+ + +G++H  F+ G+I+TQIPGGYI +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+ISE E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L     +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK--GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIP---SAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYI---EESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGFGMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPW 497          
BLAST of slc17a-10 vs. UniProt/SwissProt
Match: sp|A4FV52|VGLU1_BOVIN (Vesicular glutamate transporter 1 OS=Bos taurus OX=9913 GN=SLC17A7 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 7.703e-95
Identity = 154/444 (34.68%), Postives = 254/444 (57.21%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++     + G    ++   +  W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+             V +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVMQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 497          
BLAST of slc17a-10 vs. UniProt/SwissProt
Match: sp|Q62634|VGLU1_RAT (Vesicular glutamate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc17a7 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.143e-94
Identity = 154/444 (34.68%), Postives = 255/444 (57.43%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-------QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  +   G  I   +R N+G+ +V++++     + G    ++   +  W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+             V +   PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L + + +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 497          
BLAST of slc17a-10 vs. UniProt/SwissProt
Match: sp|Q9P2U7|VGLU1_HUMAN (Vesicular glutamate transporter 1 OS=Homo sapiens OX=9606 GN=SLC17A7 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.370e-94
Identity = 156/443 (35.21%), Postives = 256/443 (57.79%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-QEIVKEM------KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            PRR+I+  +   G  I   +R N+G+ +V++++     + G    ++   + +W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HPSISE E  Y+     E  K M        PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   +S TNVRKL N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ PI+VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   60 PRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGH--VVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPW 497          
BLAST of slc17a-10 vs. TrEMBL
Match: A0A0H3YK83 (Slc17a-10 OS=Schmidtea mediterranea OX=79327 GN=slc17a-10 PE=2 SV=1)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 3
Query:   72 MNVPEMGNPMTNEKENKPSAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            MNVPEMGNPMTNEKENKPSAINGENISKDNHSADNKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS
Sbjct:    1 MNVPEMGNPMTNEKENKPSAINGENISKDNHSADNKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 483          
BLAST of slc17a-10 vs. TrEMBL
Match: A0A267G1Q9 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012125g1 PE=4 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 1.349e-157
Identity = 223/435 (51.26%), Postives = 307/435 (70.57%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEM-KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            +R++V  LC+ G++I+H+MRVN+ ITVVTILD   H KVGS      LP V W   M+GVLHS+FY+GF+ITQ+PGGY++ K  + ++F L I +SC LN+LLP  I N  + FTC +R+ QGL EG + P +YKI+++W P      +  +   GMYAG IIGFPLDG+I HY  W Y+FY+H++ G +WF   +L  YE P   PS+ ++E   +++ ++ V E+ K+PW  IF+S  VWA++ C+FV+SWMF  +LTNEP +LN F F++VENG+FSA PH+LKV+   + G + +I+L  +  S TNVRK+F   GFGIE++ CY L     G  A+VFL +G+G SGL V+GWQ+N LD+AP+F+ V+AGISA+FGT GGILSPI+VG+ITHPQTL NWQ SFILTG+VLA GV  +   G G+   W +
Sbjct:   36 KRYVVCLLCFLGMVIIHSMRVNIAITVVTILDKAPHEKVGSSKRAQELPDVDWTPTMVGVLHSVFYVGFLITQVPGGYLATKLPTNRIFGLCICLSCALNLLLPTAIANVGFIFTCSVRVVQGLLEGAVIPTMYKIVNDWSPRMQRSSFASFCITGMYAGAIIGFPLDGMITHYANWQYMFYIHAVFGFVWFFFWFLFVYERPEFDPSVKDDEKKLIMAGRDQVVELDKVPWKAIFTSLPVWAVMVCHFVRSWMFFFLLTNEPAFLNMFNFSIVENGIFSATPHLLKVLCCILGGIVADIVLLKSPCSLTNVRKMFTCFGFGIEAMCCYALSRVQQGYVAIVFLNLGVGCSGLTVAGWQVNHLDLAPQFASVLAGISASFGTIGGILSPIVVGIITHPQTLWNWQKSFILTGTVLAAGVIFYFFLGSGELQPWAA 470          
BLAST of slc17a-10 vs. TrEMBL
Match: A0A1I8HN91 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012125g2 PE=4 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 1.349e-157
Identity = 223/435 (51.26%), Postives = 307/435 (70.57%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEM-KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            +R++V  LC+ G++I+H+MRVN+ ITVVTILD   H KVGS      LP V W   M+GVLHS+FY+GF+ITQ+PGGY++ K  + ++F L I +SC LN+LLP  I N  + FTC +R+ QGL EG + P +YKI+++W P      +  +   GMYAG IIGFPLDG+I HY  W Y+FY+H++ G +WF   +L  YE P   PS+ ++E   +++ ++ V E+ K+PW  IF+S  VWA++ C+FV+SWMF  +LTNEP +LN F F++VENG+FSA PH+LKV+   + G + +I+L  +  S TNVRK+F   GFGIE++ CY L     G  A+VFL +G+G SGL V+GWQ+N LD+AP+F+ V+AGISA+FGT GGILSPI+VG+ITHPQTL NWQ SFILTG+VLA GV  +   G G+   W +
Sbjct:   36 KRYVVCLLCFLGMVIIHSMRVNIAITVVTILDKAPHEKVGSSKRAQELPDVDWTPTMVGVLHSVFYVGFLITQVPGGYLATKLPTNRIFGLCICLSCALNLLLPTAIANVGFIFTCSVRVVQGLLEGAVIPTMYKIVNDWSPRMQRSSFASFCITGMYAGAIIGFPLDGMITHYANWQYMFYIHAVFGFVWFFFWFLFVYERPEFDPSVKDDEKKLIMAGRDQVVELDKVPWKAIFTSLPVWAVMVCHFVRSWMFFFLLTNEPAFLNMFNFSIVENGIFSATPHLLKVLCCILGGIVADIVLLKSPCSLTNVRKMFTCFGFGIEAMCCYALSRVQQGYVAIVFLNLGVGCSGLTVAGWQVNHLDLAPQFASVLAGISASFGTIGGILSPIVVGIITHPQTLWNWQKSFILTGTVLAAGVIFYFFLGSGELQPWAA 470          
BLAST of slc17a-10 vs. TrEMBL
Match: A0A1I8HTW9 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 3.792e-151
Identity = 223/433 (51.50%), Postives = 306/433 (70.67%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEM-KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            +R++V  LC+ G++I+H+MRVN+ ITVVTILD   H KVGS      LP V W   M+GVLHS+FY+GF+ITQ+PGGY++ K  + ++F L I +SC LN+LLP  I N  + FTC +R+ QGL EG + P +YKI+++W P      +  +   GMYAG IIGFPLDG+I HY  W Y+FY+H++ G +WF   +L  YE P   PS+ ++E   +++ ++ V E+ K+PW  IF+S  VWA++ C+FV+SWMF  +LTNEP +LN F F++VENG+FSA PH+LKV+   + G + +I+L  +  S TNVRK+F   GFGIE++ CY L     G  A+VFL +G+G SGL V+GWQ+N LD+AP+F+ V+AGISA+FGT GGILSPI+VG+ITHPQTL NWQ SFILTG+VLA GV  +   G G+   W
Sbjct: 1227 KRYVVCLLCFLGMVIIHSMRVNIAITVVTILDKAPHEKVGSSKRAQELPDVDWTPTMVGVLHSVFYVGFLITQVPGGYLATKLPTNRIFGLCICLSCALNLLLPTAIANVGFIFTCSVRVVQGLLEGAVIPTMYKIVNDWSPRMQRSSFASFCITGMYAGAIIGFPLDGMITHYANWQYMFYIHAVFGFVWFFFWFLFVYERPEFDPSVKDDEKKLIMAGRDQVVELDKVPWKAIFTSLPVWAVMVCHFVRSWMFFFLLTNEPAFLNMFNFSIVENGIFSATPHLLKVLCCILGGIVADIVLLKSPCSLTNVRKMFTCFGFGIEAMCCYALSRVQQGYVAIVFLNLGVGCSGLTVAGWQVNHLDLAPQFASVLAGISASFGTIGGILSPIVVGIITHPQTLWNWQKSFILTGTVLAAGVIFYFFLGSGELQPW 1659          
BLAST of slc17a-10 vs. TrEMBL
Match: A0A1I8HH03 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 4.966e-147
Identity = 215/435 (49.43%), Postives = 296/435 (68.05%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEM-KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            +R++V  LC+ G++I+H+MRVN+ ITVVTILD   H KVGS      LP V W   M+GVLHS+FY+GF+ITQ+PGGY++ K  + ++F L I +SC LN+LLP  I N                 G + P +YKI+++W P      +  +   GMYAG IIGFPLDG+I HY  W Y+FY+H++ G +WF   +L  YE P   PS+ ++E   +++ ++ V E+ K+PW  IF+S  VWA++ C+FV+SWMF  +LTNEP +LN F F++VENG+FSA PH+LKV+   + G + +I+L  +  S TNVRK+F   GFGIE++ CY L     G  A+VFL +G+G SGL V+GWQ+N LD+AP+F+ V+AGISA+FGT GGILSPI+VG+ITHPQTL NWQ SFILTG+VLA GV  +   G G+   W +
Sbjct:   36 KRYVVCLLCFLGMVIIHSMRVNIAITVVTILDKAPHEKVGSSKRAQELPDVDWTPTMVGVLHSVFYVGFLITQVPGGYLATKLPTNRIFGLCICLSCALNLLLPTAIAN-----------------GAVIPTMYKIVNDWSPRMQRSSFASFCITGMYAGAIIGFPLDGMITHYANWQYMFYIHAVFGFVWFFFWFLFVYERPEFDPSVKDDEKKLIMAGRDQVVELDKVPWKAIFTSLPVWAVMVCHFVRSWMFFFLLTNEPAFLNMFNFSIVENGIFSATPHLLKVLCCILGGIVADIVLLKSPCSLTNVRKMFTCFGFGIEAMCCYALSRVQQGYVAIVFLNLGVGCSGLTVAGWQVNHLDLAPQFASVLAGISASFGTIGGILSPIVVGIITHPQTLWNWQKSFILTGTVLAAGVIFYFFLGSGELQPWAA 453          
BLAST of slc17a-10 vs. Ensembl Cavefish
Match: slc17a7a (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:103024379])

HSP 1 Score: 310.457 bits (794), Expect = 2.260e-98
Identity = 160/447 (35.79%), Postives = 259/447 (57.94%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ +V++++   H+    +  I+   + TW+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  ++ C I  R+CQGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   GI+W++   L+ YE+P+ HP+I+  E  Y+   +E + E           K PW   F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L   N ++ TNVRKL N  GFG+E+ +   + F++T + A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   59 LPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNE--HTVFRGKKPIIEAAQFTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPAA---ARVHYGCVIMVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYTGWSSVFYVYGSVGILWYMFWILVSYESPAVHPTITPEERKYI---EEAIGESAGLVNPLQKFKTPWRHFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQLADYLRTHNIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 304.294 bits (778), Expect = 3.028e-96
Identity = 167/483 (34.58%), Postives = 274/483 (56.73%), Query Frame = 3
Query:  108 EKENKPSAINGENI--SKDNHSAXXXXXXXXXXXXLYF--PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-SHQEIVK------EMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            E+  KP    GE+I  ++D   A   E K        F  PRR+I+  +   G  I   +R N+G+ +V++++     + G +  I    K  W+ + +G++H  F+ G+I+TQIPGGYIS +  + ++F   IV++  LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W++   L+ YE+P+ HP+I++ E  Y+  S  E  K      + K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L + N +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   10 ERRQKP----GESIELTEDGRPAQRSERKTPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENG-KIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPW 484          
BLAST of slc17a-10 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 303.908 bits (777), Expect = 7.320e-96
Identity = 167/483 (34.58%), Postives = 274/483 (56.73%), Query Frame = 3
Query:  108 EKENKPSAINGENI--SKDNHSAXXXXXXXXXXXXLYF--PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-SHQEIVK------EMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            E+  KP    GE+I  ++D   A   E K        F  PRR+I+  +   G  I   +R N+G+ +V++++     + G +  I    K  W+ + +G++H  F+ G+I+TQIPGGYIS +  + ++F   IV++  LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W++   L+ YE+P+ HP+I++ E  Y+  S  E  K      + K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L + N +S TNVRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   32 ERRQKP----GESIELTEDGRPAQRSERKTPLCDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTIHENG-KIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIP---SAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGFGMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKNKTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPW 506          
BLAST of slc17a-10 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 300.442 bits (768), Expect = 1.365e-94
Identity = 153/444 (34.46%), Postives = 258/444 (58.11%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYL-------LSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             P+R+I+  L   G  I   +R N+G+ +V +++ +     G+   ++   +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GIIW+    LL Y++P+ HP+IS+ E  Y+        S     ++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   +S T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  +AIF  G++ +W
Sbjct:   56 LPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGT--PVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIP---SAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTIGEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDW 494          
BLAST of slc17a-10 vs. Ensembl Cavefish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 296.204 bits (757), Expect = 9.329e-93
Identity = 155/457 (33.92%), Postives = 258/457 (56.46%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDA------------HSKVGSEAAILSLP-KVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYL-------LSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             P+R+I+  L   G  I   +R N+G+ +V +++ +               K     +   LP +  W+ + +G++H  F+ G+I+TQIPGG+IS K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GIIW+    LL Y++P+ HP+IS+ E  Y+        S     ++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   +S T VRK+ N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  +AIF  G++ +W
Sbjct:   56 LPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGTPVMQVNKKKHKRTESFFILPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSMLNMFIP---SAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYTFWLLLAYDSPAVHPTISDEEKIYIETTIGEGASLMSATEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIVVPIGGQLADFLRSNKILSTTTVRKIMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKHKTRLEWQNVFVIASMVHYCGVIFYAIFASGEKQDW 509          
BLAST of slc17a-10 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 233.417 bits (594), Expect = 6.597e-70
Identity = 136/448 (30.36%), Postives = 234/448 (52.23%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSI--FYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYY-FTCFIRLC-QGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P+R+++  +   G  I   +R N+G+ VV +++  ++     +  I+    + W+  +   LH +  F++ F+ T    G+I  KS S +        S +    LP+ ++        C   L    + +G+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  W  VFY++   G+ W+I    + YE+P+ HP+IS+ E +Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  I+  + G L +   +   +S T VRK+ N  GFG+E+ +   + F++    A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++  W
Sbjct:   28 PKRYVIAVMSGLGFCISFGIRCNLGVAVVDMVNNSSYHS--GDKLIVQKGSLGWSMDLAMQLHELYNFFLFFLATW--QGHIVVKSMSRE--ERLHQCSTLPPHWLPVHVEERRAVPCACLTSLSLSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYI---EESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGMEATLLLVVGFSHGKGIAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPW 466          
BLAST of slc17a-10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 3.382e-40
Identity = 80/252 (31.75%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  777 TGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMK----IPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTG-IEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            TG++W I+ +L  +++P  HP IS  E  ++L   +  ++      IPW  +++   +WAI    F   W F ++LT+ P Y++    + M +NG+ SALP++   +     G   + L     +S T +RK+  TLG  + SL      F     + AV FL + + F     +G  IN LDIAP+++GV+ GIS TF    G L+P L G +T   TL  W   F ++ ++  FG   + +FG G + +W
Sbjct:    3 TGLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAERQANHGTSIPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEHDTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSW 254          
BLAST of slc17a-10 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 225.713 bits (574), Expect = 8.717e-68
Identity = 138/452 (30.53%), Postives = 236/452 (52.21%), Query Frame = 3
Query:  222 RFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVG-SEAAILSLPKVT-------------WNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYW---KWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYL---LSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSW-MFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            R+IV  + + G+ + +A+RVN+ + +  + +    ++ G +   +L +  VT             W+SK+ G +   FY G++  Q+PGG++ ++   T++F + + I+ +L +L P+  + +       +R+ +GL+ G +FP  + I   W P     +       G   G I+  PL GL+  Y     W  VFY     G++WF +  L  +  PS HP+ISE E  Y+   ++ Q  VK + IPW  I +S  VWAII  NF   W M+ +++     ++   KF + + G  +ALP++LK  +    G +V+ L+  NK+S  N R+   T+G  + S+      +AN    AV  L IG+G +G+  +G+ +N LDIAP+++GVI G++  FG   G +SP +VG+IT  +T   W+  F +T  V   G+ +F +   GD+  W
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSKLQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTSVVALIT-LRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAIADQPGVK-LSIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWLIK-NKLSVKNTRRCVFTVGCTVASIFVLATGYANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPNKTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKW 449          
BLAST of slc17a-10 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 219.55 bits (558), Expect = 3.837e-65
Identity = 138/454 (30.40%), Postives = 226/454 (49.78%), Query Frame = 3
Query:  222 RFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVG---SEAAILSLPKVT-------WNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIH---YWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLS-----HQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIES--LMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQ-TLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWN 1517
            R+ +  L   G  +V+ +RVN+ + +V ++++      G   SE    + P  T       W+ K  G++   F+ G+I TQ+PGG+++ +     LF  G++ + I  +L P             +R+ +GL EG+ FPA++ I  +W P     K     + G   G II  PL G++        WP VFY+    GI+WF++  L+  E P+ HP+ISE E  Y++S           +   PW  I+SS AVWAII  +F  +W F   LT  P Y  +   F+++ NG  SA+P+  + +   ++G + + LL     S ++VRK+F    F I +  L+        T   +V      +GF+G  +SG+ +N LDIAP ++G++ GI+ +FGT  GI +P + G IT+ +   A+WQ  F ++  +   G   F    +G    WN
Sbjct:   25 RYTLALLACLGFCVVYGLRVNLSVALVAMVNSTYDGIDGNTNSECPGGNTPDTTYKNGDFNWDQKTQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAHQGIPMLIA-LRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIGTSQDRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRWN 477          
BLAST of slc17a-10 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 218.394 bits (555), Expect = 1.315e-64
Identity = 131/444 (29.50%), Postives = 232/444 (52.25%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLII-HYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-----SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQ-TLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
             P R+I+  L   GL +  ++RVN+ + +V ++++    +   +         +W+ +  G++   F+ G+I+  IPGG+++ ++       LG++IS +L++L P+  + + Y     +R+ +GL++G+I+P++  ++  W P     K     + G  AG IIG  + GL+    ++WP VFYL   +GI+W++    L Y++PS HP IS  E  Y++     S  ++VK+   PW +I +S AV AI    F  +W F   LT+ P Y  +   F +  NG+ SALP+  +   +  +G+L + L++ + I+ T VRK+F      + S +   L F N  + AV  LC+   F  +   G  I+ ++ AP + G++  I+ + GT  GI +P +VG +T+ Q T   WQ  + +   +  FG   FA  G      WN+
Sbjct:    8 LPCRYILAVLGCFGLTVTFSLRVNLSVALVAMVNSTQTGQPKED-------YFSWDQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYS-YKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQWPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIVTAIGASQDKVVKKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRKIFT-----LASCIMVALGFTNQPVVAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNT 438          
BLAST of slc17a-10 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 218.009 bits (554), Expect = 2.317e-64
Identity = 127/441 (28.80%), Postives = 225/441 (51.02%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYW---KWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYL----LSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P+R++++A+ W G + +++MRVN+ + +V +++    SK       +   +  W+S + G++   F+ G+ + QIPG +++ +   T++F  G+ ++ +L +L P+  + + +     +R+ QGL  G+ FP  + I   W P             G   G I+  PL GL+  Y     WP VFY    +GIIW+    L+ +E+P+THP+IS+ E   +     S     +   +PW  I    AVWAI+  +F   W +  + T  P Y      F + + G  +A P++ K ++A + G L + L+  N +    VR +F  +G  +  +      +A T    V+FL +G+GFSGL   G+ +N LDIAP+++GV+ G++ TF +  G +SP + G++T  +    W+  F +T  V    V  ++    G R  W
Sbjct:   37 PKRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISK--GRLHFIKKAEFNWDSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYSVWGLVG-VRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENSIASSDNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGYYTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSYATTRHMCVIFLVLGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKHKKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPW 474          
BLAST of slc17a-10 vs. Ensembl Nematostella
Match: EDO31712 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX51])

HSP 1 Score: 205.682 bits (522), Expect = 1.480e-60
Identity = 128/424 (30.19%), Postives = 213/424 (50.24%), Query Frame = 3
Query:  264 VHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFP---NRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWK-WPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMK--IPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            ++A+R  + + +V ++        G +   +  P+  W+S+M G++   FY G+ + QIP G+   K     +F  GI+++ +L ++ P  ++ +   F C +R+ QGLS GLI  A + I   W P     S+    G    G   G I+  P+ GL+    K WP  FY     G++WFI      YE P  HP+I++ E+ ++     I +  K  +PW  I  ST VWA     F+  W F  ML   P+++ Q   F++ E G  SALP +L  I++ VSG   + L     +S   +RK+F   G    S     + + +    ++  L +GIG  GL  +G   N +D++P+++G++ G S T G+  G L+P +VG++T   TL  W+  F LT  +   G+ ++  FG G + +W
Sbjct:    1 MYAVRTCLSVAIVAMVSNSTVLINGKKT--VKPPEFAWSSEMQGLVLGSFYYGYAVLQIPAGWAVLKIGGKPIFGFGILVASVLALVTPPIVKQSFIVFIC-LRIAQGLSLGLIASAHHCIWATWSPIFERASLLTIAG---SGTLVGTIVTMPVTGLLCDSPKGWPLAFYFIGSLGVLWFIAWQYFMYETPQDHPTITQAEIEFIGVPWNIDEATKSVVPWASILCSTPVWAANFTMFISDWCFYSMLICIPLFMKQVLHFSLSETGFVSALPFVLMTIVSPVSGMYADRLRARGVLSTGAIRKIFQCAGLAASSCFVVAVGYESKPFLSLALLTLGIGSFGLIAAGVGPNLIDLSPKYAGLLMGFSNTMGSLSGFLAPGVVGVLTVHGTLEEWRLVFWLTAVLSLAGILVYVAFGSGKKQSW 418          
BLAST of slc17a-10 vs. Ensembl Medaka
Match: slc17a7a (vesicular glutamate transporter 1 [Source:NCBI gene;Acc:101175655])

HSP 1 Score: 311.997 bits (798), Expect = 6.180e-99
Identity = 158/444 (35.59%), Postives = 261/444 (58.78%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-------SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ +V++++   H+       +L   + TW+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  +++C I  R+CQGL EG+ +PA + I   W P     +     F G YAG ++  PL G+++ Y  WP VFY++   GI W++   L+ YE+P+ HP+I+  E  Y+        S    +++ K PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L + N ++ TNVRKL N  GFG+E+ +   + +++T + A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + +F  G++  W
Sbjct:   59 LPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVND--HTVYKGNKEVLVAAQFTWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIP---SAARCHYSCVILVRICQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYIGWPSVFYVYGSFGIFWYLFWILVSYESPAAHPTITAEERKYIEEAIGESSSFLNPLQKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSHNLMTTTNVRKLMNCGGFGMEATLLLVVGYSHTKVIAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQYVFLIASLVHYGGVVFYGLFASGEKQPW 497          
BLAST of slc17a-10 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 305.064 bits (780), Expect = 2.269e-96
Identity = 154/441 (34.92%), Postives = 263/441 (59.64%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTC--FIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH-QEIVKEM---KIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             P+R+I+  L   G  I   +R N+G+ +V +++ +     G+   +L   +  W+ + +G++H  F+ G+I+TQIPGG+I+ K  + ++F   I ++ +LN+ +P     A  ++ C  F+R+ QGL EG+ +PA + +   W P     +     F G YAG +I  PL G+++ Y  WP VFY++ + GI+W+++  LL Y +P+ HP+I+E E  Y+ +   E V ++   + PW + F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SA+PH++  I+  + G L + L +   +S TNVRKL N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ+ F++   V   GV  +AIF  G++ +W
Sbjct:   70 LPKRYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYINGT--PVLQRAQFNWDPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIP---SAARVHYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQYVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAIGETVNQLSKFRTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGFGMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKNKTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDW 505          
BLAST of slc17a-10 vs. Ensembl Medaka
Match: ENSORLT00000010015.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 300.442 bits (768), Expect = 5.195e-95
Identity = 156/442 (35.29%), Postives = 254/442 (57.47%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-----SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ VV+++++  H  +     ++   +  W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W+    L+ YE+P+ HP+I+E E  Y+      S Q  V +   PW   F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   ++ TNVRKL N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++  W
Sbjct:   11 LPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVNS--HKVLRGNKEVIVKAQFEWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAA---ARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTW 447          
BLAST of slc17a-10 vs. Ensembl Medaka
Match: ENSORLT00000010014.2 (vesicular glutamate transporter 1-like [Source:NCBI gene;Acc:101167994])

HSP 1 Score: 301.212 bits (770), Expect = 8.624e-95
Identity = 156/442 (35.29%), Postives = 254/442 (57.47%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI--RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLL-----SHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ VV+++++  H  +     ++   +  W+ + +G++H  F+ G+I+TQIPGG+I +K  + ++F   IV +  LN+L+P     A  +F C I  R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   G++W+    L+ YE+P+ HP+I+E E  Y+      S Q  V +   PW   F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G + + L +   ++ TNVRKL N  GFG+E+ +   + F++T   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQ  F++   V   GV  + +F  G++  W
Sbjct:   56 LPRRYIIAILSGIGFCISFGIRCNLGVAVVSMVNS--HKVLRGNKEVIVKAQFEWDPETVGMIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSCLNMLIPAA---ARMHFGCVIIVRIFQGLVEGVSYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGSFGVMWYCFWILVSYESPAAHPTITEEERKYIEESIGESAQHTVTKFNTPWRCFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIVSALPHLVMTIIVPIGGQIADYLRSNQIMTTTNVRKLMNCGGFGMEATLLLVVGFSHTKGVAITFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEWQGVFLIASLVHYGGVIFYGLFASGEKQTW 492          
BLAST of slc17a-10 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 300.827 bits (769), Expect = 1.100e-94
Identity = 157/445 (35.28%), Postives = 257/445 (57.75%), Query Frame = 3
Query:  213 FPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKE----------MKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
             PRR+I+  L   G  I   +R N+G+ +V++++     + G +  +    K  W+ + +G++H  F+ G+I+TQIPGGYIS +  + ++F   IV++  LN+ +P   ++ +Y    F+R+ QGL EG+ +PA + I   W P     +     F G YAG +I  PL G+++ Y  W  VFY++   GI W++   L+ YE+P+ HP+I+E E  Y+   +E + E           K PW K F+S  V+AII  NF +SW F L+L ++P Y  + F F + + G+ SALPH++  II  + G L + L + N +S T VRK+ N  GFG+E+ +   + ++++   A+ FL + +GFSG A+SG+ +N LDIAP ++ ++ GIS   GT  G++ P++VG +T  +T   WQY F++   V   GV  + IF  G++  W
Sbjct:   67 LPRRYIIAILSGLGFCISFGIRCNLGVAIVSMVNNSTIHQNG-KIIVKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARS-HYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYTGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYI---EESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKNKTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPW 506          
BLAST of slc17a-10 vs. Planmine SMEST
Match: SMESG000075620.1 (SMESG000075620.1)

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 480/483 (99.38%), Postives = 482/483 (99.79%), Query Frame = 3
Query:   72 MNVPEMGNPMTNEKENKPSAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            MNVPEMGNPMTNEKENKPSAINGENISKDNHSA+NKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIG+LHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANY FTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS
Sbjct:    1 MNVPEMGNPMTNEKENKPSAINGENISKDNHSANNKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGILHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYCFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 483          
BLAST of slc17a-10 vs. Planmine SMEST
Match: SMESG000075620.1 (SMESG000075620.1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 475/478 (99.37%), Postives = 477/478 (99.79%), Query Frame = 3
Query:   87 MGNPMTNEKENKPSAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 1520
            MGNPMTNEKENKPSAINGENISKDNHSA+NKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIG+LHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANY FTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS
Sbjct:    1 MGNPMTNEKENKPSAINGENISKDNHSANNKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGILHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYCFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNS 478          
BLAST of slc17a-10 vs. Planmine SMEST
Match: SMESG000075620.1 (SMESG000075620.1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 439/442 (99.32%), Postives = 441/442 (99.77%), Query Frame = 3
Query:   87 MGNPMTNEKENKPSAINGENISKDNHSAXXXXXXXXXXXXLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQ 1412
            MGNPMTNEKENKPSAINGENISKDNHSA+NKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIG+LHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANY FTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQ
Sbjct:    1 MGNPMTNEKENKPSAINGENISKDNHSANNKEMKEDKNKDLYFPRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKVTWNSKMIGILHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYCFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQ 442          
BLAST of slc17a-10 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 230.335 bits (586), Expect = 1.092e-68
Identity = 137/452 (30.31%), Postives = 238/452 (52.65%), Query Frame = 3
Query:  216 PRRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVG----SEAAILSLPKVT------WNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIH---YWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSHQEIVKEMK---IPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTG-IEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLIT-HPQTLANWQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            P R+++    + G  +V+A+RVN+ + ++ +++  A    G     E    +L KVT      W+  + G++   F+ G+I  QIP G I+ K      F +G++ + +L +L P+  +   Y +   +R+ +G  E + +PA++ ++  W P       GG ++ G +AG +IG      +I       WP VFY+  + GI+WFI+   + +  P+ HP I+  E  ++ S   +  E +   +PW  I  S  VWAI   NF   W    +LT+ P+Y      F++ +NG  +ALP++L  I+  VSG + +I+ +   +S T  RKLFNT+G  I ++    + +     +  V FLCI +       +G+ +N +D+AP+++GV+ GI+ +  T  GI+ P +VG++T H +T   WQ  F ++ ++  FG   F IFG GDR +W
Sbjct:   45 PTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDPGLNLTPECPNSNLSKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAAR-LGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSSEERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGCNKVLVVTFLCIAVALGTSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSW 495          
BLAST of slc17a-10 vs. Planmine SMEST
Match: SMESG000019933.1 (SMESG000019933.1)

HSP 1 Score: 218.779 bits (556), Expect = 1.337e-64
Identity = 137/444 (30.86%), Postives = 233/444 (52.48%), Query Frame = 3
Query:  219 RRFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVG-------SEAAILSLPKVTWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNVLLPIGIQNANYYFTCFI-RLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGGWIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYENPSTHPSISENELSYLLSH--QEIVKEMKIPWCKIFSSTAVWAIITCNFVKSWMFILMLTNEPVYLNQ-FKFTMVENGVFSALPHILKVIIASVSGYLVEILLNLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSGLAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLAN-WQYSFILTGSVLAFGVFIFAIFGRGDRLNW 1514
            +R+++  L   GLLI   MR  +GI ++ +  T+ H  V        SE  ++ + +V W++  + ++ + FYIG+ +  IPGG++S    + K+F   +  S   N  +P+ +     + + F+ R+ QG+SEG ++P+++     W P +   K     F GM  GPIIG+P+ G++   + WP  FY      + W ++   +  + PS    ISE E +Y+  +  Q  +   ++PW  I +S  VWAII  N  ++W +    +  P +L + F  + +  G   ++P+I+  I+    G + + ++   K S   VRK FN++GFGI  LM  FL F      A   L IG+G  G+ +SG+ +N LDIA  ++GV+ GIS   GT  GIL+PI+   IT+  ++ + W   FI++G +    V  +AIF  G+  +W
Sbjct:   16 KRYLLAILACFGLLIPLGMRCEIGIAIIKL--TELHDMVVPAGNNNISEFKVIQVREVAWSNTKVSLIEASFYIGYTLFSIPGGFLSTIFPANKVFGFAVFTSAFFNFAIPLLVIYQCGFVSVFVLRIFQGMSEGCLYPSVHSFWRYWAPKQERSKLVTISFFGMALGPIIGYPISGILTKRYDWPANFYFWGTAAMSWAVIWLAVSRKCPSQDSFISEAEKTYIEQNTSQMAITASQVPWISILTSVPVWAIIIANIGRNWTYQFSFSGLPSFLRKKFNDSSINLGFHMSIPYIVMAILTPSCGIVADCMIK-RKFSVAFVRKFFNSVGFGIAGLMFLFLGFIPYLWLATTTLSIGLGSFGIGISGFGVNHLDIADIYAGVLMGISNGIGTLAGILAPIVAMEITNKFSVNDGWLIFFIISGIIHLITVTFYAIFASGENQSW 456          
The following BLAST results are available for this feature:
BLAST of slc17a-10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A72.853e-9535.21solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A62.446e-9434.68solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A72.883e-9235.27solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A81.974e-8732.73solute carrier family 17 member 8 [Source:HGNC Sym... [more]
SLC17A83.562e-6829.59solute carrier family 17 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-46.446e-7430.96Probable vesicular glutamate transporter eat-4 [S... [more]
eat-41.196e-7330.98Probable vesicular glutamate transporter eat-4 [S... [more]
vglu-21.736e-5831.54Vesicular GLUtamate transporter [Source:UniProtKB... [more]
slc-17.14.373e-5828.97SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.16.806e-5828.97SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VGlut7.741e-6931.82gene:FBgn0031424 transcript:FBtr0307078[more]
VGlut7.741e-6931.82gene:FBgn0031424 transcript:FBtr0331202[more]
VGlut7.741e-6931.82gene:FBgn0031424 transcript:FBtr0077769[more]
MFS96.380e-6529.40gene:FBgn0038799 transcript:FBtr0083889[more]
MFS96.380e-6529.40gene:FBgn0038799 transcript:FBtr0083888[more]
back to top
BLAST of slc17a-10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a85.216e-9832.80solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a86.525e-9832.80solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a7a1.564e-9635.14solute carrier family 17 member 7a [Source:ZFIN;Ac... [more]
slc17a7a1.564e-9635.14solute carrier family 17 member 7a [Source:ZFIN;Ac... [more]
slc17a6b1.094e-9434.93solute carrier family 17 member 6b [Source:NCBI ge... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hgf2.616e-9635.35hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf2.947e-9635.35hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf3.233e-9635.35hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf4.412e-9635.35hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf1.163e-9535.35hepatocyte growth factor (hepapoietin A; scatter f... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a73.164e-9534.68solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a63.500e-9434.45solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a72.690e-9233.62solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a82.439e-8832.58solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a81.079e-6834.34solute carrier family 17 (sodium-dependent inorgan... [more]
back to top
BLAST of slc17a-10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1L8X9|VGLU3_DANRE3.938e-9732.80Vesicular glutamate transporter 3 OS=Danio rerio O... [more]
sp|Q05B21|VGLU1_XENTR2.337e-9535.35Vesicular glutamate transporter 1 OS=Xenopus tropi... [more]
sp|A4FV52|VGLU1_BOVIN7.703e-9534.68Vesicular glutamate transporter 1 OS=Bos taurus OX... [more]
sp|Q62634|VGLU1_RAT1.143e-9434.68Vesicular glutamate transporter 1 OS=Rattus norveg... [more]
sp|Q9P2U7|VGLU1_HUMAN1.370e-9435.21Vesicular glutamate transporter 1 OS=Homo sapiens ... [more]
back to top
BLAST of slc17a-10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK830.000e+0100.00Slc17a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A267G1Q91.349e-15751.26MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HN911.349e-15751.26MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HTW93.792e-15151.50MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HH034.966e-14749.43MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a7a2.260e-9835.79vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a6b3.028e-9634.58vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b7.320e-9634.58vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a81.365e-9434.46solute carrier family 17 member 8 [Source:NCBI gen... [more]
slc17a89.329e-9333.92solute carrier family 17 member 8 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b6.597e-7030.36solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.13.382e-4031.75pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486718.717e-6830.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455143.837e-6530.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463661.315e-6429.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317042.317e-6428.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317121.480e-6030.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a7a6.180e-9935.59vesicular glutamate transporter 1 [Source:NCBI gen... [more]
slc17a82.269e-9634.92vesicular glutamate transporter 3 [Source:NCBI gen... [more]
ENSORLT00000010015.25.195e-9535.29vesicular glutamate transporter 1-like [Source:NCB... [more]
ENSORLT00000010014.28.624e-9535.29vesicular glutamate transporter 1-like [Source:NCB... [more]
slc17a6a1.100e-9435.28solute carrier family 17 member 6 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075620.10.000e+099.38SMESG000075620.1[more]
SMESG000075620.10.000e+099.37SMESG000075620.1[more]
SMESG000075620.10.000e+099.32SMESG000075620.1[more]
SMESG000066847.11.092e-6830.31SMESG000066847.1[more]
SMESG000019933.11.337e-6430.86SMESG000019933.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034265
GenBankAKN21533.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034265 ID=SMED30034265|Name=slc17a-10|organism=Schmidtea mediterranea sexual|type=transcript|length=1644bp
TCGTTCTTATTGATTTGTGTTATTAAGTAGATGTTAATTGTGCATTGATT
CATTTTGATTGTTCAATAAAAATGAATGTACCTGAAATGGGAAATCCTAT
GACAAATGAGAAAGAAAACAAACCATCAGCTATTAATGGAGAAAATATTT
CAAAGGATAATCATTCAGCAGATAATAAAGAAATGAAAGAAGACAAAAAT
AAAGATTTATATTTTCCAAGACGGTTTATTGTTGTAGCTTTATGTTGGAG
TGGATTGTTAATAGTTCATGCTATGAGAGTAAATGTTGGGATTACTGTAG
TAACCATTTTGGATACTGACGCACATTCTAAAGTTGGTAGTGAAGCAGCT
ATTTTAAGTTTGCCTAAAGTAACTTGGAATTCTAAAATGATTGGAGTTCT
ACATAGTATATTTTATATTGGATTTATAATAACTCAAATACCGGGTGGCT
ACATTTCCAGAAAATCTTATTCTACTAAATTGTTTAGTCTTGGTATTGTA
ATTTCATGTATTTTAAATGTCCTCTTGCCAATTGGGATCCAGAACGCAAA
TTATTACTTCACTTGTTTTATCAGATTATGCCAAGGTTTGTCAGAGGGTT
TAATTTTTCCAGCCTTATACAAAATCATGCACAATTGGTTTCCTAATCGA
AGTGTACATAAATATGGAGGATGGATATTTGGAGGAATGTACGCTGGACC
AATAATTGGATTTCCTCTTGATGGGCTCATTATTCATTATTGGAAGTGGC
CATATGTATTTTATTTACACAGCTTGACTGGAATTATTTGGTTTATATTA
TCATATTTATTATTTTACGAAAATCCGTCGACTCATCCTTCTATTTCTGA
AAATGAATTGAGCTATTTACTTTCTCATCAAGAAATAGTCAAAGAGATGA
AAATTCCATGGTGCAAGATATTTTCTTCAACAGCTGTCTGGGCTATTATC
ACTTGTAATTTTGTAAAAAGTTGGATGTTCATTTTAATGCTTACCAATGA
ACCAGTTTATTTGAATCAATTCAAGTTCACCATGGTCGAAAATGGAGTAT
TCTCCGCATTACCTCACATTTTGAAAGTAATTATCGCTTCTGTTAGTGGG
TATTTGGTAGAAATTCTATTAAATCTCAACAAAATATCAAAAACAAATGT
TCGAAAGCTATTTAACACATTAGGCTTCGGAATAGAATCTTTAATGTGTT
ATTTTTTGGTATTTGCAAATACTGGAATTGAAGCGGTGGTTTTTTTATGC
ATTGGAATTGGATTTAGTGGCCTTGCTGTGTCAGGATGGCAGATTAATTT
TTTAGATATTGCACCAGAATTTTCTGGGGTTATAGCAGGAATATCTGCTA
CTTTTGGTACATTTGGAGGTATTTTAAGTCCTATTCTAGTTGGTTTAATA
ACACACCCGCAAACTCTGGCAAATTGGCAATATTCCTTTATTTTGACCGG
ATCAGTTCTAGCTTTTGGTGTTTTTATATTCGCAATTTTCGGGAGAGGTG
ACCGCCTAAACTGGAATTCAGAAGAGGAAATTATACTTTTAGAGAAAAAA
TAACAATTTATTGTTTATGATATGGGTTTTTTGATCTTTTATCATAAAAT
TATTTTTTGATGATTTATCAAATAAATTATTTACAATCGAAAAA
back to top

protein sequence of SMED30034265-orf-1

>SMED30034265-orf-1 ID=SMED30034265-orf-1|Name=SMED30034265-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=494bp
MNVPEMGNPMTNEKENKPSAINGENISKDNHSADNKEMKEDKNKDLYFPR
RFIVVALCWSGLLIVHAMRVNVGITVVTILDTDAHSKVGSEAAILSLPKV
TWNSKMIGVLHSIFYIGFIITQIPGGYISRKSYSTKLFSLGIVISCILNV
LLPIGIQNANYYFTCFIRLCQGLSEGLIFPALYKIMHNWFPNRSVHKYGG
WIFGGMYAGPIIGFPLDGLIIHYWKWPYVFYLHSLTGIIWFILSYLLFYE
NPSTHPSISENELSYLLSHQEIVKEMKIPWCKIFSSTAVWAIITCNFVKS
WMFILMLTNEPVYLNQFKFTMVENGVFSALPHILKVIIASVSGYLVEILL
NLNKISKTNVRKLFNTLGFGIESLMCYFLVFANTGIEAVVFLCIGIGFSG
LAVSGWQINFLDIAPEFSGVIAGISATFGTFGGILSPILVGLITHPQTLA
NWQYSFILTGSVLAFGVFIFAIFGRGDRLNWNSEEEIILLEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 275..478
e-value: 2.8E-20
score: 74.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 48..259
e-value: 5.6E-30
score: 106.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 36..485
NoneNo IPR availablePANTHERPTHR11662:SF418VESICULAR GLUTAMATE TRANSPORTER, ISOFORM Acoord: 36..485
NoneNo IPR availableCDDcd17318MFS_SLC17coord: 57..474
e-value: 3.08925E-90
score: 278.733
NoneNo IPR availableTMHMMTMhelixcoord: 454..473
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 137..156
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 363..381
NoneNo IPR availableTMHMMTMhelixcoord: 52..74
NoneNo IPR availableTMHMMTMhelixcoord: 227..249
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 61..437
e-value: 1.8E-45
score: 155.4
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 61..478
score: 15.631
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 31..477