Eukaryotic translation initiation factor 3 subunit I

Overview
NameEukaryotic translation initiation factor 3 subunit I
Smed IDSMED30034258
Length (bp)952
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 3 subunit I (SMED30034258) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit I (SMED30034258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 3 subunit I (SMED30034258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 3 subunit I (SMED30034258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034258

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034258SMESG000034899.1 dd_Smed_v4_721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034258SMESG000034899.1 dd_Smed_v4_721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034258SMESG000034899.1 dd_Smed_v4_721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034258SMESG000034899.1 dd_Smed_v4_721_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034258SMESG000034899.1 Contig49537uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034258SMESG000034899.1 Contig49537newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Match: EIF3I (eukaryotic translation initiation factor 3 subunit I [Source:HGNC Symbol;Acc:HGNC:3272])

HSP 1 Score: 204.142 bits (518), Expect = 4.385e-63
Identity = 96/193 (49.74%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I  + P  ++ C    KIT+ +WGP+   I  GH++G+L +++ K+      +  H+  I D+Q SRD TMF+T+SKD TAKLF++  +E  K +  +RP+NSAA+SP+ +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YFEFE E
Sbjct:  133 IDNNEPYMKIPCNDS-KITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Match: STRAP (serine/threonine kinase receptor associated protein [Source:HGNC Symbol;Acc:HGNC:30796])

HSP 1 Score: 65.0846 bits (157), Expect = 3.003e-11
Identity = 45/165 (27.27%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++  TM+  + +N    S++ M+   +  + + +     A   +A  ++ +K + A   +NSA++ P++E  L+ GG++             F+   Y      E+ S KGHFGPI+ V F+P G  YASG E+G +R++Q
Sbjct:  146 IKKALWCSEDKQILSA-DDKTVRLWDHATMTEVKSLN-FNMSVSSMEYIPEGEILVITYGRSIA-FHSAVSLDPIKSFEAPATINSASLHPEKE-FLVAGGED-------------FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQ 293          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Match: STRAP (serine/threonine kinase receptor associated protein [Source:HGNC Symbol;Acc:HGNC:30796])

HSP 1 Score: 65.0846 bits (157), Expect = 3.289e-11
Identity = 45/165 (27.27%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++  TM+  + +N    S++ M+   +  + + +     A   +A  ++ +K + A   +NSA++ P++E  L+ GG++             F+   Y      E+ S KGHFGPI+ V F+P G  YASG E+G +R++Q
Sbjct:  159 IKKALWCSEDKQILSA-DDKTVRLWDHATMTEVKSLN-FNMSVSSMEYIPEGEILVITYGRSIA-FHSAVSLDPIKSFEAPATINSASLHPEKE-FLVAGGED-------------FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQ 306          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Match: STRAP (serine/threonine kinase receptor associated protein [Source:HGNC Symbol;Acc:HGNC:30796])

HSP 1 Score: 50.447 bits (119), Expect = 1.262e-7
Identity = 21/38 (55.26%), Postives = 28/38 (73.68%), Query Frame = 3
Query:  786 NEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
             E+ S KGHFGPI+ V F+P G  YASG E+G +R++Q
Sbjct:   23 EELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQ 60          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Match: FP565260.1 (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:102724159])

HSP 1 Score: 54.6842 bits (130), Expect = 1.415e-7
Identity = 36/159 (22.64%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P    I TG D+G++  +N  +         H++ +T +  +    + +TSS D T + F+ +     + +T+ RP   + ++ D           + E+  +A ++  FE   + M     +  + GH GPI+ + FNP  +  AS   +  VR++
Sbjct:  381 YSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATGYVVVTSSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVD----------ASGEIV-SAGAQDSFEIFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSVLASASWDKTVRLW 528          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Celegans
Match: eif-3.I (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:Q965S8])

HSP 1 Score: 159.458 bits (402), Expect = 2.824e-46
Identity = 72/178 (40.45%), Postives = 119/178 (66.85%), Query Frame = 3
Query:  408 TNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKIN--AHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            T  ++  +D ++  G ++G L +++++        N   H  S+ D+Q S      I++S+D+TA L +  D++ +K+Y ++RP+NSA ISP+R+HI LGGG++A +VT+T+ S G FEA  YHM+FE E    KGHFGPIN++A++P+G   A+GGE+G +R+ +FD+DY  F  ++
Sbjct:  150 TTALFTQMDDLVTIGFESGLLQQYDLRNPDTPIHTNESVHRYSVQDLQLSPRGDFLISASRDKTAALLDVNDLKKLKQYKSERPVNSACISPNRDHICLGGGEDAMQVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGTIIATGGEDGYIRIQEFDEDYLGFTYDF 327          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Celegans
Match: eif-3.I (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:Q965S8])

HSP 1 Score: 83.9593 bits (206), Expect = 1.749e-20
Identity = 36/72 (50.00%), Postives = 53/72 (73.61%), Query Frame = 3
Query:  720 EVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            +VT+T+ S G FEA  YHM+FE E    KGHFGPIN++A++P+G   A+GGE+G +R+ +FD+DY  F  ++
Sbjct:    2 QVTQTSVSAGHFEAKIYHMVFEEEFARFKGHFGPINTMAWHPSGTIIATGGEDGYIRIQEFDEDYLGFTYDF 73          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Match: eIF3i (gene:FBgn0015834 transcript:FBtr0079053)

HSP 1 Score: 200.675 bits (509), Expect = 4.592e-62
Identity = 96/191 (50.26%), Postives = 133/191 (69.63%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVI-FKITNCIWGPVDSVIYTGHDNGQLCRFNM-KTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFE 920
            ++E  P  R+  P+   KIT+ +WGP+D  I TGHDNG +  +++ K     +    H+A I DMQ S+D TMF+T+SKD TAKLF++  +  +K Y  +RP+NSAAISP  +H++LGGGQ+A EVT T+   GKF++ F+H+I+E E   +KGHFGPINS+AF+P G  YASGGE+G VR+  FD  YFE
Sbjct:  134 LSEQEPTLRI--PMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQKVVDSGTDHSAGINDMQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE 322          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Match: wmd (gene:FBgn0034876 transcript:FBtr0113112)

HSP 1 Score: 65.855 bits (159), Expect = 6.534e-12
Identity = 38/120 (31.67%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  540 MQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            ++ S DN + +T S   +   +    ++ +K+      + SA++ PD+ H+ + GG++             F+   +  I  NEI S KGHFGP++SV F+P G  YASG E+G +R++Q
Sbjct:  193 LEISSDNHI-LTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDK-HVFVCGGED-------------FKMYKFDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQ 297          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Match: wmd (gene:FBgn0034876 transcript:FBtr0072114)

HSP 1 Score: 65.855 bits (159), Expect = 6.534e-12
Identity = 38/120 (31.67%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  540 MQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            ++ S DN + +T S   +   +    ++ +K+      + SA++ PD+ H+ + GG++             F+   +  I  NEI S KGHFGP++SV F+P G  YASG E+G +R++Q
Sbjct:  193 LEISSDNHI-LTISHGSSISFWEIDTLKKLKEVKVPTNVASASLHPDK-HVFVCGGED-------------FKMYKFDYITGNEIESFKGHFGPVHSVKFSPDGELYASGSEDGTLRLWQ 297          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Match: CG12325 (gene:FBgn0033557 transcript:FBtr0345930)

HSP 1 Score: 54.6842 bits (130), Expect = 6.891e-8
Identity = 35/155 (22.58%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  441 IYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDRE-HILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNP--TGAGYASGGEEGLVRMY 896
            I TG ++ ++  +N ++       + HT+ +T +Q SR+    ++SS D T + F+       + +T+  P   + ++ D    +++ GGQ+  ++   +   GK             +  + GH GP+ S+AF+P  T +   SG  +  V+++
Sbjct:  408 IATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQFSCVAVDYSGELVVAGGQDVFDIFLWSVKTGKL------------LEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIW 550          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Match: CG12325 (gene:FBgn0033557 transcript:FBtr0088227)

HSP 1 Score: 54.6842 bits (130), Expect = 6.891e-8
Identity = 35/155 (22.58%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  441 IYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDRE-HILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNP--TGAGYASGGEEGLVRMY 896
            I TG ++ ++  +N ++       + HT+ +T +Q SR+    ++SS D T + F+       + +T+  P   + ++ D    +++ GGQ+  ++   +   GK             +  + GH GP+ S+AF+P  T +   SG  +  V+++
Sbjct:  408 IATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQFSCVAVDYSGELVVAGGQDVFDIFLWSVKTGKL------------LEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIW 550          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Zebrafish
Match: eif3i (eukaryotic translation initiation factor 3, subunit I [Source:NCBI gene;Acc:406263])

HSP 1 Score: 198.749 bits (504), Expect = 3.074e-61
Identity = 95/193 (49.22%), Postives = 133/193 (68.91%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I ++ P   V C    KIT+ +WGP+   +  GH+NG++ +F+ K+    +K   HT  I D+Q+S D TM I++SKD TAK+F++  +E VK +  +RP+NSAAISP  +H+++GGGQEA EVT T+   GKFEA F+H  +E E   VKGHFGPIN VAF+P G  Y+SGGE+G VR++ FD  YF+FE+E
Sbjct:  133 IEDNQPYISVPCSES-KITSAVWGPLGEFVIAGHENGEINQFSAKSGEVLKKAKEHTKQINDIQSSVDLTMIISASKDCTAKMFDSSTLEHVKTFKTERPVNSAAISPIMDHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPHYFDFELE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Zebrafish
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 76.6406 bits (187), Expect = 1.797e-15
Identity = 50/172 (29.07%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFN------MKTMSFDEKINAHTASITDMQASRD-NTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++      +KT+SFD       AS++ M+   D  T+ IT  +  T   +NA+ ++++K   A   ++SA++ PD++  + GG                F+   Y    + E+ S KGHFGP++ V F+P G  YASG E+G +R++Q
Sbjct:  146 IKKALWCNNDQQILSAADDKTIRLWDKNTNEAVKTLSFD-------ASVSSMEYIPDGETLVITYGR--TIAFYNAHSLDLIKTVDAPASIHSASLHPDKDFFVAGGDD--------------FKLYKYDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQ 294          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Zebrafish
Match: pwp2h (PWP2 small subunit processome component [Source:ZFIN;Acc:ZDB-GENE-021031-3])

HSP 1 Score: 49.6766 bits (117), Expect = 3.005e-6
Identity = 33/159 (20.75%), Postives = 73/159 (45.91%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P    + TG D+G++  +N  +         H++ +T++  +    + +++S D T + F+ +     +  T+ RP   ++++ D      G G+        A S+  FE   + M     +  + GH GP++++ F+P  +  AS   +  VR++
Sbjct:  393 YSPDGQYLATGGDDGKVKVWNTNSGLCFVTFTEHSSGVTEVAFTSSGFVVVSASLDGTVRAFDLHRYRNFRTMTSPRPAQFSSLAVD------GSGELVC-----AGSQDSFEIFLWSMQTGRLLEVLSGHEGPVSNLCFSPVQSVLASVSWDKTVRLW 540          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Zebrafish
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:30722])

HSP 1 Score: 47.7506 bits (112), Expect = 8.145e-6
Identity = 41/161 (25.47%), Postives = 72/161 (44.72%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTAD-----RPLNSAAISPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N      V KYT         ++    SP+  +  I+  G  +  +V   A  K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLG---VCKYTIQDDSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLK----------TNHI----GHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 223          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Xenopus
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:548498])

HSP 1 Score: 203.371 bits (516), Expect = 7.342e-63
Identity = 96/193 (49.74%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I ++ P  ++ C    KIT+ +WGP+   I  GH+NG+L +++ K+      I  H+  I D+Q SRD TMF+T+SKD T+KLF++  +E  K +  +RP+NSAAISP  +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINS+AF+P G  Y+SGGE+G VR++ FD  YF+FE E
Sbjct:  133 IEDNEPYMKIPCSES-KITSAVWGPLGENIIAGHENGELNQYSAKSGEIVNSIKEHSKQINDIQTSRDMTMFVTASKDCTSKLFDSTSLEHQKTFRTERPVNSAAISPIYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHVAFEEEFGRVKGHFGPINSLAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Xenopus
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:548498])

HSP 1 Score: 203.371 bits (516), Expect = 7.342e-63
Identity = 96/193 (49.74%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I ++ P  ++ C    KIT+ +WGP+   I  GH+NG+L +++ K+      I  H+  I D+Q SRD TMF+T+SKD T+KLF++  +E  K +  +RP+NSAAISP  +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINS+AF+P G  Y+SGGE+G VR++ FD  YF+FE E
Sbjct:  133 IEDNEPYMKIPCSES-KITSAVWGPLGENIIAGHENGELNQYSAKSGEIVNSIKEHSKQINDIQTSRDMTMFVTASKDCTSKLFDSTSLEHQKTFRTERPVNSAAISPIYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHVAFEEEFGRVKGHFGPINSLAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 48.9062 bits (115), Expect = 5.635e-6
Identity = 41/161 (25.47%), Postives = 72/161 (44.72%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRP-----LNSAAISPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N      V KYT         ++    SP+  +  I+  G  +  +V   A  K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLG---VCKYTVQEESHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLK----------TNHI----GHSGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 223          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 48.1358 bits (113), Expect = 9.062e-6
Identity = 38/156 (24.36%), Postives = 72/156 (46.15%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N    +  + +T    ++    SP+  +  I+  G  +  +V   A  K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGDDTPESHT--EWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLK----------TNHI----GHSGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 219          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Match: Eif3i (eukaryotic translation initiation factor 3, subunit I [Source:MGI Symbol;Acc:MGI:1860763])

HSP 1 Score: 203.756 bits (517), Expect = 4.249e-63
Identity = 95/193 (49.22%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I  + P  ++ C    KIT+ +WGP+   +  GH++G+L +++ K+      +  H+  I D+Q SRD TMF+T+SKD TAKLF++  +E  K +  +RP+NSAA+SP+ +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YFEFE E
Sbjct:  133 IDSNEPYMKIPCNDS-KITSAVWGPLGECVIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Match: Eif3i (eukaryotic translation initiation factor 3, subunit I [Source:MGI Symbol;Acc:MGI:1860763])

HSP 1 Score: 63.929 bits (154), Expect = 6.559e-12
Identity = 28/66 (42.42%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAK 599
            KIT+ +WGP+   +  GH++G+L +++ K+      +  H+  I D+Q SRD TMF+T+SKD TAK
Sbjct:  100 KITSAVWGPLGECVIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAK 165          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Match: Strap (serine/threonine kinase receptor associated protein [Source:MGI Symbol;Acc:MGI:1329037])

HSP 1 Score: 66.2402 bits (160), Expect = 8.799e-12
Identity = 46/165 (27.88%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++  TM+  + +N    S++ M+   +  + + +     A   +A  +E +K + A   +NSA++ P++E  L+ GG++             F+   Y      E+ S KGHFGPI+ V F+P G  YASG E+G +R++Q
Sbjct:  146 IKKALWCSDDKQILSA-DDKTVRLWDHATMTEVKSLN-FNMSVSSMEYIPEGEILVITYGRSIA-FHSAVSLEPIKSFEAPATINSASLHPEKE-FLVAGGED-------------FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQ 293          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Match: Pwp2 (PWP2 periodic tryptophan protein homolog (yeast) [Source:MGI Symbol;Acc:MGI:1341200])

HSP 1 Score: 50.8322 bits (120), Expect = 1.378e-6
Identity = 35/159 (22.01%), Postives = 73/159 (45.91%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P    I TG D+G++  +N  +      +  H++ +T +  +    + +TSS D T + F+ +     + +T+ RP   + ++ D           + E+  +A ++  FE   + M     +  + GH GP++ + FNP  +  AS   +  VR++
Sbjct:  381 YSPDGQYIVTGGDDGKVKVWNTLSGFCFVTLTEHSSGVTGVTFTTTGHVIVTSSLDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVD----------SSGEIV-SAGAQDSFEIFVWSMQTGRLLDVLSGHEGPVSGLCFNPMKSILASASWDKTVRLW 528          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Match: Rack1 (receptor for activated C kinase 1 [Source:MGI Symbol;Acc:MGI:101849])

HSP 1 Score: 49.2914 bits (116), Expect = 2.867e-6
Identity = 42/161 (26.09%), Postives = 73/161 (45.34%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAI-----SPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N      V KYT     +S  +     SP+  +  I+  G  +  +V   A  K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLG---VCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLK----------TNHI----GHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 223          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Match: sp|Q1HPW4|EIF3I_BOMMO (Eukaryotic translation initiation factor 3 subunit I OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.301e-66
Identity = 94/178 (52.81%), Postives = 133/178 (74.72%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            K+T+ IWG +D  I TGH+ G L +++++T      +  HT  ITDMQ SRD TMF+T+SKD TAKLF+   +E++K+Y  +RP+NSAA+SP  +H++LGGGQ+A EVT T+  +GKF+A F+H++FE E   VKGHFGPINS+AF+P G  YASGGE+G VR++ FD+ YF++  +Y
Sbjct:  149 KVTSMIWGSLDETIITGHEAGDLIQWDLRTGKKIHSVKEHTHQITDMQLSRDGTMFVTASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYFDYTFDY 326          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Match: sp|B5FZ19|EIF3I_TAEGU (Eukaryotic translation initiation factor 3 subunit I OS=Taeniopygia guttata OX=59729 GN=EIF3I PE=2 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 5.526e-64
Identity = 100/193 (51.81%), Postives = 133/193 (68.91%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I  + P  ++ C    KIT+ +WGP+   I  GH+NG+L +F+ K+      I  HT  I D+Q SRD TMFIT+SKD TAKLF+   ++ +K +  +RP+NSAA+SP  +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YFEFE E
Sbjct:  133 IENNEPYMKIPCSDS-KITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKEHTKQINDIQTSRDMTMFITASKDNTAKLFDCTSLKHLKTFRTERPVNSAALSPIFDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Match: sp|A7RM20|EIF3I_NEMVE (Eukaryotic translation initiation factor 3 subunit I OS=Nematostella vectensis OX=45351 GN=v1g239264 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 6.521e-64
Identity = 91/178 (51.12%), Postives = 132/178 (74.16%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            K+T  +WGP+D  + TGH+NG+LC++++K+ +    +  H+  I D+Q  +D+TMF+T+SKD TAKLF+   +  +K Y  DRP+NSAA+SP ++H+++GGGQEA EVT T+   GKF+A F+H++FE EI  VKGHFGPINS+AF+P G  Y+SGGE+G VR++ FD  Y + E EY
Sbjct:  144 KVTAGLWGPLDQFLVTGHENGELCQWDVKSGNKLISVQEHSKQINDIQMYKDSTMFVTASKDTTAKLFDTDSLRHLKTYKTDRPVNSAALSPIKDHVVVGGGQEAMEVTTTSTRVGKFDARFFHVVFEEEIGRVKGHFGPINSLAFHPDGRSYSSGGEDGYVRIHSFDPSYDDIEFEY 321          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Match: sp|Q5E966|EIF3I_BOVIN (Eukaryotic translation initiation factor 3 subunit I OS=Bos taurus OX=9913 GN=EIF3I PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 6.442e-63
Identity = 97/193 (50.26%), Postives = 133/193 (68.91%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I  + P  R+ C    KIT+ +WGP+   I  GH+ G+L +++ K+      +  H+  I D+Q SRD TMF+T+SKD TAKLF++  +E  K +  +RP+NSAA+SP+ +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YFEFE E
Sbjct:  133 IDSNEPYMRIPCNDS-KITSAVWGPLGECIIAGHEGGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Match: sp|B0BNA7|EIF3I_RAT (Eukaryotic translation initiation factor 3 subunit I OS=Rattus norvegicus OX=10116 GN=Eif3i PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.558e-62
Identity = 96/193 (49.74%), Postives = 134/193 (69.43%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I  + P  ++ C    KIT+ +WGP+   I  GH++G+L +++ K+      +  H+  I D+Q SRD TMF+T+SKD TAKLF++  +E  K +  +RP+NSAA+SP+ +H++LGGGQEA +VT T+   GKFEA F+H+ FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YFEFE E
Sbjct:  133 IDSNEPYMKIPCNDS-KITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTSLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Match: A0A3S2NSE3 (Uncharacterized protein OS=Chilo suppressalis OX=168631 GN=evm_000066 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.084e-66
Identity = 98/196 (50.00%), Postives = 139/196 (70.92%), Query Frame = 3
Query:  354 IAESSPM--WRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            I+  SP+  W +      K+T+ +WG +D  I TGH+ G L +++++T      +  HT  I DMQ SRD TMFIT+SKDQTAKLF+   +E++K+Y  +RP+NSAA+SP  +H++LGGGQ+A EVT T+  +GKF+A F+H++FE E   VKGHFGPINS+AF+P G  YASGGE+G VR+  FD+ YF++  +Y
Sbjct:   26 ISTQSPILKWEITDS---KVTSMVWGTLDETIITGHEAGDLIQWDLRTGKKVHSVKEHTHQINDMQLSRDGTMFITASKDQTAKLFDTSSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVQSFDQSYFDYTFDY 218          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Match: A0A1S8WN81 (WD domain, G-beta repeat protein OS=Opisthorchis viverrini OX=6198 GN=X801_08241 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 3.274e-66
Identity = 98/194 (50.52%), Postives = 135/194 (69.59%), Query Frame = 3
Query:  345 FV*IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFE 926
            FV ++ +SP+ RV      K+T  IWGP++  I  GHD+G L   ++++      I +H   +TD+Q      MFIT SKD TAKL++AYD+  ++ YT +RP+NSAAISP R+H+LLGGGQEA EVT TA  +GKF+A FYH+I++ E   VKGHFGPINSV+F P G G+A+GGEEG VR++ FD +Y + +
Sbjct:    9 FVQLSGASPVLRVFSADKTKVTGAIWGPLNKTIICGHDSGALTVLDVRSGQVLHHIASHKGPVTDIQMHLHLPMFITGSKDHTAKLYSAYDLSSIRTYTTERPINSAAISPTRDHVLLGGGQEAHEVTTTAVGQGKFDARFYHLIYQEEFGRVKGHFGPINSVSFTPDGTGFATGGEEGYVRLHTFDPEYADLD 202          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Match: H2KU59 (Translation initiation factor 3 subunit I OS=Clonorchis sinensis OX=79923 GN=CLF_107848 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 9.918e-66
Identity = 96/191 (50.26%), Postives = 134/191 (70.16%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFE 926
            ++ +SP+ RV      K+T  IWGP++  I  GHD+G L   ++++     +I +H   +TD+Q      MFIT SKD TAKL++AYD+  ++ YT +RP+NSAAISP R+H+LLGGGQEA EVT TA  +GKF+A FYH+I++ E   VKGHFGPINSV+F P G G+A+GGEEG VR++ FD +Y + +
Sbjct:    5 LSGASPVLRVFSADKTKVTGAIWGPLNKTIICGHDSGALTVLDVRSGQVLHQIASHKGPVTDIQMHLHLPMFITGSKDHTAKLYSAYDLSSIRTYTTERPINSAAISPTRDHVLLGGGQEAHEVTTTAVGQGKFDARFYHLIYQEEFGRVKGHFGPINSVSFTPDGTGFATGGEEGYVRLHTFDLEYADLD 195          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Match: A0A0K8SIG7 (Uncharacterized protein OS=Lygus hesperus OX=30085 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.337e-65
Identity = 95/191 (49.74%), Postives = 135/191 (70.68%), Query Frame = 3
Query:  363 SSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            S P+  +  P  +K+T   WGP+D  I TGH+NG+LC+++++      +++ H  SI DMQ S+D+ MF+T+S D TAKLF+   +  +K Y  +RP+NSAAISP  +H++LGGGQEA+ VT T+   GKF++ FYH++FE E   VKGHFGPINS+AF+P G GYA+GGE+G VR+  FD  YFEF  ++
Sbjct:   12 SDPILHIPVPE-YKVTAMQWGPIDETIVTGHENGRLCQWDIRMSKKLNEVDGHQGSINDMQMSKDSMMFVTASSDHTAKLFDTESLMHLKTYQTERPVNSAAISPILDHVVLGGGQEASVVTTTSTRVGKFDSRFYHLVFEEEFARVKGHFGPINSLAFHPDGRGYATGGEDGYVRIQSFDASYFEFNFDF 201          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Match: T1IKC0 (Eukaryotic translation initiation factor 3 subunit I OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.874e-65
Identity = 91/177 (51.41%), Postives = 136/177 (76.84%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            K+T+C+WGPVD    TGH+NG++ +F++KT    + +  H+ +I D+Q ++D TMFI++SKD TA+L++   +E++K Y  +RP+NSAAISP R+H++LGGGQEA +VT T+A  GKF+A FYH++FE E   +KGHFGPIN+V F+P G  Y+SGGE+G +R++ FD  YF+F++E
Sbjct:  151 KVTSCMWGPVDEYFITGHENGEIAQFDLKTSEKMKSVREHSLAINDLQFNKDQTMFISASKDHTARLYDTESLEVMKVYKTERPVNSAAISPIRDHVVLGGGQEAMDVTTTSARIGKFDARFYHLVFEEEFGRIKGHFGPINTVMFHPDGKSYSSGGEDGYIRIHNFDPQYFDFQME 327          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Match: eif3i (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:103045556])

HSP 1 Score: 204.142 bits (518), Expect = 2.146e-63
Identity = 95/193 (49.22%), Postives = 133/193 (68.91%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I ++ P   + C    KIT+ +WGP+   +  GH+NG++ +F+ K+    +KI  HT  I D+Q S D TMFIT+SKD  AK+F+   ++ +K +  +RP+NSAAISP+ EH+++GGGQEA EVT T+   GKFEA F+H  +E E   VKGHFGPIN VAF+P G  Y+SGGE+G VR++ FD  YF+FE+E
Sbjct:  133 IEDNQPYLSIPCSES-KITSAVWGPLGEFVVAGHENGEINQFSAKSGEIVKKIKEHTKQINDIQTSVDLTMFITASKDCAAKMFDTTSLDHIKSFKTERPVNSAAISPNMEHVVMGGGQEAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFELE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:111193019])

HSP 1 Score: 69.3218 bits (168), Expect = 4.682e-13
Identity = 44/171 (25.73%), Postives = 83/171 (48.54%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFN------MKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            +   +W   D  I +  D+  +  ++      +KT+SF+       AS++ M+   D  + + +   +T   + A+ ++ +K   A   ++SA++ PD++  + GG                F+   Y    + E+ S KGHFGP++ V F+P G  YASG E+G +R++Q
Sbjct:  146 VKKALWCNNDQQILSAADDRTIRLWDRNTGEAVKTLSFE-------ASVSSMEYIPDGEILVITYG-RTIAFYKAHTLDPIKTVDAPASIHSASLHPDKDFFVAGGDD--------------FKLYKYDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQ 294          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Match: pwp2h (PWP2, small subunit processome component [Source:NCBI gene;Acc:103032036])

HSP 1 Score: 52.7582 bits (125), Expect = 2.653e-7
Identity = 35/170 (20.59%), Postives = 76/170 (44.71%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEI 929
            + P    + TG D+G++  +N  +         HT+S+T++  +    + +++S D T + F+ +     +  T+ RP   ++++ D    L+  G           ++  FE   + M     +  + GH GP++ + F+P  +  AS   +  VR+++    +   EI
Sbjct:  409 YSPDGQYLATGGDDGKVKVWNTTSGLCFVTFTEHTSSVTNVTFTNSGFVVVSASMDGTVRAFDLHRYRNFRTMTSPRPTQFSSLAVDVSGELVCAG-----------AQDSFEIFLWSMQTGRLLEVLSGHEGPVSCLCFSPVQSVLASASWDKTVRLWEMLDSWQTREI 567          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Match: pwp2h (PWP2, small subunit processome component [Source:NCBI gene;Acc:103032036])

HSP 1 Score: 52.7582 bits (125), Expect = 3.160e-7
Identity = 35/170 (20.59%), Postives = 76/170 (44.71%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEI 929
            + P    + TG D+G++  +N  +         HT+S+T++  +    + +++S D T + F+ +     +  T+ RP   ++++ D    L+  G           ++  FE   + M     +  + GH GP++ + F+P  +  AS   +  VR+++    +   EI
Sbjct:  397 YSPDGQYLATGGDDGKVKVWNTTSGLCFVTFTEHTSSVTNVTFTNSGFVVVSASMDGTVRAFDLHRYRNFRTMTSPRPTQFSSLAVDVSGELVCAG-----------AQDSFEIFLWSMQTGRLLEVLSGHEGPVSCLCFSPVQSVLASASWDKTVRLWEMLDSWQTREI 555          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Match: rack1 (guanine nucleotide-binding protein subunit beta-2-like 1 [Source:NCBI gene;Acc:103029614])

HSP 1 Score: 48.521 bits (114), Expect = 4.435e-6
Identity = 42/161 (26.09%), Postives = 73/161 (45.34%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAI-----SPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N      V KYT     +S  +     SP+  +  I+  G  +  +V   A  K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLG---VCKYTIQDESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLK----------TNHI----GHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 223          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007457.1 (pep scaffold:Pmarinus_7.0:GL491961:4107:5175:-1 gene:ENSPMAG00000006732.1 transcript:ENSPMAT00000007457.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.234e-20
Identity = 35/57 (61.40%), Postives = 45/57 (78.95%), Query Frame = 3
Query:  765 FYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            F+H++FE E   VKGHFGPINSVAF+P G  Y+SGGE+G VR++ FD  YF+FE E+
Sbjct:    2 FFHLVFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDSQYFDFEFEH 58          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Sea Lamprey
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 71.633 bits (174), Expect = 1.960e-14
Identity = 40/115 (34.78%), Postives = 66/115 (57.39%), Query Frame = 3
Query:  555 DNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            D  + IT S+  T   +NA  +E++K++ A   +NSA++ P++E  + GG  E  ++ K   + G+            E+ S KGHFGP++ V F+P G  YASG E+G +R++Q
Sbjct:  195 DEIVVITYSR--TIAFYNALTLELIKQFEASASINSASLHPEKECFIAGG--EDFKLYKFDYTTGE------------ELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQ 293          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 3.240e-6
Identity = 40/161 (24.84%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  447 TGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRP-----LNSAAISPDREH--ILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDK 908
            +G  +G L  +++ T +   +   HT  +  +  S DN   ++ S+D+T KL+N      V KYT         ++    SP+  +  I+  G  +  +V      K K           N I    GH G +N+V  +P G+  ASGG++G   ++  ++
Sbjct:   80 SGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLG---VCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTNCKLK----------TNHI----GHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNE 223          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Yeast
Match: TIF34 (eIF3i subunit of the eukaryotic translation initiation factor 3 (eIF3); subunit of the core complex of eIF3; essential for translation; stimulates rate of ribosomal scanning during translation reinitiation; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004754])

HSP 1 Score: 176.792 bits (447), Expect = 2.183e-53
Identity = 82/170 (48.24%), Postives = 119/170 (70.00%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKT-MSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFE 926
            W      I  GH +G++ ++++     + + I+ H  SI+DMQ S D T FITSS+D  + L +   ++++KKY  D PLN+A I+P +E I+LGGGQEA +VT T+A++GKFEA FYH IFE EI  V+GHFGP+N+VA +P G  YASGGE+G +R++ F+K YF+F+
Sbjct:  161 WSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFK 330          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Yeast
Match: SIF2 (WD40 repeat-containing subunit of Set3C histone deacetylase complex; complex represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus [Source:SGD;Acc:S000000307])

HSP 1 Score: 47.7506 bits (112), Expect = 1.402e-6
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVK----KYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEIT-SVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            ++T   W    + I TG +NG+L  +N KT +    +N H A I  ++ ++D T  I+   +    L+N     +++    K T    +N+   S D     LG   E  +  K     G   A+F + I E   T  + GH GPI+ + FN T     S  ++G +R++ 
Sbjct:  222 QVTCLAWSHDGNSIVTGVENGELRLWN-KTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGGSSINAENHSGDGS---LGVDVEWVDDDKFVI-PGPKGAIFVYQITEKTPTGKLIGHHGPISVLEFNDTNKLLLSASDDGTLRIWH 387          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Match: EDO47524 (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:A7RM20])

HSP 1 Score: 207.994 bits (528), Expect = 2.673e-65
Identity = 91/178 (51.12%), Postives = 132/178 (74.16%), Query Frame = 3
Query:  402 KITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            K+T  +WGP+D  + TGH+NG+LC++++K+ +    +  H+  I D+Q  +D+TMF+T+SKD TAKLF+   +  +K Y  DRP+NSAA+SP ++H+++GGGQEA EVT T+   GKF+A F+H++FE EI  VKGHFGPINS+AF+P G  Y+SGGE+G VR++ FD  Y + E EY
Sbjct:  144 KVTAGLWGPLDQFLVTGHENGELCQWDVKSGNKLISVQEHSKQINDIQMYKDSTMFVTASKDTTAKLFDTDSLRHLKTYKTDRPVNSAALSPIKDHVVVGGGQEAMEVTTTSTRVGKFDARFFHVVFEEEIGRVKGHFGPINSLAFHPDGRSYSSGGEDGYVRIHSFDPSYDDIEFEY 321          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Match: EDO32418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV44])

HSP 1 Score: 73.559 bits (179), Expect = 1.702e-15
Identity = 46/166 (27.71%), Postives = 83/166 (50.00%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRD-NTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   ++++Y+G D+  +  ++ +T+     I     ++T+M  SRD N + IT     T   +    M+++K +     +  A++ PD+   + GG  E  ++ K     GK            E+ S KGHFGP++ V ++P G  YASG E+G +R++Q
Sbjct:   52 IKTALWNKENNMVYSGGDDKMIRLWDTRTLENTRNIQL-PHNLTNMDMSRDGNVLVITHG--TTVVFYETESMDVIKSFEMPTLVYGASLHPDKSCFVAGG--EDLKIYKFDYDTGK------------ELESYKGHFGPVHCVRYSPDGELYASGSEDGTLRLWQ 200          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Match: EDO45665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS02])

HSP 1 Score: 51.9878 bits (123), Expect = 1.967e-7
Identity = 37/159 (23.27%), Postives = 74/159 (46.54%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P  + I TG D+G++  +N  T       + H+AS+T +  S +  + +++S D T + F+       + + + RP   + ++ D        G+  A     A S+  FE   + +     +  + GH  P++S+AF+P+     SG  +  VR++
Sbjct:  346 YSPDGNYIATGGDDGKVKLWNTMTGFCFVTFHEHSASVTAVTFSPNGQVVLSASLDGTVRAFDLNRYRNFRTFASPRPAQFSTLALD------SSGEVVA-----AGSRDTFEIFVWSIQTGRLLEVLAGHEAPVSSLAFSPSHPVLISGAWDKTVRLW 493          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Match: EDO37614 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFB4])

HSP 1 Score: 47.3654 bits (111), Expect = 4.188e-6
Identity = 45/186 (24.19%), Postives = 80/186 (43.01%), Query Frame = 3
Query:  399 FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSA----AISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPT-GAG---------------YASGGEEGLVRMY 896
            + + +C   P  +++ T   +  L  +N++T      +  HT ++   + S ++   I+ S D+T   F  +D+ + K       L S+    A +PD  HI+ G  +    + +  A KGKF            IT V+GH   + +  F+PT G+                 ASGG + LVR++
Sbjct:   57 YHVNSCSVSPFGTLMATASTDSTLMLWNLETGECLAVLEGHTGAVRVCRFSPNSQFLISGSADET---FIIWDVLLKKPVRCVDKLESSVTACAFTPDGLHIITGTSEGKLAIWE--AQKGKF------------ITQVEGHDMGVGACDFSPTFGSAVPGLSDTSGSAPQFLLASGGNDNLVRLW 225          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Match: EDO27311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9L3])

HSP 1 Score: 44.2838 bits (103), Expect = 8.748e-6
Identity = 37/154 (24.03%), Postives = 68/154 (44.16%), Query Frame = 3
Query:  399 FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSA----AISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPT 848
            + + +C   P  +++ T   +  L  +N++T      +  HT ++   + S ++   I+ S D+T   F  +D+ + K       L S+    A +PD  HI+ G  +    + +  A KGKF            IT V+GH   + +  F+PT
Sbjct:    8 YHVNSCSVSPFGTLMATASTDSTLMLWNLETGECLAVLEGHTGAVRVCRFSPNSQFLISGSADET---FIIWDVLLKKPVRCVDKLESSVTACAFTPDGLHIITGTSEGKLAIWE--AQKGKF------------ITQVEGHDMGVGACDFSPT 144          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Match: EIF3I (eukaryotic translation initiation factor 3 subunit I [Source:NCBI gene;Acc:101173320])

HSP 1 Score: 202.216 bits (513), Expect = 1.168e-62
Identity = 94/193 (48.70%), Postives = 136/193 (70.47%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIE 932
            I +++P   V C    KIT+ +WGP+   +  GH+NG++ +F+ K+    +K+  HT  I D+Q+S D TM IT+SKD +AKLF++  +E +K +  +RP+NSAAISP ++H+++GGGQEA +VT T+   GKFEA F+H  +E E   VKGHFGPIN VAF+P G  Y+SGGE+G VR++ FD  YF+FE+E
Sbjct:  133 IEDNNPYLSVPCNES-KITSAVWGPLGEFVIAGHENGEISQFSAKSGEALKKVKEHTKQINDIQSSVDLTMVITASKDNSAKLFDSTSLENIKTFRTERPVNSAAISPIKDHVVMGGGQEAMDVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQYFDFELE 324          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:101165272])

HSP 1 Score: 75.0998 bits (183), Expect = 5.600e-15
Identity = 44/165 (26.67%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++  +M   + +  +T S++ M+   D  + + +   +T   +NA  +E++K   A  P+NSA++ P+++  + GG                F+   +    + E+ S KGHFGP++ V F+P G  YASG E+G +R++Q
Sbjct:  146 IKKALWCNDDKQILSAADDKTIRLWDRTSMEEVKTLTFNT-SVSSMEYMADGEILVITYG-KTIAFYNALSLELIKTAEAPAPINSASLHPEKDFFVAGGED--------------FKLYKFDYGTQEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQ 294          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:101165272])

HSP 1 Score: 75.0998 bits (183), Expect = 5.922e-15
Identity = 44/165 (26.67%), Postives = 83/165 (50.30%), Query Frame = 3
Query:  405 ITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQ 899
            I   +W   D  I +  D+  +  ++  +M   + +  +T S++ M+   D  + + +   +T   +NA  +E++K   A  P+NSA++ P+++  + GG                F+   +    + E+ S KGHFGP++ V F+P G  YASG E+G +R++Q
Sbjct:  146 IKKALWCNDDKQILSAADDKTIRLWDRTSMEEVKTLTFNT-SVSSMEYMADGEILVITYG-KTIAFYNALSLELIKTAEAPAPINSASLHPEKDFFVAGGED--------------FKLYKFDYGTQEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLWQ 294          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Match: pwp2h (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:101167684])

HSP 1 Score: 50.8322 bits (120), Expect = 1.045e-6
Identity = 33/159 (20.75%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P    I TG D+ ++  +N  +         HT+S+T +  +    + +++S D T + F+ +     + +T+ RP   ++++ D    L+  G           ++  FE   + M     +  + GH GP++ + F+P  +  AS   +  VR++
Sbjct:  378 YSPDGQYIVTGGDDSKVKAWNTSSGLCFVTFTEHTSSVTSVAFTASGFVIVSASLDGTVRAFDLHRYRNFRTFTSPRPAQFSSLAVDVSGELVSAG-----------AQDSFEIFLWSMQTGRLLEVLGGHEGPVSGLCFSPVQSILASSSWDRTVRLW 525          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Match: pwp2h (periodic tryptophan protein 2 homolog [Source:NCBI gene;Acc:101167684])

HSP 1 Score: 50.8322 bits (120), Expect = 1.124e-6
Identity = 33/159 (20.75%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  420 WGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMY 896
            + P    I TG D+ ++  +N  +         HT+S+T +  +    + +++S D T + F+ +     + +T+ RP   ++++ D    L+  G           ++  FE   + M     +  + GH GP++ + F+P  +  AS   +  VR++
Sbjct:  317 YSPDGQYIVTGGDDSKVKAWNTSSGLCFVTFTEHTSSVTSVAFTASGFVIVSASLDGTVRAFDLHRYRNFRTFTSPRPAQFSSLAVDVSGELVSAG-----------AQDSFEIFLWSMQTGRLLEVLGGHEGPVSGLCFSPVQSILASSSWDRTVRLW 464          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 407.142 bits (1045), Expect = 3.185e-143
Identity = 193/194 (99.48%), Postives = 193/194 (99.48%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            IAESSPMWRVDCPV FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY
Sbjct:  133 IAESSPMWRVDCPVDFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 326          

HSP 2 Score: 73.559 bits (179), Expect = 1.549e-14
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:    1 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQV 102
            QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQ+
Sbjct:  100 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQI 133          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 407.142 bits (1045), Expect = 5.575e-143
Identity = 193/194 (99.48%), Postives = 193/194 (99.48%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            IAESSPMWRVDCPV FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY
Sbjct:  150 IAESSPMWRVDCPVDFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 343          

HSP 2 Score: 73.1738 bits (178), Expect = 1.925e-14
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:    1 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQV 102
            QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQ+
Sbjct:  117 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQI 150          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 406.757 bits (1044), Expect = 7.817e-143
Identity = 193/194 (99.48%), Postives = 193/194 (99.48%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            IAESSPMWRVDCPV FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY
Sbjct:  144 IAESSPMWRVDCPVDFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 337          

HSP 2 Score: 73.559 bits (179), Expect = 1.729e-14
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:    1 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQV 102
            QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQ+
Sbjct:  111 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQI 144          
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Planmine SMEST
Match: SMESG000034899.1 (SMESG000034899.1)

HSP 1 Score: 405.986 bits (1042), Expect = 6.519e-139
Identity = 193/194 (99.48%), Postives = 193/194 (99.48%), Query Frame = 3
Query:  354 IAESSPMWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 935
            IAESSPMWRVDCPV FKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY
Sbjct:  396 IAESSPMWRVDCPVDFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAHTASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAISPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGPINSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY 589          

HSP 2 Score: 73.1738 bits (178), Expect = 4.147e-14
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:    1 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQV 102
            QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQ+
Sbjct:  363 QFGYSGNTILMTTDNIKNQKCEMMVFDIRDKKQI 396          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3I4.385e-6349.74eukaryotic translation initiation factor 3 subunit... [more]
STRAP3.003e-1127.27serine/threonine kinase receptor associated protei... [more]
STRAP3.289e-1127.27serine/threonine kinase receptor associated protei... [more]
STRAP1.262e-755.26serine/threonine kinase receptor associated protei... [more]
FP565260.11.415e-722.64periodic tryptophan protein 2 homolog [Source:NCBI... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eif-3.I2.824e-4640.45Eukaryotic translation initiation factor 3 subunit... [more]
eif-3.I1.749e-2050.00Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF3i4.592e-6250.26gene:FBgn0015834 transcript:FBtr0079053[more]
wmd6.534e-1231.67gene:FBgn0034876 transcript:FBtr0113112[more]
wmd6.534e-1231.67gene:FBgn0034876 transcript:FBtr0072114[more]
CG123256.891e-822.58gene:FBgn0033557 transcript:FBtr0345930[more]
CG123256.891e-822.58gene:FBgn0033557 transcript:FBtr0088227[more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif3i3.074e-6149.22eukaryotic translation initiation factor 3, subuni... [more]
strap1.797e-1529.07serine/threonine kinase receptor associated protei... [more]
pwp2h3.005e-620.75PWP2 small subunit processome component [Source:ZF... [more]
rack18.145e-625.47receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif3i7.342e-6349.74eukaryotic translation initiation factor 3 subunit... [more]
eif3i7.342e-6349.74eukaryotic translation initiation factor 3 subunit... [more]
rack15.635e-625.47receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack19.062e-624.36receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif3i4.249e-6349.22eukaryotic translation initiation factor 3, subuni... [more]
Eif3i6.559e-1242.42eukaryotic translation initiation factor 3, subuni... [more]
Strap8.799e-1227.88serine/threonine kinase receptor associated protei... [more]
Pwp21.378e-622.01PWP2 periodic tryptophan protein homolog (yeast) [... [more]
Rack12.867e-626.09receptor for activated C kinase 1 [Source:MGI Symb... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1HPW4|EIF3I_BOMMO1.301e-6652.81Eukaryotic translation initiation factor 3 subunit... [more]
sp|B5FZ19|EIF3I_TAEGU5.526e-6451.81Eukaryotic translation initiation factor 3 subunit... [more]
sp|A7RM20|EIF3I_NEMVE6.521e-6451.12Eukaryotic translation initiation factor 3 subunit... [more]
sp|Q5E966|EIF3I_BOVIN6.442e-6350.26Eukaryotic translation initiation factor 3 subunit... [more]
sp|B0BNA7|EIF3I_RAT1.558e-6249.74Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S2NSE33.084e-6650.00Uncharacterized protein OS=Chilo suppressalis OX=1... [more]
A0A1S8WN813.274e-6650.52WD domain, G-beta repeat protein OS=Opisthorchis v... [more]
H2KU599.918e-6650.26Translation initiation factor 3 subunit I OS=Clono... [more]
A0A0K8SIG72.337e-6549.74Uncharacterized protein OS=Lygus hesperus OX=30085... [more]
T1IKC04.874e-6551.41Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif3i2.146e-6349.22eukaryotic translation initiation factor 3 subunit... [more]
strap4.682e-1325.73serine/threonine kinase receptor associated protei... [more]
pwp2h2.653e-720.59PWP2, small subunit processome component [Source:N... [more]
pwp2h3.160e-720.59PWP2, small subunit processome component [Source:N... [more]
rack14.435e-626.09guanine nucleotide-binding protein subunit beta-2-... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000007457.13.234e-2061.40pep scaffold:Pmarinus_7.0:GL491961:4107:5175:-1 ge... [more]
strap1.960e-1434.78serine/threonine kinase receptor associated protei... [more]
ENSPMAT00000002506.13.240e-624.84pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TIF342.183e-5348.24eIF3i subunit of the eukaryotic translation initia... [more]
SIF21.402e-626.90WD40 repeat-containing subunit of Set3C histone de... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475242.673e-6551.12Eukaryotic translation initiation factor 3 subunit... [more]
EDO324181.702e-1527.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456651.967e-723.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376144.188e-624.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273118.748e-624.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF3I1.168e-6248.70eukaryotic translation initiation factor 3 subunit... [more]
strap5.600e-1526.67serine/threonine kinase receptor associated protei... [more]
strap5.922e-1526.67serine/threonine kinase receptor associated protei... [more]
pwp2h1.045e-620.75periodic tryptophan protein 2 homolog [Source:NCBI... [more]
pwp2h1.124e-620.75periodic tryptophan protein 2 homolog [Source:NCBI... [more]
back to top
BLAST of Eukaryotic translation initiation factor 3 subunit I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000034899.13.185e-14399.48SMESG000034899.1[more]
SMESG000034899.15.575e-14399.48SMESG000034899.1[more]
SMESG000034899.17.817e-14399.48SMESG000034899.1[more]
SMESG000034899.16.519e-13999.48SMESG000034899.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034258 ID=SMED30034258|Name=Eukaryotic translation initiation factor 3 subunit I|organism=Schmidtea mediterranea sexual|type=transcript|length=952bp
CAGTTTGGGTATAGTGGTAATACAATTCTGATGACCACTGATAATATTAA
AAACCAAAAATGTGAAATGATGGTATTTGATATTAGAGATAAAAAACAGG
TAAATTATAAGAGATTTACTTTGTTATTGATAATTTAACAAAGAATATTT
AATATTATTTTTATTGATATTGAAATATTGTTATAATTGAGTATCTTATT
AATTCCCTTTTTTCGTATATATTAATTGGAATTATTATTTCATCTATGCA
ATTAGTTAGTTGATTCATATTAATAATTAATGTCTCAGTGGATATTTACA
GTGGATAATCTCATGATAATAGTCTACAATATACGAATTTTCTATTTGTT
TAGATCGCCGAATCCTCTCCAATGTGGCGTGTTGATTGCCCAGTTATTTT
TAAAATTACCAATTGTATATGGGGACCTGTGGATAGTGTTATTTATACTG
GGCATGATAATGGCCAGTTGTGTCGGTTTAACATGAAAACTATGAGCTTC
GATGAGAAAATCAATGCCCACACTGCCAGCATCACTGACATGCAAGCCAG
CCGCGACAATACAATGTTTATCACTTCATCTAAAGATCAGACAGCAAAAC
TGTTCAATGCCTACGACATGGAAATGGTGAAGAAATATACCGCTGATCGT
CCGCTGAATTCCGCTGCAATAAGTCCTGATCGGGAGCACATCTTACTTGG
TGGTGGTCAGGAAGCAGCTGAAGTGACAAAAACGGCAGCCAGTAAAGGGA
AATTTGAGGCCCTGTTCTATCACATGATATTCGAGAATGAAATCACGAGT
GTTAAAGGTCATTTCGGTCCGATTAATAGCGTTGCTTTCAATCCTACTGG
AGCGGGATACGCGTCAGGAGGAGAGGAAGGTCTGGTGAGGATGTATCAAT
TTGACAAGGATTATTTTGAATTCGAAATCGAATATTAATGATGAATAATT
GC
back to top

protein sequence of SMED30034258-orf-1

>SMED30034258-orf-1 ID=SMED30034258-orf-1|Name=SMED30034258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MWRVDCPVIFKITNCIWGPVDSVIYTGHDNGQLCRFNMKTMSFDEKINAH
TASITDMQASRDNTMFITSSKDQTAKLFNAYDMEMVKKYTADRPLNSAAI
SPDREHILLGGGQEAAEVTKTAASKGKFEALFYHMIFENEITSVKGHFGP
INSVAFNPTGAGYASGGEEGLVRMYQFDKDYFEFEIEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001732formation of cytoplasmic translation initiation complex
GO:0002183cytoplasmic translational initiation
GO:0006412translation
GO:0006413translational initiation
Vocabulary: cellular component
TermDefinition
GO:0016282eukaryotic 43S preinitiation complex
GO:0033290eukaryotic 48S preinitiation complex
GO:0005737cytoplasm
GO:0005852eukaryotic translation initiation factor 3 complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003743translation initiation factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 137..176
e-value: 0.0019
score: 27.4
coord: 40..79
e-value: 4.4E-4
score: 29.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 48..79
e-value: 0.032
score: 15.1
coord: 139..175
e-value: 0.002
score: 18.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 47..88
score: 9.573
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 144..178
score: 9.974
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 5..188
e-value: 9.9E-55
score: 188.1
NoneNo IPR availablePANTHERPTHR19877:SF1EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT Icoord: 10..186
NoneNo IPR availablePANTHERPTHR19877WD40 REPEAT PROTEINcoord: 10..186
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 47..88
score: 9.415
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 144..185
score: 9.494
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 8..186