calreticulin-1

Overview
Namecalreticulin-1 (AFJ24760.1)
Smed IDSMED30034254
Length (bp)1429
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of calreticulin-1 (SMED30034254) t-SNE clustered cells

Violin plots show distribution of expression levels for calreticulin-1 (SMED30034254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of calreticulin-1 (SMED30034254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for calreticulin-1 (SMED30034254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034254

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034254SMESG000017261.1 SMESG000017084.1 Contig3842GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034254SMESG000009012.1 Contig3842GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30034254SMESG000009012.1 dd_Smed_v4_220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034254SMESG000009012.1 dd_Smed_v4_220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034254SMESG000009012.1 dd_Smed_v4_220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034254SMESG000009012.1 dd_Smed_v4_220_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034254SMESG000077304.1 SMESG000009012.1 dd_Smed_v6_220_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of calreticulin-1 vs. Ensembl Human
Match: CALR (calreticulin [Source:HGNC Symbol;Acc:HGNC:1455])

HSP 1 Score: 432.18 bits (1110), Expect = 9.279e-149
Identity = 226/347 (65.13%), Postives = 270/347 (77.81%), Query Frame = 3
Query:  132 DPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            +P +Y KE+F   D    +W+ES +K SD GKF+ ++GKFY D +KDKG+QTSQDA+FY +S   E PFSNK +TLVVQF VKHEQ IDCGGGY+KL    LDQ + HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD ++Y     G +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   18 EPAVYFKEQFLDGDGWTSRWIESKHK-SDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. Ensembl Human
Match: CALR3 (calreticulin 3 [Source:HGNC Symbol;Acc:HGNC:20407])

HSP 1 Score: 269.24 bits (687), Expect = 1.854e-85
Identity = 163/359 (45.40%), Postives = 219/359 (61.00%), Query Frame = 3
Query:   87 MYYILVILFSAIV--NADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAM 1154
            M   LV L++  +   A  T+Y +EEF   +  + +W++ST   S  G F  ++GKFY   +KDKG+QT+Q+ +FY IS +  KPFSNK +TLV+Q+ VKHEQ +DCGGGYIK+   D+DQKN +G++ Y IMFGPDICG   KKVHVI ++  K H  KK I CK D F+HLYTLIL+ D +Y+V ID + +ESG+ E DW+    KK   P   K  DW          D K +DW+K     D    K  DW+ ++DG+W AP +  P Y+   KP+ I    +K  W+H ++ N DY     L     IG +G +LWQV+SGTIFDN LITD+ EYA +FG  TW  T   E+ M
Sbjct:    1 MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQST-NDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARF-KPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESK--DW------EQTKDNKAQDWEKH--FLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGI----HKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREM 343          
BLAST of calreticulin-1 vs. Ensembl Human
Match: CALR (calreticulin [Source:HGNC Symbol;Acc:HGNC:1455])

HSP 1 Score: 236.884 bits (603), Expect = 8.416e-75
Identity = 128/183 (69.95%), Postives = 148/183 (80.87%), Query Frame = 3
Query:  480 GPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVG 1028
            GPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD ++Y     G +G
Sbjct:   65 GPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLG 247          
BLAST of calreticulin-1 vs. Ensembl Human
Match: CLGN (calmegin [Source:HGNC Symbol;Acc:HGNC:2060])

HSP 1 Score: 194.897 bits (494), Expect = 5.518e-55
Identity = 141/388 (36.34%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  141 IYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYD-------DMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGK--DLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKI-----------------DNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWR 1127
            +Y  E F +   L  WV S  K  D  + I      ++        +  D+G+     AK + IS  L KPF   D+ L+VQ++V  +  IDCGG YIKL+    DL  +NF+ +T Y IMFGPD CG    K+H IF +         + H    D+  K    D  +HLYTL++  D+T+EVL+D   V  G+  +D       PK+I DPN +KP +W +  K+PD +  KPEDWD+                     PK IPDP A+KP+DW+++ DGEWEAP+I                 DNP+Y+G W+P  +DNPNY+G W   +I NPDY  D+  +L      +G +LW + S   FDN +I  E E A  +    WR
Sbjct:   60 VYFAETFDSG-RLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCG-EDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWR 445          
BLAST of calreticulin-1 vs. Ensembl Human
Match: CLGN (calmegin [Source:HGNC Symbol;Acc:HGNC:2060])

HSP 1 Score: 194.897 bits (494), Expect = 5.518e-55
Identity = 141/388 (36.34%), Postives = 197/388 (50.77%), Query Frame = 3
Query:  141 IYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYD-------DMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGK--DLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKI-----------------DNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWR 1127
            +Y  E F +   L  WV S  K  D  + I      ++        +  D+G+     AK + IS  L KPF   D+ L+VQ++V  +  IDCGG YIKL+    DL  +NF+ +T Y IMFGPD CG    K+H IF +         + H    D+  K    D  +HLYTL++  D+T+EVL+D   V  G+  +D       PK+I DPN +KP +W +  K+PD +  KPEDWD+                     PK IPDP A+KP+DW+++ DGEWEAP+I                 DNP+Y+G W+P  +DNPNY+G W   +I NPDY  D+  +L      +G +LW + S   FDN +I  E E A  +    WR
Sbjct:   60 VYFAETFDSG-RLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCG-EDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWR 445          
BLAST of calreticulin-1 vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 390.963 bits (1003), Expect = 2.583e-133
Identity = 206/333 (61.86%), Postives = 254/333 (76.28%), Query Frame = 3
Query:   87 MYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITD 1085
            M  + ++   A+V+A+  +Y KEEF+ A   K+WV+S +K  D G F  +AGKF+D   +D+GIQTSQDAKFY  + K +K FSNK +TLV+Q+ VKHEQ IDCGGGY+K+M  D D  +FHGETPY +MFGPDICG  T++VHVI NY G+N LIKK+I CK DE +HLYTLIL SDNTYEV ID E  ++G+ E+DWD L  KKI DP+A+KP DW +   + D  D KPEDW+KP+ IPDP AKKPEDWDDEMDGEWE P IDNPEY+G+WKPK+I NP YKG W+HPEI+NP+Y PD+ LY     G +GFDLWQVKSGTIFDNI+ITD
Sbjct:    1 MKSLCLLAIVAVVSAE--VYFKEEFNDASWEKRWVQSKHK-DDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICG-PTRRVHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITD 329          
BLAST of calreticulin-1 vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 390.963 bits (1003), Expect = 2.583e-133
Identity = 206/333 (61.86%), Postives = 254/333 (76.28%), Query Frame = 3
Query:   87 MYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITD 1085
            M  + ++   A+V+A+  +Y KEEF+ A   K+WV+S +K  D G F  +AGKF+D   +D+GIQTSQDAKFY  + K +K FSNK +TLV+Q+ VKHEQ IDCGGGY+K+M  D D  +FHGETPY +MFGPDICG  T++VHVI NY G+N LIKK+I CK DE +HLYTLIL SDNTYEV ID E  ++G+ E+DWD L  KKI DP+A+KP DW +   + D  D KPEDW+KP+ IPDP AKKPEDWDDEMDGEWE P IDNPEY+G+WKPK+I NP YKG W+HPEI+NP+Y PD+ LY     G +GFDLWQVKSGTIFDNI+ITD
Sbjct:    1 MKSLCLLAIVAVVSAE--VYFKEEFNDASWEKRWVQSKHK-DDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICG-PTRRVHVILNYKGENKLIKKEITCKSDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITD 329          
BLAST of calreticulin-1 vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 168.318 bits (425), Expect = 1.418e-45
Identity = 125/345 (36.23%), Postives = 171/345 (49.57%), Query Frame = 3
Query:  258 MDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLM--GKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNY----NGKNHLIKKDIPCK------DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWD-------------KP--------KTIPDPKAKKPXXXXXXXXXXXXAPKIDN-------------------PEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRV 1130
            ++ D G+     A+ + I+ KL  PF+    T VVQ+ +K E+  +CGGGY+KL+  G + D  NF  +T Y IMFGPD CG  T KVH+IF Y    NG       + P        DD  +HL+TL++K    Y V +D + +  GN   D       PK+I D    KP DW +   + DE+  KP+DWD             KP        + I DP+AKKP+DWD++MDG WEAP IDN                   P+Y+G W   +I NP +KG W    IDNP+Y           I  VG ++W +    +FDNILIT   E + D   +T+ V
Sbjct:  106 IEGDLGLIVKTKARHHAIAAKLNTPFAFDANTFVVQYDIKFEEGQECGGGYLKLLSEGAEKDLANFQDKTAYTIMFGPDKCG-ATGKVHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYV 449          
BLAST of calreticulin-1 vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 113.235 bits (282), Expect = 4.779e-27
Identity = 97/271 (35.79%), Postives = 128/271 (47.23%), Query Frame = 3
Query:  474 MFGPDICGIGTKKVHVIFNY----NGKNHLIKKDIPCK------DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWD-------------KP--------KTIPDPKAKKPXXXXXXXXXXXXAPKIDN-------------------PEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRV 1130
            MFGPD CG  T KVH+IF Y    NG       + P        DD  +HL+TL++K    Y V +D + +  GN   D       PK+I D    KP DW +   + DE+  KP+DWD             KP        + I DP+AKKP+DWD++MDG WEAP IDN                   P+Y+G W   +I NP +KG W    IDNP+Y           I  VG ++W +    +FDNILIT   E + D   +T+ V
Sbjct:    1 MFGPDKCG-ATGKVHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYV 270          
BLAST of calreticulin-1 vs. Ensembl Fly
Match: Calr (gene:FBgn0005585 transcript:FBtr0334618)

HSP 1 Score: 435.261 bits (1118), Expect = 1.721e-150
Identity = 232/363 (63.91%), Postives = 270/363 (74.38%), Query Frame = 3
Query:   84 MMYYILVILFSAIVN-ADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            MM+   VI+  A V      +YLKE F   +    W+ S + G + GKF+ T G FY+D + DKGIQTSQDA+FY  S K +  FSN+D+ LVVQF VKHEQ IDCGGGY+KL    LDQ + HGE+PYEIMFGPDICG GTKKVHVIF+Y GKNHLI KDI CKDD ++H YTLI++ DNTYEVLID EKVESGN EDDWDFL PKKI DP A KP DW D   +PD +DKKPEDWDKP+ IPDP A KPEDWDDEMDGEWE P IDNPE++G+W+PK++DNPNYKG W HPEI NP+Y PD+ LYLR EI  +GFDLWQVKSGTIFDN+LITD+ E A     +  + T  GEK MK   D
Sbjct:    1 MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDG-FSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEV-KNTQAGEKKMKEAQD 361          
BLAST of calreticulin-1 vs. Ensembl Fly
Match: Calr (gene:FBgn0005585 transcript:FBtr0082103)

HSP 1 Score: 435.261 bits (1118), Expect = 1.721e-150
Identity = 232/363 (63.91%), Postives = 270/363 (74.38%), Query Frame = 3
Query:   84 MMYYILVILFSAIVN-ADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            MM+   VI+  A V      +YLKE F   +    W+ S + G + GKF+ T G FY+D + DKGIQTSQDA+FY  S K +  FSN+D+ LVVQF VKHEQ IDCGGGY+KL    LDQ + HGE+PYEIMFGPDICG GTKKVHVIF+Y GKNHLI KDI CKDD ++H YTLI++ DNTYEVLID EKVESGN EDDWDFL PKKI DP A KP DW D   +PD +DKKPEDWDKP+ IPDP A KPEDWDDEMDGEWE P IDNPE++G+W+PK++DNPNYKG W HPEI NP+Y PD+ LYLR EI  +GFDLWQVKSGTIFDN+LITD+ E A     +  + T  GEK MK   D
Sbjct:    1 MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDG-FSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEV-KNTQAGEKKMKEAQD 361          
BLAST of calreticulin-1 vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085438)

HSP 1 Score: 176.407 bits (446), Expect = 1.466e-48
Identity = 139/387 (35.92%), Postives = 196/387 (50.65%), Query Frame = 3
Query:  171 DSLKKWVESTYKGSDQGKFIYTAGKFYD-------DMDKDKGIQTSQDAKFYGISYKLEKPFSNK-DRTLVVQFQVKHEQTIDCGGGYIKLM--GKDLDQ-KNFHGETPYEIMFGPDICGIGTKKVHVIFNY----NG----------KNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKIDNP-------------------EYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRV 1130
            +S K+WV S  K  D  + I      ++           D G+     AK   I+  L KPF  K D+ LVVQ++V  ++  +CGG Y+KL+  GKD +Q K F+ +TPY IMFGPD CG    K+H IF +    NG          KN L   + P KD +  HLY L+++ DN++E+ +D + +  G+   D+      P +I+DPN  KP  W +  K+PD    KPEDWD+                     P  I DP A KPEDWD E+DGEWEAP +DNP                    Y+G W+   I+NPNY+G W   +I NPD+  D   +    I  VG +LW + S  +FDN++ITD+ E A+DF   ++ +
Sbjct:   83 ESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCG-NDVKMHFIFRHVNPINGTITEKHCNKPKNRL---EEPFKD-KLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDI 464          
BLAST of calreticulin-1 vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085437)

HSP 1 Score: 176.407 bits (446), Expect = 1.466e-48
Identity = 139/387 (35.92%), Postives = 196/387 (50.65%), Query Frame = 3
Query:  171 DSLKKWVESTYKGSDQGKFIYTAGKFYD-------DMDKDKGIQTSQDAKFYGISYKLEKPFSNK-DRTLVVQFQVKHEQTIDCGGGYIKLM--GKDLDQ-KNFHGETPYEIMFGPDICGIGTKKVHVIFNY----NG----------KNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKIDNP-------------------EYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRV 1130
            +S K+WV S  K  D  + I      ++           D G+     AK   I+  L KPF  K D+ LVVQ++V  ++  +CGG Y+KL+  GKD +Q K F+ +TPY IMFGPD CG    K+H IF +    NG          KN L   + P KD +  HLY L+++ DN++E+ +D + +  G+   D+      P +I+DPN  KP  W +  K+PD    KPEDWD+                     P  I DP A KPEDWD E+DGEWEAP +DNP                    Y+G W+   I+NPNY+G W   +I NPD+  D   +    I  VG +LW + S  +FDN++ITD+ E A+DF   ++ +
Sbjct:   83 ESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCG-NDVKMHFIFRHVNPINGTITEKHCNKPKNRL---EEPFKD-KLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDI 464          
BLAST of calreticulin-1 vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0110909)

HSP 1 Score: 176.407 bits (446), Expect = 1.466e-48
Identity = 139/387 (35.92%), Postives = 196/387 (50.65%), Query Frame = 3
Query:  171 DSLKKWVESTYKGSDQGKFIYTAGKFYD-------DMDKDKGIQTSQDAKFYGISYKLEKPFSNK-DRTLVVQFQVKHEQTIDCGGGYIKLM--GKDLDQ-KNFHGETPYEIMFGPDICGIGTKKVHVIFNY----NG----------KNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKIDNP-------------------EYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRV 1130
            +S K+WV S  K  D  + I      ++           D G+     AK   I+  L KPF  K D+ LVVQ++V  ++  +CGG Y+KL+  GKD +Q K F+ +TPY IMFGPD CG    K+H IF +    NG          KN L   + P KD +  HLY L+++ DN++E+ +D + +  G+   D+      P +I+DPN  KP  W +  K+PD    KPEDWD+                     P  I DP A KPEDWD E+DGEWEAP +DNP                    Y+G W+   I+NPNY+G W   +I NPD+  D   +    I  VG +LW + S  +FDN++ITD+ E A+DF   ++ +
Sbjct:   83 ESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCG-NDVKMHFIFRHVNPINGTITEKHCNKPKNRL---EEPFKD-KLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDI 464          
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 429.869 bits (1104), Expect = 5.044e-148
Identity = 219/358 (61.17%), Postives = 276/358 (77.09%), Query Frame = 3
Query:   87 MYYILVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
            +  + + +  A++ A+  +Y +E+F   DS + +WVES +K +D GKF+ +AGKFY D +KDKG+QTSQDA FY +S +    F+NKD+ LV+QF VKHEQ IDCGGGYIKL   DL+Q++ HG++ Y IMFGPDICG GTKKVHVIFNY GKNHLI KDI CKDDE+SHLYTLI+  DNTYEV ID +KVESG+ E+DWDFL  KKI DP A+KP DW +  K+ D  D+KPE+WDKP+ IPDP AKKP+DWD+EMDGEWE P + NP+Y+G+WKP++IDNP YKG WVHPEIDNP+Y  D+ +Y    IG +G DLWQVKSGTIFDN LIT++P+ A++ G +TW  T D EK MK
Sbjct:    4 LSLLFMAVSVALITAESNVYFREQFEDGDSWRSRWVESKHK-TDYGKFVLSAGKFYGDAEKDKGLQTSQDAHFYAMSARF-GDFNNKDQPLVIQFSVKHEQNIDCGGGYIKLFPSDLNQEDMHGDSTYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEYSHLYTLIVNPDNTYEVKIDNKKVESGSLEEDWDFLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWDKPENIPDPDAKKPDDWDEEMDGEWEPPMVTNPDYKGEWKPRQIDNPAYKGKWVHPEIDNPEYTADSEIYKYDSIGVIGLDLWQVKSGTIFDNFLITNDPKLAEEVGTETWGATKDAEKKMK 359          
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Match: calr3a (calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-17])

HSP 1 Score: 416.772 bits (1070), Expect = 6.952e-143
Identity = 223/362 (61.60%), Postives = 268/362 (74.03%), Query Frame = 3
Query:   84 MMYYILVILFSAIVN-ADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNK 1163
            M     V   SA+   A   +Y KE+F   D  K +WVES +K SD G++  T+GKFY D + DKG+QTSQDA+FY +S + +  FSN+ +TLV+QF VKHEQ IDCGGGY+K+   ++DQ   HGE+ Y IMFGPDICG  TKKVHVIFNY G+NHLIKKDI CKDDE +HLYTLIL+ D TYEV ID EKVESG+ E+DWDFL PKKI DP A+KP DW D  K+ D  D KPEDWDKP+ IPDP AKKP+DWD++MDGEWE   I NPEY+G+WKPK+IDNP+YKG WVHPEIDNP+Y  D+ +Y    IG +G DLWQVKSGTIFDN LITD+ E A+ FG  TW  T   EK MK++
Sbjct:    1 MRITAAVCFISALAFIAHADVYFKEQFLDGDGWKSRWVESKHK-SDYGQWKLTSGKFYGDAELDKGLQTSQDARFYALSSRFDS-FSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPAEMDQTEMHGESQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILRPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPDDWDDRAKIDDPEDTKPEDWDKPENIPDPDAKKPDDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPSYKGTWVHPEIDNPEYAADDAIYKFDSIGVLGLDLWQVKSGTIFDNFLITDDVEEAEKFGTDTWGATKGPEKKMKDQ 360          
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 413.69 bits (1062), Expect = 1.054e-141
Identity = 216/332 (65.06%), Postives = 259/332 (78.01%), Query Frame = 3
Query:  141 IYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVT 1133
            +YL E+F   D+ + +WV S +K SD G+F  TAG FY D +KDKG+QTSQDA+FY  S + E PFSN+ +TLV+QF VKHEQ IDCGGGY+K+   DL+Q + HG++ Y IMFGPDICG  TKKVHVIFNY G+NHLIKKDI CKDDE +HLYTLIL  D TYEV ID EKVESG+ E+DWDFL PKKI DP A+KP DW D  K+ DE D KPEDWDKP+ IPDP AKKPEDWD++MDGEWE   I NPEY+G+WKPK+IDNPNYKG WVHPEIDNP++ PD+ +Y    IG +G DLWQVKSGTIFDN  I+D+ + A++FG +TW  T
Sbjct:   22 VYLNEQFLDGDAWRSRWVNSEHK-SDYGQFKLTAGNFYGDAEKDKGLQTSQDARFYATSVRFE-PFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPADLNQADMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPAMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEHVPDDQIYKFDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGNETWGAT 351          
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Match: clgn (calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708])

HSP 1 Score: 186.422 bits (472), Expect = 7.577e-52
Identity = 133/340 (39.12%), Postives = 179/340 (52.65%), Query Frame = 3
Query:  267 DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMG--KDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNY----NG---KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKI-------------------DNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            D G+     AK + IS  L KPF  KD+ L+VQ++V  +  IDCGG YIKL+   KDL+ + FH  TPY IMFGPD CG    K+H IF +    NG   + H  + D+  K    D+ +HL+TL+L  DN+YE  ID   V  G+   D       PK+I+DP   KP DW +  K+PD    KPE+WD+                     P+ + DP A+KP+DWD+EMDGEWEAP++                   +NP+Y+G WK   IDNPNY+G W   +I NPD+  D   +       VG +LW + S   FDN +IT E E A  +   +W
Sbjct:  118 DLGLVLKSRAKHHAISALLNKPFVFKDKPLIVQYEVNFQDGIDCGGAYIKLLSDSKDLELEQFHDRTPYSIMFGPDKCG-EDYKLHFIFRHKNPLNGDVEEKHAKRPDVDLKKIYTDKKTHLFTLVLNPDNSYETFIDQSSVSRGSLLTDVVPPVNPPKEIDDPKDSKPEDWDERAKIPDPEAVKPEEWDEEALAKVPDPDAVKPDGWLDDEPEFVSDPTAEKPDDWDEEMDGEWEAPQVPNPACTSAPGCGEWKPPMVNNPKYKGKWKAPLIDNPNYQGVWSPRKIPNPDHFEDLHPFRMEPFRAVGLELWSMTSDIYFDNFIITTEKEVADRWAADSW 456          
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Match: canx (calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797])

HSP 1 Score: 183.341 bits (464), Expect = 6.175e-51
Identity = 146/402 (36.32%), Postives = 198/402 (49.25%), Query Frame = 3
Query:  144 YLKEEFSTADSLKKWVESTYK--GSDQGKFIYTAGKFYDDMDK-----DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGK--DLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCKD---DEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWD--FLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPKI-------------------DNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKL 1166
            Y  E F    +L+ WV S  K  G D+    Y      ++M       DKG+     AK + IS  L +PF+   + L+VQ++V  +  IDCGG Y+KL+ +  DLD + F  +TPY IMFGPD CG    K+H IF +         + H  K D   +    D+ +HLYTL+L  DNT+E+LID   V SG+  +D       P +I DP+  KP DW + PK+ D +  KPEDWD+                     P+ I DP A KPEDWD++MDGEWEAP+I                   DNP Y+G WK   IDNPNY+G W   +I NPD+  D   +       VG +LW + S   FDN  IT +   A+ +    W +    E A +  L
Sbjct:   78 YFAEAFDKG-TLQGWVLSQAKKDGIDEDIAKYDGKWEVEEMQDSKLPGDKGLVLKSKAKHHAISALLLRPFTFDTKPLIVQYEVNFQTGIDCGGAYVKLLSQTPDLDLEEFVDKTPYTIMFGPDKCG-EDYKLHFIFRHKNPKTGEFEEKHAKKPDSDLRSYYTDKKTHLYTLVLNPDNTFEILIDQTVVNSGSLLNDVTPPVNPPAEIEDPDDHKPEDWDERPKIQDPDAVKPEDWDEDAPAKIADEDAVKPDGWLDDEPEYISDPDAVKPEDWDEDMDGEWEAPQIPNPVCETAPGCGAWERPMIDNPNYKGKWKSPMIDNPNYQGVWKPRKIPNPDFFEDLHPFRMTPFSAVGLELWSMSSDIFFDNFFITSDRNVAERWANDGWGLKKAAEGAAEPGL 477          
BLAST of calreticulin-1 vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 431.795 bits (1109), Expect = 1.401e-148
Identity = 224/360 (62.22%), Postives = 278/360 (77.22%), Query Frame = 3
Query:   93 YILVILFSAIVNADPTIYLKEEFSTADSL-KKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            ++++ L +A+  ADP +YLKEEF+  D   ++WVES +K SD GKF  +AGKFY D +KDKG+QTSQDA+FY +S + +  FSNKD+TLV+QF VKHEQ IDCGGGY+KL   +L+Q   HGE+ Y IMFGPDICG  TKKVHVIF Y  KN  I KDI C+DD F+HLYTLI++ DNTYEV ID  KVESG+ E+DWDFL  KKI DP A+KP DW + PK+ D  DKKPEDWDK + IPDP A KPEDWD+EMDGEWE P I NP+Y+G+WKP++IDNP+YKG W+HPEIDNP+Y PD+TLY     G +G DLWQVKSGTIFDN L+TD+ +YA+++G +TW VT + EK MK + D
Sbjct:    6 FLILPLLAALCIADPAVYLKEEFADGDGWSQRWVESKHK-SDYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQD 363          
BLAST of calreticulin-1 vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 408.297 bits (1048), Expect = 7.030e-140
Identity = 213/332 (64.16%), Postives = 259/332 (78.01%), Query Frame = 3
Query:  174 SLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            S+ +WVES +K SD GKF  +AGKFY D +KDKG+QTSQDA+FY +S + +  FSNKD+TLV+QF VKHEQ IDCGGGY+KL   +L+Q   HGE+ Y IMFGPDICG  TKKVHVIF Y  KN  I KDI C+DD F+HLYTLI++ DNTYEV ID  KVESG+ E+DWDFL  KKI DP A+KP DW + PK+ D  DKKPEDWDK + IPDP A KPEDWD+EMDGEWE P I NP+Y+G+WKP++IDNP+YKG W+HPEIDNP+Y PD+TLY     G +G DLWQVKSGTIFDN L+TD+ +YA+++G +TW VT + EK MK + D
Sbjct:    4 SVLRWVESKHK-SDYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQD 333          
BLAST of calreticulin-1 vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 409.453 bits (1051), Expect = 1.727e-139
Identity = 217/359 (60.45%), Postives = 267/359 (74.37%), Query Frame = 3
Query:   99 LVILFSAIVNADPTIYLKEEFSTADS--LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            +++L   I    P I      S+      ++WVES +K SD GKF  +AGKFY D +KDKG+QTSQDA+FY +S + +  FSNKD+TLV+QF VKHEQ IDCGGGY+KL   +L+Q   HGE+ Y IMFGPDICG  TKKVHVIF Y  KN  I KDI C+DD F+HLYTLI++ DNTYEV ID  KVESG+ E+DWDFL  KKI DP A+KP DW + PK+ D  DKKPEDWDK + IPDP A KPEDWD+EMDGEWE P I NP+Y+G+WKP++IDNP+YKG W+HPEIDNP+Y PD+TLY     G +G DLWQVKSGTIFDN L+TD+ +YA+++G +TW VT + EK MK + D
Sbjct:   38 MIVLCVFIACNAPVINFNLSCSSLSDGWSQRWVESKHK-SDYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQD 394          
BLAST of calreticulin-1 vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 407.142 bits (1045), Expect = 4.211e-139
Identity = 212/330 (64.24%), Postives = 258/330 (78.18%), Query Frame = 3
Query:  180 KKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            ++WVES +K SD GKF  +AGKFY D +KDKG+QTSQDA+FY +S + +  FSNKD+TLV+QF VKHEQ IDCGGGY+KL   +L+Q   HGE+ Y IMFGPDICG  TKKVHVIF Y  KN  I KDI C+DD F+HLYTLI++ DNTYEV ID  KVESG+ E+DWDFL  KKI DP A+KP DW + PK+ D  DKKPEDWDK + IPDP A KPEDWD+EMDGEWE P I NP+Y+G+WKP++IDNP+YKG W+HPEIDNP+Y PD+TLY     G +G DLWQVKSGTIFDN L+TD+ +YA+++G +TW VT + EK MK + D
Sbjct:   27 QRWVESKHK-SDYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQD 354          
BLAST of calreticulin-1 vs. Ensembl Xenopus
Match: calr (calreticulin [Source:NCBI gene;Acc:407962])

HSP 1 Score: 407.142 bits (1045), Expect = 4.360e-139
Identity = 212/330 (64.24%), Postives = 258/330 (78.18%), Query Frame = 3
Query:  180 KKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            ++WVES +K SD GKF  +AGKFY D +KDKG+QTSQDA+FY +S + +  FSNKD+TLV+QF VKHEQ IDCGGGY+KL   +L+Q   HGE+ Y IMFGPDICG  TKKVHVIF Y  KN  I KDI C+DD F+HLYTLI++ DNTYEV ID  KVESG+ E+DWDFL  KKI DP A+KP DW + PK+ D  DKKPEDWDK + IPDP A KPEDWD+EMDGEWE P I NP+Y+G+WKP++IDNP+YKG W+HPEIDNP+Y PD+TLY     G +G DLWQVKSGTIFDN L+TD+ +YA+++G +TW VT + EK MK + D
Sbjct:   29 QRWVESKHK-SDYGKFKLSAGKFYGDAEKDKGLQTSQDARFYALSTRFDS-FSNKDKTLVIQFSVKHEQNIDCGGGYVKLFPAELEQSEMHGESEYNIMFGPDICGPPTKKVHVIFQYKKKNLQINKDIRCRDDSFTHLYTLIVRPDNTYEVKIDNSKVESGSLEEDWDFLPAKKIKDPEAKKPDDWDERPKIDDPEDKKPEDWDKAEHIPDPDAVKPEDWDEEMDGEWEPPVIQNPDYKGEWKPRQIDNPDYKGKWIHPEIDNPEYTPDSTLYQYDSFGVLGLDLWQVKSGTIFDNFLMTDDEKYAEEYGNETWGVTKEAEKKMKEQQD 356          
BLAST of calreticulin-1 vs. Ensembl Mouse
Match: Calr (calreticulin [Source:MGI Symbol;Acc:MGI:88252])

HSP 1 Score: 438.728 bits (1127), Expect = 1.699e-151
Identity = 230/347 (66.28%), Postives = 272/347 (78.39%), Query Frame = 3
Query:  132 DPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            DP IY KE+F   D+   +WVES +K SD GKF+ ++GKFY D++KDKG+QTSQDA+FY +S K E PFSNK +TLVVQF VKHEQ IDCGGGY+KL    LDQK+ HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD  +Y       +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   18 DPAIYFKEQFLDGDAWTNRWVESKHK-SDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 351.288 bits (900), Expect = 4.213e-117
Identity = 181/333 (54.35%), Postives = 241/333 (72.37%), Query Frame = 3
Query:  159 FSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
            FST    K+WV+S ++ SD G+F   +GKFY D ++DKG+QT++DAKFY +S +  KPFSN++ TLVVQF VKHEQ IDCGGGY+KL    L+Q++ H E+ Y IMFGPDICG G  ++ VI ++ GK H   K + C+ ++ +HLYTLIL+ + TYEV ID +KV SG  EDDWDFL PKKI DP A+KP  W +  ++ D +DKKPEDW+  + IPDP AKKP+DW++ MDG WE P I N +Y G+WKP+ IDNPNY+G W+HPEIDNP Y+PD T+     I  +G DLWQVKSG+IFDN L+T++ E+A++ G  TW +  D E+  +
Sbjct:   14 FSTDGWTKRWVQSKHQ-SDYGQFQLASGKFYQDKERDKGLQTTEDAKFYALSTRF-KPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPAALNQEDMHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWR 344          
BLAST of calreticulin-1 vs. Ensembl Mouse
Match: Calr3 (calreticulin 3 [Source:MGI Symbol;Acc:MGI:1920566])

HSP 1 Score: 252.677 bits (644), Expect = 2.208e-79
Identity = 155/359 (43.18%), Postives = 203/359 (56.55%), Query Frame = 3
Query:   99 LVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDW--KPKEIDNPNYKG----PWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAM 1154
            L+     +  A  T+Y +EEF   +  + +WV+ST   S  G F  ++GKFY   +KDKG+QT+Q+++FY IS    KPFSNK +TLV+Q+ VKHEQ +DCGGGYIK+   DLDQK  +G++ Y IMFGPDICG   KKVHVI  +  + H  KK I CK D F+HLYTLIL+ D +YEV +D + +ESG+ E DW+    +K  +  +    DW            K +DW+K     D  A KP DW              N E  GDW  KP   D    +G     W+H ++    Y     L     IG +G +LWQV+SGTIFDN LITD+ EYA+ FG  TW  T   EK M
Sbjct:    7 LLWAICVLRVALATVYFQEEFLDGERWRNRWVQST-NDSQFGHFRVSSGKFYGHKEKDKGLQTTQNSRFYAISASF-KPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPSDLDQKKMNGKSQYYIMFGPDICGFDIKKVHVILYFKNQYHENKKPIRCKVDGFTHLYTLILRPDLSYEVKVDGQSIESGSIEYDWNLTSLRK-TEKTSLDSRDW------DQVEGSKVQDWEKH--FLDAGASKPSDW--------------NSELDGDWLQKPPYEDGLKAEGIDKDVWLHQKMRPAGYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYAEKFGKATWGETKGPEKEM 340          
BLAST of calreticulin-1 vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 244.202 bits (622), Expect = 6.989e-77
Identity = 127/237 (53.59%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  447 FHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
             H E+ Y IMFGPDICG G  ++ VI ++ GK H   K + C+ ++ +HLYTLIL+ + TYEV ID +KV SG  EDDWDFL PKKI DP A+KP  W +  ++ D +DKKPEDW+  + IPDP AKKP+DW++ MDG WE P I N +Y G+WKP+ IDNPNY+G W+HPEIDNP Y+PD T+     I  +G DLWQVKSG+IFDN L+T++ E+A++ G  TW +  D E+  +
Sbjct:    1 MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWR 237          
BLAST of calreticulin-1 vs. Ensembl Mouse
Match: Calr4 (calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435])

HSP 1 Score: 244.202 bits (622), Expect = 6.989e-77
Identity = 127/237 (53.59%), Postives = 168/237 (70.89%), Query Frame = 3
Query:  447 FHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
             H E+ Y IMFGPDICG G  ++ VI ++ GK H   K + C+ ++ +HLYTLIL+ + TYEV ID +KV SG  EDDWDFL PKKI DP A+KP  W +  ++ D +DKKPEDW+  + IPDP AKKP+DW++ MDG WE P I N +Y G+WKP+ IDNPNY+G W+HPEIDNP Y+PD T+     I  +G DLWQVKSG+IFDN L+T++ E+A++ G  TW +  D E+  +
Sbjct:    1 MHSESQYYIMFGPDICGFGNNRLQVILSHKGKYHENNKTLKCRINKDTHLYTLILRPNATYEVKIDNQKVTSGGLEDDWDFLPPKKIKDPYARKPRKWDERQQIEDPDDKKPEDWEDSEFIPDPDAKKPDDWNEAMDGVWEGPLIPNVKYMGEWKPRIIDNPNYQGEWIHPEIDNPKYRPDPTIGHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDVEQQWR 237          
BLAST of calreticulin-1 vs. UniProt/SwissProt
Match: sp|P14211|CALR_MOUSE (Calreticulin OS=Mus musculus OX=10090 GN=Calr PE=1 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.189e-150
Identity = 230/347 (66.28%), Postives = 272/347 (78.39%), Query Frame = 3
Query:  132 DPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            DP IY KE+F   D+   +WVES +K SD GKF+ ++GKFY D++KDKG+QTSQDA+FY +S K E PFSNK +TLVVQF VKHEQ IDCGGGY+KL    LDQK+ HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD  +Y       +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   18 DPAIYFKEQFLDGDAWTNRWVESKHK-SDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. UniProt/SwissProt
Match: sp|P18418|CALR_RAT (Calreticulin OS=Rattus norvegicus OX=10116 GN=Calr PE=1 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.146e-149
Identity = 229/347 (65.99%), Postives = 271/347 (78.10%), Query Frame = 3
Query:  132 DPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            DP IY KE+F   D+   +WVES +K SD GKF+ ++GKFY D +KDKG+QTSQDA+FY +S + E PFSNK +TLVVQF VKHEQ IDCGGGY+KL    LDQK+ HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD  +Y       +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   18 DPAIYFKEQFLDGDAWTNRWVESKHK-SDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. UniProt/SwissProt
Match: sp|P29413|CALR_DROME (Calreticulin OS=Drosophila melanogaster OX=7227 GN=Calr PE=1 SV=2)

HSP 1 Score: 435.261 bits (1118), Expect = 1.725e-149
Identity = 232/363 (63.91%), Postives = 270/363 (74.38%), Query Frame = 3
Query:   84 MMYYILVILFSAIVN-ADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            MM+   VI+  A V      +YLKE F   +    W+ S + G + GKF+ T G FY+D + DKGIQTSQDA+FY  S K +  FSN+D+ LVVQF VKHEQ IDCGGGY+KL    LDQ + HGE+PYEIMFGPDICG GTKKVHVIF+Y GKNHLI KDI CKDD ++H YTLI++ DNTYEVLID EKVESGN EDDWDFL PKKI DP A KP DW D   +PD +DKKPEDWDKP+ IPDP A KPEDWDDEMDGEWE P IDNPE++G+W+PK++DNPNYKG W HPEI NP+Y PD+ LYLR EI  +GFDLWQVKSGTIFDN+LITD+ E A     +  + T  GEK MK   D
Sbjct:    1 MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQTSQDARFYAASRKFDG-FSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEV-KNTQAGEKKMKEAQD 361          
BLAST of calreticulin-1 vs. UniProt/SwissProt
Match: sp|P15253|CALR_RABIT (Calreticulin OS=Oryctolagus cuniculus OX=9986 GN=CALR PE=1 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 6.708e-149
Identity = 226/348 (64.94%), Postives = 271/348 (77.87%), Query Frame = 3
Query:  129 ADPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            A+P +Y KE+F   D   ++W+ES +K SD GKF+ ++GKFY D +KDKG+QTSQDA+FY +S + E PFSNK + LVVQF VKHEQ IDCGGGY+KL    LDQK+ HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ DNTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW +  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP+YKG W+HPEIDNP+Y PD  +Y       +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   17 AEPVVYFKEQFLDGDGWTERWIESKHK-SDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQPLVVQFTVKHEQNIDCGGGYVKLFPAGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKTAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. UniProt/SwissProt
Match: sp|P52193|CALR_BOVIN (Calreticulin OS=Bos taurus OX=9913 GN=CALR PE=1 SV=2)

HSP 1 Score: 434.106 bits (1115), Expect = 7.718e-149
Identity = 227/348 (65.23%), Postives = 271/348 (77.87%), Query Frame = 3
Query:  129 ADPTIYLKEEFSTADS-LKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            ADPT+Y KE+F   D   ++W+ES +K  D GKF+ ++GKFY D +KDKG+QTSQDA+FY +S + E PFSNK +TLVVQF VKHEQ IDCGGGY+KL    LDQ + HG++ Y IMFGPDICG GTKKVHVIFNY GKN LI KDI CKDDEF+HLYTLI++ +NTYEV ID  +VESG+ EDDWDFL PKKI DP+A KP DW D  K+ D  D KPEDWDKP+ IPDP AKKPEDWD+EMDGEWE P I NPEY+G+WKP++IDNP YKG W+HPEIDNP+Y PD+ +Y       +G DLWQVKSGTIFDN LIT++  YA++FG +TW VT   EK MK+K D
Sbjct:   17 ADPTVYFKEQFLDGDGWTERWIESKHK-PDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFE-PFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPAGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPNNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDDRAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPEYKGIWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQD 362          
BLAST of calreticulin-1 vs. TrEMBL
Match: I1ZIA6 (Calreticulin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 407/409 (99.51%), Postives = 408/409 (99.76%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDXXXXXXXXXXXXXXXXXXXXXPKVEEQDKAPESEEAESKDKVDHTEL 1310
            MMYYILVILF AIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEE+RKRTEEEDKKKEATKQAEPKVEEQDKAPESEEAESKDKVDHTEL
Sbjct:    1 MMYYILVILFCAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEEERKRTEEEDKKKEATKQAEPKVEEQDKAPESEEAESKDKVDHTEL 409          
BLAST of calreticulin-1 vs. TrEMBL
Match: V9XRS2 (Calreticulin OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 521.931 bits (1343), Expect = 0.000e+0
Identity = 266/362 (73.48%), Postives = 306/362 (84.53%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            M  +I+ IL S  + A+PTIYL EEF T     +WVEST+KG+DQGKF +TAGKFY+D +KDKGIQTSQDAKFYGIS K +K FSN+ + LV+QFQVKHEQTIDCGGGY+KL+G + +Q  FHGETPY IMFGPDICG+ TKKVHVIFNY G+N LIKKDI CKDDEF+H+YTLI+  DNTYEVLID EKVESG+ EDDWDFL PKKI DPNA+KP DW D  K+ D  DKKPE+WDKPKTIPDPKAKKPEDWDDEMDGEWEAP+IDNPEY+G+WKPK+IDNP YKGPWVHPEI NPDYKPD  LY+  +IG +GFDLWQVKSGTIFDNIL+TD+P YAK +  +TW+VTADGEK MK+K D
Sbjct:    1 MKIFIMSILVSLAL-AEPTIYLNEEFLTESYKTQWVESTFKGADQGKFTWTAGKFYNDAEKDKGIQTSQDAKFYGISKKFDKAFSNEGKKLVIQFQVKHEQTIDCGGGYVKLVGSNFEQDKFHGETPYHIMFGPDICGLSTKKVHVIFNYKGQNLLIKKDIKCKDDEFTHVYTLIVNPDNTYEVLIDNEKVESGSLEDDWDFLAPKKIKDPNAKKPEDWEDNEKIDDITDKKPEEWDKPKTIPDPKAKKPEDWDDEMDGEWEAPQIDNPEYKGEWKPKQIDNPKYKGPWVHPEIPNPDYKPDTNLYVYKDIGAIGFDLWQVKSGTIFDNILLTDDPAYAKKYAEQTWKVTADGEKKMKDKQD 361          
BLAST of calreticulin-1 vs. TrEMBL
Match: A0A267FN87 (Calreticulin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004264g3 PE=3 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.098e-160
Identity = 243/343 (70.85%), Postives = 280/343 (81.63%), Query Frame = 3
Query:  141 IYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            +Y KEEF       +WVESTYKG+DQGK+ +TAGKFY+D +KDKGI+TSQDAKFYGIS K   PFSN  +TLV+QFQVKHEQ IDCGGGY+K++G D+DQKNFHG+TPY+IMFGPDICG GTKKVHVIFNY GKN L KK+I CKDDE SHLYTLI+K DNTYEVLID E+ E G  E DWDFL PKKI DP A+KP DW +  K+ D NDKKPEDWDKPKTIPDPKAKKP+DWDDEMDGEWE P IDNP+Y+GDWKPK+IDNP YKG W+HPEIDNPDY PD  LY   +IG +GFDLWQVKSG+IFDN+ + D+P  AK F  +T++ T +GEK MK K D
Sbjct:   19 VYFKEEFLDESWKDRWVESTYKGNDQGKWEWTAGKFYNDAEKDKGIKTSQDAKFYGISAKFNSPFSNAGKTLVIQFQVKHEQNIDCGGGYVKVLGSDVDQKNFHGDTPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGDWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEAKAFADETFKKTVEGEKKMKEKQD 361          
BLAST of calreticulin-1 vs. TrEMBL
Match: A1YB06 (Calreticulin OS=Eisenia andrei OX=168636 PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.004e-159
Identity = 238/361 (65.93%), Postives = 287/361 (79.50%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKL 1166
            ++  + V   +AI  A+PT Y +E+F  A    +WVEST+KG++QGKF +TAGKFY+D +KDKG+QT+QDA+FYGIS K +KPF+N+ +TL++QF VKHEQ IDCGGGYIKL   DLDQKN HGE+PY IMFGPDICG  TKKVHVIFNY GKN LIKK+I CKDD  SHLYTLI++ DNTYEV ID +K ESG  +DDWDFL PKKI DP A+KP DW D  K+ D  D KPEDWDK + IPDP+AKKPEDWDDEMDGEWE P IDNPEY+G+WKPK+I NP YKG WVHPEIDNP+Y  D++LY   +IG +GFDLWQVKSGTIFDN+LITD+ ++A++ G +TW    DGEK MK+K 
Sbjct:    3 VIRAVFVACLAAIALAEPTTYFREDFD-AGWKSRWVESTHKGAEQGKFAWTAGKFYNDAEKDKGLQTTQDARFYGISAKFDKPFTNEGKTLIIQFTVKHEQEIDCGGGYIKLFSSDLDQKNMHGESPYYIMFGPDICGYSTKKVHVIFNYKGKNLLIKKEIRCKDDTLSHLYTLIVRPDNTYEVKIDNKKEESGKLDDDWDFLAPKKIKDPEAKKPEDWDDREKLDDPEDTKPEDWDKAEHIPDPEAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQITNPAYKGAWVHPEIDNPEYAADDSLYRYSDIGAIGFDLWQVKSGTIFDNMLITDDEKFAEEVGEETWGKAKDGEKKMKDKF 362          
BLAST of calreticulin-1 vs. TrEMBL
Match: A0A1I8I182 (Calreticulin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 1.411e-158
Identity = 240/361 (66.48%), Postives = 286/361 (79.22%), Query Frame = 3
Query:   87 MYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            M     +L + +  A   +Y KEEF       +WVESTYKG+DQGK+ ++AGKFY+D  KD+GI+T+QDAKFY IS K +KPFSN+ + LV+QFQVKHEQ IDCGGGY+KL+G D+DQKNFHG++PY+IMFGPDICG GTKKVHVIFNY GKN L KK+I CKDDE SHLYTLI+K DNTYEVLID E+ E G  E DWDFL PKKI DP A+KP DW +  K+ D NDKKPEDWDKPKTIPDPKAKKP+DWDDEMDGEWE P IDNP+Y+G+WKPK+IDNP YKG W+HPEIDNPDY PD  LY   +IG +GFDLWQVKSG+IFDN+ + D+P  A+ F  +T++ T +GEK MK K D
Sbjct:    1 MIKWFFVLAALLPFAFCEVYFKEEFLDESWRDRWVESTYKGADQGKWDWSAGKFYNDAQKDRGIKTTQDAKFYDISAKFDKPFSNQGKPLVIQFQVKHEQNIDCGGGYVKLLGSDIDQKNFHGDSPYKIMFGPDICGPGTKKVHVIFNYKGKNLLTKKEIRCKDDELSHLYTLIVKPDNTYEVLIDNERAEGGELEADWDFLPPKKIKDPAAKKPDDWDEREKIDDPNDKKPEDWDKPKTIPDPKAKKPDDWDDEMDGEWEPPMIDNPDYKGEWKPKQIDNPAYKGKWIHPEIDNPDYSPDPELYKYTDIGAIGFDLWQVKSGSIFDNVFVGDDPAEARTFADETFKKTVEGEKKMKEKQD 361          
BLAST of calreticulin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000019127.2 (calreticulin-like [Source:NCBI gene;Acc:103024869])

HSP 1 Score: 442.195 bits (1136), Expect = 6.318e-153
Identity = 233/359 (64.90%), Postives = 280/359 (77.99%), Query Frame = 3
Query:   93 YILVILFSAIVN--ADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKN 1160
            ++L +  SA  +  A+P +YL+E+F   D+ K +WVES +K SD GKF+ TAGKFY D +KDKG+QTSQDA FY IS +  K FSNKD+TLV+QF VKHEQ+IDCGGGYIKL   DL Q++ HG++ Y IMFGPDICG GTKKVHVIFNY GKNHLI KDI CKDDE +HLYTLI+  DNTYEV ID +KVESG+ EDDWDFL PKKI DPNA+KP DW +  K+ D  D+KPEDW+K + IPDP AKKP+DWDDEMDGEWE P + NPEY+G+WKPK+IDNP YKG WVHPEIDNP+Y  D  +Y    IG +G DLWQVKSGTIFDN LIT++P+ A++ G +TW  T D EK MK+
Sbjct:    5 FLLALCVSAAFSTAAEPAVYLREQFEDGDAWKTRWVESEHK-SDYGKFVLTAGKFYGDAEKDKGLQTSQDAHFYSISSRF-KDFSNKDQTLVLQFTVKHEQSIDCGGGYIKLFPSDLKQEDMHGDSIYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEHTHLYTLIVNPDNTYEVKIDNKKVESGSLEDDWDFLPPKKIKDPNAKKPEDWDEREKIDDPEDQKPEDWEKAENIPDPDAKKPDDWDDEMDGEWEPPMVSNPEYKGEWKPKQIDNPGYKGKWVHPEIDNPEYTADPEIYAYSSIGVIGLDLWQVKSGTIFDNFLITNDPKLAEEIGNETWGATKDAEKKMKD 361          
BLAST of calreticulin-1 vs. Ensembl Cavefish
Match: calr3b (calreticulin-like [Source:NCBI gene;Acc:103040817])

HSP 1 Score: 422.55 bits (1085), Expect = 3.637e-145
Identity = 224/343 (65.31%), Postives = 263/343 (76.68%), Query Frame = 3
Query:  129 ADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAM 1154
             D T+Y KE+F      K +WV S +K SD G+F  T+G FY D++KDKG+QTSQDA+FY  S + E PFSN+ ++LVVQF VKHEQ IDCGGGY+K+   DLDQ N HG++ Y IMFGPDICG  TKKVHVIFNY GKNHLIKK+I CKDDE +HLYTLIL  D TYEV ID EKVESG+ E+DWDFL  KKI DP A+KP DW D  K+ DE D KPEDWDKP+ IPDP AKKPEDWD++MDGEWE P I NPEY+G+WKPK+IDNPNYKG WVHPEIDNP+Y PD  +Y   +IG +G DLWQVK+GTIFDN LITD+ + A +F  +TW VT   EK M
Sbjct:   19 VDATVYFKEQFLDGGEWKSRWVNSEHK-SDYGQFKLTSGNFYGDVEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVVQFSVKHEQKIDCGGGYVKIFPSDLDQTNMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGKNHLIKKEIKCKDDELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWDFLPAKKIKDPEAKKPEDWDDRAKIDDETDTKPEDWDKPENIPDPDAKKPEDWDEDMDGEWEPPMIPNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEYSPDAEIYKFEKIGVLGLDLWQVKAGTIFDNFLITDDVQTADEFAKETWGVTKGPEKKM 359          
BLAST of calreticulin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000022283.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:25050572:25055355:1 gene:ENSAMXG00000021635.2 transcript:ENSAMXT00000022283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.341 bits (991), Expect = 1.780e-131
Identity = 202/311 (64.95%), Postives = 240/311 (77.17%), Query Frame = 3
Query:  237 AGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            A  F+ +   D G+QTSQDA+FY +S + E PFSN+ + LV+QF VKHEQ IDCGGGY+K+   DLDQ N HG++ Y IMFGPDICG  TKKVHVIFNY G+NHLIKKDI CKDDE +HLYTLIL  D TYEV I+ EKVESG+ E+DWDFL PKKI DP A+KP DW D  K+ D  D KPEDWDKP+ IPDP AKKP+DWD++MDGEWE P I NPEY+G+WKPK+IDNPNYKG WVHPEIDNP+Y  D+++Y    IG +G DLWQVKSGTIFDN  I+D+ + A++FG +TW  T   EK MK K D
Sbjct:   19 ATVFFKEQFLDGGLQTSQDARFYALSSRFE-PFSNEGKPLVIQFTVKHEQKIDCGGGYVKIFPTDLDQANMHGDSQYYIMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIRCKDDEHTHLYTLILHPDQTYEVKINNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRAKIDDPEDTKPEDWDKPENIPDPDAKKPDDWDEDMDGEWEPPMIPNPEYKGEWKPKQIDNPNYKGTWVHPEIDNPEYTADDSIYKYDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGKETWGATKGPEKKMKEKQD 328          
BLAST of calreticulin-1 vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 189.119 bits (479), Expect = 3.397e-53
Identity = 133/340 (39.12%), Postives = 176/340 (51.76%), Query Frame = 3
Query:  267 DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMG--KDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPK-------------------IDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            D G+     AK + IS  L KP+  KDR LVVQ++V  +  IDCGG YIKL+    DLD + FH  TPY IMFGPD CG    K+H IF +         + H  + D   +    D+ +HL+TL+L  DN+YE+ ID      GN   D       PK+I+DP   KP DW +  K+PD    KP+DWD+                     P+ +PDP A KP+DWD+EMDGEWEAP+                   I+NP+Y+G WK   IDNPNY+G W   +I NPDY  D   +    +  VG +LW + S   FDN +IT + E A  +   +W
Sbjct:  119 DLGLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCG-EDYKLHFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSW 457          
BLAST of calreticulin-1 vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 189.889 bits (481), Expect = 3.951e-53
Identity = 133/340 (39.12%), Postives = 176/340 (51.76%), Query Frame = 3
Query:  267 DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMG--KDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDK---------------------PKTIPDPKAKKPXXXXXXXXXXXXAPK-------------------IDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            D G+     AK + IS  L KP+  KDR LVVQ++V  +  IDCGG YIKL+    DLD + FH  TPY IMFGPD CG    K+H IF +         + H  + D   +    D+ +HL+TL+L  DN+YE+ ID      GN   D       PK+I+DP   KP DW +  K+PD    KP+DWD+                     P+ +PDP A KP+DWD+EMDGEWEAP+                   I+NP+Y+G WK   IDNPNY+G W   +I NPDY  D   +    +  VG +LW + S   FDN +IT + E A  +   +W
Sbjct:  119 DLGLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCG-EDYKLHFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSW 457          
BLAST of calreticulin-1 vs. Ensembl Sea Lamprey
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 422.165 bits (1084), Expect = 3.069e-146
Identity = 224/346 (64.74%), Postives = 271/346 (78.32%), Query Frame = 3
Query:  132 DPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPE---DWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
            +P +Y KE F   D+ + +WV S +K SD GKF+ +AGKFY D +KDKG+QTSQDA+FY +S   +  FSNKD+TLV+QF VKHEQ IDCGGGYIKL  KD++Q+  HG++ Y IMFGPDICG GTKKVHVIFNY GKNHLI KDI CKDDE++HLYTLI++ D TYEV ID +KVESG+ E+DWD L  KKI DP A KP DW D+ K+ D  D KPE   DW+KP+ IPDP AKKPEDWDDEMDGEWE P ++NPEY+G+WKP++IDNP YKG WVHPEIDNP+Y PD+ +YL   IG +G DLWQVKSGTIFD+ LITD+ +YA+  G +TW VT +GEK MK
Sbjct:   19 EPAVYFKELFDDGDAWQDRWVVSKHK-SDYGKFVLSAGKFYGDAEKDKGLQTSQDARFYALSAGFDS-FSNKDKTLVIQFTVKHEQNIDCGGGYIKLFPKDMNQEEMHGDSQYFIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEYTHLYTLIVRPDQTYEVKIDNKKVESGSLEEDWDILPAKKIKDPEAHKPEDWEDQSKIDDPTDVKPEPTKDWEKPEHIPDPDAKKPEDWDDEMDGEWEPPMVENPEYKGEWKPRQIDNPKYKGVWVHPEIDNPEYAPDSNIYLSENIGVIGLDLWQVKSGTIFDSFLITDDEKYAETIGEETWGVTKEGEKKMK 362          
BLAST of calreticulin-1 vs. Ensembl Sea Lamprey
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 395.971 bits (1016), Expect = 2.218e-135
Identity = 211/365 (57.81%), Postives = 269/365 (73.70%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMF--GPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDEND-KKP---EDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
            MM  +L +  +A   A   ++ +E FS  D  + +WVES +K SD GK   +AG FY D ++DKG+QT+QD +FY IS     PFSNK RTLV+QF VKHEQ IDCGGGY+KL   +LDQ++ HG++ Y +MF  GPDICG GTKKVHVI NY GKNHLI KDI C+DDEF+HLYTL+L+ D TYEV ID E+VESG+ EDDWD L P+++ DP A +P DW + P + D +D KKP   +DWD+P+ IPDP AKKP+DWDDEMDGEWE P ++NP+++ +WKPK+I NP+YKG WVHP+IDNPD+  D  +Y    IG +G DLWQVKSGTIFDN LITD+ +YA++   KTW +T D E+ MK
Sbjct:    2 MMKAVLTLWLTASW-AMAEVFFEERFSDGDGWQPRWVESQHK-SDYGKMRLSAGAFYGDAERDKGLQTTQDVRFYAISAAF-PPFSNKGRTLVLQFSVKHEQDIDCGGGYVKLFPAELDQQDMHGDSRYYLMFAEGPDICGPGTKKVHVIINYKGKNHLINKDIRCRDDEFTHLYTLVLRPDQTYEVKIDGERVESGSLEDDWDVLPPRRVEDPAAVRPDDWDERPSIDDPHDTKKPDRGQDWDQPEHIPDPDAKKPDDWDDEMDGEWEPPMVENPDFKSEWKPKQISNPDYKGTWVHPKIDNPDFASDPNIYYFDNIGVLGLDLWQVKSGTIFDNFLITDDEQYAEEVAKKTWGLTKDAERKMK 363          
BLAST of calreticulin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-274f20.2 (si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204-91])

HSP 1 Score: 181.03 bits (458), Expect = 1.318e-50
Identity = 133/400 (33.25%), Postives = 185/400 (46.25%), Query Frame = 3
Query:  144 YLKEEFSTADSLKKWVESTYKGSDQ--------GKFIYTA---GKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMG--KDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKN------HLIKKDI---PCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGN-FEDDWDFLQP-KKINDPNAQKPADWVDEPKMPDENDKKPEDWDK--PKTIPDPKAKK--------------------------------------PXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKA 1151
            Y  + F +  +L  WV S  K  D         GK++      GK  DD    KG+     AK + I+  L +PF   D+ L+VQ++V  +  I+CGG Y+KL+    DLD   F+ +TPY IMFGPD CG   K   ++ + N K       H  K D+   P   D+  HLY+L+L  DN YE+LID   V SG+  ED    + P ++I DP+  KP DW +  K+PD +  KPEDWD+  P  I DP A K                                      P        G W+AP + NP Y+G WKP  IDNPNY+G W   +I NPD+  D   +       +G +LW + S  +FDN ++  E   A  +   +W +      A
Sbjct:  115 YFVDSFDSG-TLDNWVISKAKKEDTDEDIAKYDGKWLVEEQLDGKLPDD----KGLVLKTRAKHHAIAGALTRPFHFIDKPLIVQYEVNFQNGIECGGAYVKLLSGNADLDLTKFYDKTPYTIMFGPDKCGEDYKLHFIMRHRNPKTGTYEEKHAKKSDVDLKPYYTDKKPHLYSLVLSPDNRYEILIDQTVVGSGSLLEDMTPPVNPAREIEDPDDSKPEDWDERAKIPDPDAIKPEDWDEDAPAQISDPDAVKPEGWLDDEPEYTADPEAVKPEDWDEEMDGEWEAPQVPNPTCEAAPGCGVWKAPMVSNPAYKGKWKPSNIDNPNYQGVWKPRKIANPDFFEDLHPFRLTAFNAIGLELWSMTSDILFDNFIVCSERAVADQWAADSWGLKRQAAAA 509          
BLAST of calreticulin-1 vs. Ensembl Yeast
Match: CNE1 (Calnexin; integral membrane ER chaperone involved in folding and quality control of glycoproteins; chaperone activity is inhibited by Mpd1p, with which Cne1p interacts; 24% identical to mammalian calnexin; Ca+ binding not yet shown in yeast [Source:SGD;Acc:S000000054])

HSP 1 Score: 108.997 bits (271), Expect = 4.578e-26
Identity = 116/405 (28.64%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  111 FSAIVNADPTIYLKEEFSTADSLKKWVESTYKGS---DQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDR-TLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETP----YEIMFGPDICGIGTKKVHVIFNYNGK-NHLIK----KDIPCK---DDEFSHLYTLIL-KSDNTYEVLID---------LEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKK-------------------PEDWDK--PKTIPDPKAKKPXXXXXXXXXXXXAPKIDNP-------------------EYRGDWKPKEIDNPNYKGPWVHPEIDNPD-YKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            F A  N   T +L +E+ T++++       Y       QG+   +A         DKGI          I + LE P +  +  TLVVQ+++K + ++ CGG +IKLM   ++ +      P     E++FGPD C      V    N   K  H  K    +++P     D   SHLYTLI+ +S  ++++LID         +E  +  NFE       P  I D +  KP DW D  ++PD    K                   P +W+   P+ I DP A+KP  W +   GEW  P I NP                   +Y+G  +  EI NPNY G W  PEI+NP  Y+  + L +   I  V  + W      +  NI +      A+  G KTW
Sbjct:   37 FQAYTN---TKHLNQEWITSEAVNNEGSKIYGAQWRLSQGRLQGSAW--------DKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPP--ITPPLMIPDVSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEAQIIGNKTW 428          
BLAST of calreticulin-1 vs. Ensembl Nematostella
Match: EDO48109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK57])

HSP 1 Score: 444.506 bits (1142), Expect = 4.457e-155
Identity = 230/329 (69.91%), Postives = 268/329 (81.46%), Query Frame = 3
Query:  183 KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            +WV ST KG+ QGKF +TAGKFY D + DKGIQTS+DAKFYGIS K EKPF+N+ +TLV+QF VKHEQ IDCGGGY K+   D+DQKN HG++PY IMFGPDICG GTKKVHVIFNY GKN L KKDI CKDDE +HLYTLI++ DNTYEV ID EKVESG  E DWDFL PK I DP A+KP DW D+  + D  DKKPEDWDKP+ IPDP AKKPEDWDDE+DGEWE P IDNPEY+G+WKPK+IDNPNYKG WVHPEIDNP+YK D+ LY+  +IG +GFDLWQVKSGTIFDN+L+TD  E+A+ F  +T+  T +GEK MK++ D
Sbjct:    5 RWVSSTSKGAQQGKFKWTAGKFYGDAEADKGIQTSEDAKFYGISAKFEKPFTNEGKTLVIQFSVKHEQNIDCGGGYAKVFPSDVDQKNLHGDSPYLIMFGPDICGPGTKKVHVIFNYKGKNLLTKKDIRCKDDEMTHLYTLIVRPDNTYEVKIDNEKVESGELEKDWDFLPPKTIKDPEAKKPEDWDDKKMIDDPEDKKPEDWDKPQNIPDPDAKKPEDWDDEIDGEWEPPMIDNPEYKGEWKPKQIDNPNYKGEWVHPEIDNPEYKADDKLYMYKDIGAIGFDLWQVKSGTIFDNVLVTDSVEHAEQFAKETFDKTKEGEKKMKDEQD 333          
BLAST of calreticulin-1 vs. Ensembl Nematostella
Match: EDO49786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFV3])

HSP 1 Score: 181.03 bits (458), Expect = 7.093e-52
Identity = 132/341 (38.71%), Postives = 186/341 (54.55%), Query Frame = 3
Query:  267 DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLM--GKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNY-NGKNHLIKKDIPCK---------DDEFSHLYTLILKSDNTYEVLIDLEKVESGNF---------------------EDDWDFLQPKKINDPNAQKPADW-VDEP-KMPDENDKKPEDW--DKPKTIPDPKAKKPXXXXXXXXXXXXAPKI------------------DNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            D G+     A+ + I+  L+K F   D+  +VQ++VK +Q ++CGG Y+KL+  G+    ++F  +TPY IMFGPD CG   +K+H IF + N KN  I++    K         D + +HL+TL+++ DNT+EV ID E V  G+                       +DWD  + +KI DP+A+KP DW  D P K+PD N KKPE W  D+P+ +PDP   KPEDWDDE DGEWEAP+I                  DNPEY+G W    IDNPNYKG W    I NP +  D   +    I  VG +LW + S  +FDN+++T++   A  +   +W
Sbjct:   35 DLGLVLKSRARHHAIAAHLDKKFDFTDKPFIVQYEVKFQQPMECGGAYLKLLSDGQGFKPESFGDKTPYTIMFGPDKCG-EDRKLHFIFRHKNPKNGTIEEKHAKKPTGNYNSVFDGKKTHLFTLVVRPDNTFEVFIDQESVNKGSLLEDMTPPVNPPAEIEDPDDKRPEDWD--EREKIPDPDAEKPDDWDEDAPVKIPDTNAKKPEGWLDDEPEYVPDPNGIKPEDWDDEEDGEWEAPQIANPKCEKVGCGEWKPPMADNPEYKGKWSAPLIDNPNYKGIWKPRLIPNPHFFEDKEPFKMTSIVGVGLELWSMTSDILFDNVIVTNDKAVADKWAQDSW 372          
BLAST of calreticulin-1 vs. Ensembl Medaka
Match: ENSORLT00000003653.2 (calreticulin [Source:NCBI gene;Acc:101160304])

HSP 1 Score: 425.631 bits (1093), Expect = 1.853e-146
Identity = 217/360 (60.28%), Postives = 274/360 (76.11%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKN 1160
            M +   ++   A V  + T+Y +EEF+  D  K +W+ES +K SD G++  ++GKFY D + DKG+QTSQDA+FY +S +   PFSN+ +TLV+QF VKHEQ IDCGGGY+K+   DLDQ + HG++ Y +MFGPDICG  TKKVHVIFNY G+NHLIKKDI CKDDE +HLYTLIL  D TYEV ID EKVESG+ EDDWD L PKKI DP+A+KP+DW D   + D +D KPEDWD+P+TIPDP AKKP+DWD++MDGEWE P I NPE++G+WKPK++ NPNYKG WVHPE+DNP+Y PD  +YL   IG +G DLWQVKSGTIFDN LITD+ + A++   +TW VT   EK M++
Sbjct:    1 MKFCSALLALFAGVAVEATVYFREEFTDGDGWKSRWLESKHK-SDYGQWKLSSGKFYGDAEADKGVQTSQDARFYALSARF-PPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPSDLDQSDMHGDSKYYVMFGPDICGYSTKKVHVIFNYKGQNHLIKKDIKCKDDELTHLYTLILNPDQTYEVRIDNEKVESGSLEDDWDMLPPKKIKDPDAKKPSDWDDRATIDDPSDTKPEDWDQPETIPDPDAKKPDDWDEDMDGEWEPPMITNPEFKGEWKPKQMSNPNYKGAWVHPEVDNPEYAPDANMYLFDNIGVLGLDLWQVKSGTIFDNFLITDDIKEAEEVAKETWEVTKGPEKKMRD 358          
BLAST of calreticulin-1 vs. Ensembl Medaka
Match: calr3b (calreticulin [Source:NCBI gene;Acc:101169735])

HSP 1 Score: 423.705 bits (1088), Expect = 1.042e-145
Identity = 222/363 (61.16%), Postives = 270/363 (74.38%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            M    L +   A+      IY +EEF   D  + +WV S +K SD G++  TAG FY D +KDKG+QTSQDA+FY  S + E PFSN+ ++LV+QF VKHEQ IDCGGGY+K+   DLDQ + HG++ Y +MFGPDICG  TKKVHVIFNY GKNHLIKK+I CKDDEF+HLYTLIL  D TY+V ID EKVESG+ E+DWDFL PKKI DP A+KP DW D PK+ D  D KPEDW+KP+ IPDP AKKPEDW ++MDGEWE P I NPEY+G+WKPK+IDNP+YKG WVHPEIDNP+Y PD  +Y    IG +G DLWQVKSGT+FDN LITD+ + A+D G +TW  T + E+ MK + D
Sbjct:    1 MNTLSLFVGLIALYCVHAKIYFREEFLDGDEWRSRWVNSKHK-SDYGEWKLTAGNFYGDAEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVIQFTVKHEQKIDCGGGYVKVFPSDLDQTDMHGDSSYYVMFGPDICGYTTKKVHVIFNYKGKNHLIKKEIKCKDDEFTHLYTLILNPDQTYQVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRPKIDDPEDTKPEDWEKPEYIPDPDAKKPEDWQEDMDGEWEPPMISNPEYKGEWKPKQIDNPDYKGAWVHPEIDNPEYSPDANIYKFDSIGVLGLDLWQVKSGTVFDNFLITDDVKEAEDVGKETWGATKEPEQKMKQEQD 361          
BLAST of calreticulin-1 vs. Ensembl Medaka
Match: calr3b (calreticulin [Source:NCBI gene;Acc:101169735])

HSP 1 Score: 374.015 bits (959), Expect = 8.574e-127
Identity = 196/312 (62.82%), Postives = 237/312 (75.96%), Query Frame = 3
Query:  162 STADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNI-LITDEPE 1094
            S+ +   +WV S +K SD G++  TAG FY D +KDKG+QTSQDA+FY  S + E PFSN+ ++LV+QF VKHEQ IDCGGGY+K+   DLDQ + HG++ Y +MFGPDICG  TKKVHVIFNY GKNHLIKK+I CKDDEF+HLYTLIL  D TY+V ID EKVESG+ E+DWDFL PKKI DP A+KP DW D PK+ D  D KPEDW+KP+ IPDP AKKPEDW ++MDGEWE P I NPEY+G+WKPK+IDNP+YKG WVHPEIDNP+Y PD  +Y    IG +G DLWQ ++     +  L   EPE
Sbjct:    6 SSDEWRSRWVNSKHK-SDYGEWKLTAGNFYGDAEKDKGLQTSQDARFYAASARFE-PFSNEGKSLVIQFTVKHEQKIDCGGGYVKVFPSDLDQTDMHGDSSYYVMFGPDICGYTTKKVHVIFNYKGKNHLIKKEIKCKDDEFTHLYTLILNPDQTYQVKIDNEKVESGSLEEDWDFLPPKKIKDPEAKKPEDWDDRPKIDDPEDTKPEDWEKPEYIPDPDAKKPEDWQEDMDGEWEPPMISNPEYKGEWKPKQIDNPDYKGAWVHPEIDNPEYSPDANIYKFDSIGVLGLDLWQSRNRIKLCSFSLFLQEPE 315          
BLAST of calreticulin-1 vs. Ensembl Medaka
Match: ENSORLT00000021485.3 (calreticulin [Source:NCBI gene;Acc:101162115])

HSP 1 Score: 347.821 bits (891), Expect = 1.688e-116
Identity = 190/355 (53.52%), Postives = 237/355 (66.76%), Query Frame = 3
Query:   96 ILVILFSAIVNADPTIYLKEEFSTADSLK-KWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMK 1157
            +L+ + +  V A+ ++Y +E+F   D+ K +W+ES +K SD G+ + TAGKFY D +KDKG+QTSQDA FY  S + +  FSNK + LV+QF VKHEQ+IDCGGGYIKL   +L+Q++ HG++ Y IMFGPDICG GTKKVHVIFNY GKNHLI KDI CKDDEF+HLYTL++  DNTYEV ID +KVESGN E+DWDFL PKKI DP+A+KP DW D  K+PD +DKKPEDWDKP+ IPDP AKKPEDW              + E  G+W+P  I NP+YK                                  VKSGTIFDN LIT++P  A++ G  TW  T D E+ MK
Sbjct:    7 LLMAVCATSVLAESSVYFREQFEDGDAWKSRWIESKHK-SDYGQLVLTAGKFYGDGEKDKGLQTSQDAHFYASSARFDD-FSNKGQPLVIQFTVKHEQSIDCGGGYIKLFPSELNQEDMHGDSVYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEFTHLYTLVVNPDNTYEVKIDNKKVESGNLEEDWDFLPPKKIKDPDAKKPEDWDDREKIPDPDDKKPEDWDKPENIPDPDAKKPEDW--------------DDEMDGEWEPPMIANPDYK----------------------------------VKSGTIFDNFLITNDPNLAEEVGNDTWGKTKDAERKMK 311          
BLAST of calreticulin-1 vs. Ensembl Medaka
Match: clgn (calnexin [Source:NCBI gene;Acc:101159642])

HSP 1 Score: 177.563 bits (449), Expect = 1.370e-48
Identity = 140/389 (35.99%), Postives = 193/389 (49.61%), Query Frame = 3
Query:  141 IYLKEEFSTADSLKKW-VESTYKGSDQGKFIYTAGKFYDDMDK------DKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMG--KDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNG-------KNHLIKKDIPCK---DDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW--DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWD-------------KPKT--------IPDPKAKKPXXXXXXXXXXXXAPK-------------------IDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTW 1124
            +Y  E F    SL +W +  T K     +     GK+  +  K      D G+     AK + I+  L KPF  +D  LVVQ++V  +  IDCGG YIKL+     L+ + FH  TPY IMFGPD CG    K+H IF +         + H  + D+  K    D+ +HLYTL+L  DN+YE+ ID   V  G+   D       PK+I+DP+  KP DW +  K+PD   +KP+DWD             KP+         + DP A+KPEDWD+EMDGEWEAP+                   I+NP+Y+G WK   +DN NY+G W   +I NPDY  D   +       +G +LW + S   FDN +IT + E A  +   +W
Sbjct:   97 VYFAETFDDG-SLDRWQLSKTMKEDADEEIAKYDGKWAVEQLKENKVPGDLGLVLKSRAKHHAIAAPLVKPFVFQDEPLVVQYEVNFQDGIDCGGAYIKLLSDTGSLNLEQFHDRTPYTIMFGPDKCG-EDYKLHFIFRHKNPLNKDMEEKHAKRADVDLKKFYTDKKTHLYTLVLNPDNSYEMFIDQSSVSRGSLLQDVVPPVNPPKEIDDPHDSKPDDWDERAKIPDPEAEKPDDWDEDAPAKVEDPDAVKPEGWLDDELEFVADPNAEKPEDWDEEMDGEWEAPQIPNPACETAPGCGEWKRPMINNPQYKGKWKAPLVDNSNYQGVWKPRKIQNPDYFEDLQPFRMTPFKALGLELWSMTSDIYFDNFIITSQKEVADRWASDSW 483          
BLAST of calreticulin-1 vs. Planmine SMEST
Match: SMESG000009012.1 (SMESG000009012.1)

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 406/409 (99.27%), Postives = 408/409 (99.76%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDXXXXXXXXXXXXXXXXXXXXXPKVEEQDKAPESEEAESKDKVDHTEL 1310
            MMYYILVILF AIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEE+RKRTEEEDKKKEATKQAEPKVEEQDKAPES+EAESKDKVDHTEL
Sbjct:    1 MMYYILVILFCAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEEERKRTEEEDKKKEATKQAEPKVEEQDKAPESDEAESKDKVDHTEL 409          
BLAST of calreticulin-1 vs. Planmine SMEST
Match: SMESG000009012.1 (SMESG000009012.1)

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 405/408 (99.26%), Postives = 407/408 (99.75%), Query Frame = 3
Query:   87 MYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDXXXXXXXXXXXXXXXXXXXXXPKVEEQDKAPESEEAESKDKVDHTEL 1310
            MYYILVILF AIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEE+RKRTEEEDKKKEATKQAEPKVEEQDKAPES+EAESKDKVDHTEL
Sbjct:    1 MYYILVILFCAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPEDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLDEEERKRTEEEDKKKEATKQAEPKVEEQDKAPESDEAESKDKVDHTEL 408          
BLAST of calreticulin-1 vs. Planmine SMEST
Match: SMESG000077304.1 (SMESG000077304.1)

HSP 1 Score: 521.931 bits (1343), Expect = 0.000e+0
Identity = 266/362 (73.48%), Postives = 306/362 (84.53%), Query Frame = 3
Query:   84 MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            M  +I+ IL S  + A+PTIYL EEF T     +WVEST+KG+DQGKF +TAGKFY+D +KDKGIQTSQDAKFYGIS K +K FSN+ + LV+QFQVKHEQTIDCGGGY+KL+G + +Q  FHGETPY IMFGPDICG+ TKKVHVIFNY G+N LIKKDI CKDDEF+H+YTLI+  DNTYEVLID EKVESG+ EDDWDFL PKKI DPNA+KP DW D  K+ D  DKKPE+WDKPKTIPDPKAKKPEDWDDEMDGEWEAP+IDNPEY+G+WKPK+IDNP YKGPWVHPEI NPDYKPD  LY+  +IG +GFDLWQVKSGTIFDNIL+TD+P YAK +  +TW+VTADGEK MK+K D
Sbjct:    1 MKIFIMSILVSLAL-AEPTIYLNEEFLTESYKTQWVESTFKGADQGKFTWTAGKFYNDAEKDKGIQTSQDAKFYGISKKFDKAFSNEGKKLVIQFQVKHEQTIDCGGGYVKLVGSNFEQDKFHGETPYHIMFGPDICGLSTKKVHVIFNYKGQNLLIKKDIKCKDDEFTHVYTLIVNPDNTYEVLIDNEKVESGSLEDDWDFLAPKKIKDPNAKKPEDWEDNEKIDDITDKKPEEWDKPKTIPDPKAKKPEDWDDEMDGEWEAPQIDNPEYKGEWKPKQIDNPKYKGPWVHPEIPNPDYKPDTNLYVYKDIGAIGFDLWQVKSGTIFDNILLTDDPAYAKKYAEQTWKVTADGEKKMKDKQD 361          
BLAST of calreticulin-1 vs. Planmine SMEST
Match: SMESG000077304.1 (SMESG000077304.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 261/354 (73.73%), Postives = 301/354 (85.03%), Query Frame = 3
Query:  108 LFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEKAMKNKLD 1169
            +  ++  A+PTIYL EEF T     +WVEST+KG+DQGKF +TAGKFY+D +KDKGIQTSQDAKFYGIS K +K FSN+ + LV+QFQVKHEQTIDCGGGY+KL+G + +Q  FHGETPY IMFGPDICG+ TKKVHVIFNY G+N LIKKDI CKDDEF+H+YTLI+  DNTYEVLID EKVESG+ EDDWDFL PKKI DPNA+KP DW D  K+ D  DKKPE+WDKPKTIPDPKAKKPEDWDDEMDGEWEAP+IDNPEY+G+WKPK+IDNP YKGPWVHPEI NPDYKPD  LY+  +IG +GFDLWQVKSGTIFDNIL+TD+P YAK +  +TW+VTADGEK MK+K D
Sbjct:    3 ILVSLALAEPTIYLNEEFLTESYKTQWVESTFKGADQGKFTWTAGKFYNDAEKDKGIQTSQDAKFYGISKKFDKAFSNEGKKLVIQFQVKHEQTIDCGGGYVKLVGSNFEQDKFHGETPYHIMFGPDICGLSTKKVHVIFNYKGQNLLIKKDIKCKDDEFTHVYTLIVNPDNTYEVLIDNEKVESGSLEDDWDFLAPKKIKDPNAKKPEDWEDNEKIDDITDKKPEEWDKPKTIPDPKAKKPEDWDDEMDGEWEAPQIDNPEYKGEWKPKQIDNPKYKGPWVHPEIPNPDYKPDTNLYVYKDIGAIGFDLWQVKSGTIFDNILLTDDPAYAKKYAEQTWKVTADGEKKMKDKQD 356          
BLAST of calreticulin-1 vs. Planmine SMEST
Match: SMESG000039107.1 (SMESG000039107.1)

HSP 1 Score: 409.068 bits (1050), Expect = 2.329e-140
Identity = 210/350 (60.00%), Postives = 254/350 (72.57%), Query Frame = 3
Query:   99 LVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIYTAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHEQTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNYNGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDWDFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKPXXXXXXXXXXXXAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYKPDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVTADGEK 1148
            ++ L  A+ N    IY  EEF      ++WVESTY+G DQGKF    GK + D  K++G+QTSQ++KFYGI+ K + PF+N  + LV+Q+QVK ++ + CGGGYIKL+G D D  +FHG TPY+IMFGPDICG   K VHVI NY  K +L KKDI C DD+FSHLYTLI+  +NTY VLID  +VE G  EDDWD L PKK+ DPNA KP DWVD  K+ D ND KPE+WD+PKTIPD   KKP  WDDE+DG WE P I NP ++G+WKPK+IDNPNYKGPW+HPEIDNP Y  D+ LYL+  IG VGFD+WQV SGTIFDNIL+TD+PE A   G  TWRV    EK
Sbjct:    4 IIFLLFAMENIFCEIYFYEEFFDESYTERWVESTYRGIDQGKFQLGTGKHFGDYWKERGLQTSQNSKFYGIATKFKTPFNNSLKPLVIQYQVKMDEYVQCGGGYIKLLGTDFDPLSFHGHTPYKIMFGPDICGTNKKMVHVILNYKEKYYLTKKDIRCMDDKFSHLYTLIIFPNNTYSVLIDNNQVEGGKLEDDWDLLPPKKVKDPNAMKPVDWVDNDKIDDPNDFKPEEWDQPKTIPDNTVKKPNKWDDEVDGVWEPPLISNPNFKGEWKPKKIDNPNYKGPWIHPEIDNPHYYLDHNLYLQTSIGGVGFDIWQVVSGTIFDNILLTDDPETALRIGETTWRVALAEEK 353          
The following BLAST results are available for this feature:
BLAST of calreticulin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALR9.279e-14965.13calreticulin [Source:HGNC Symbol;Acc:HGNC:1455][more]
CALR31.854e-8545.40calreticulin 3 [Source:HGNC Symbol;Acc:HGNC:20407][more]
CALR8.416e-7569.95calreticulin [Source:HGNC Symbol;Acc:HGNC:1455][more]
CLGN5.518e-5536.34calmegin [Source:HGNC Symbol;Acc:HGNC:2060][more]
CLGN5.518e-5536.34calmegin [Source:HGNC Symbol;Acc:HGNC:2060][more]
back to top
BLAST of calreticulin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crt-12.583e-13361.86Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
crt-12.583e-13361.86Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
cnx-11.418e-4536.23Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
cnx-14.779e-2735.79Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
back to top
BLAST of calreticulin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calr1.721e-15063.91gene:FBgn0005585 transcript:FBtr0334618[more]
Calr1.721e-15063.91gene:FBgn0005585 transcript:FBtr0082103[more]
Cnx99A1.466e-4835.92gene:FBgn0015622 transcript:FBtr0085438[more]
Cnx99A1.466e-4835.92gene:FBgn0015622 transcript:FBtr0085437[more]
Cnx99A1.466e-4835.92gene:FBgn0015622 transcript:FBtr0110909[more]
back to top
BLAST of calreticulin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calr5.044e-14861.17calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3a6.952e-14361.60calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-1... [more]
calr3b1.054e-14165.06calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
clgn7.577e-5239.12calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708][more]
canx6.175e-5136.32calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797][more]
back to top
BLAST of calreticulin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calr1.401e-14862.22calreticulin [Source:NCBI gene;Acc:407962][more]
calr7.030e-14064.16calreticulin [Source:NCBI gene;Acc:407962][more]
calr1.727e-13960.45calreticulin [Source:NCBI gene;Acc:407962][more]
calr4.211e-13964.24calreticulin [Source:NCBI gene;Acc:407962][more]
calr4.360e-13964.24calreticulin [Source:NCBI gene;Acc:407962][more]
back to top
BLAST of calreticulin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Calr1.699e-15166.28calreticulin [Source:MGI Symbol;Acc:MGI:88252][more]
Calr44.213e-11754.35calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
Calr32.208e-7943.18calreticulin 3 [Source:MGI Symbol;Acc:MGI:1920566][more]
Calr46.989e-7753.59calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
Calr46.989e-7753.59calreticulin 4 [Source:MGI Symbol;Acc:MGI:2140435][more]
back to top
BLAST of calreticulin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14211|CALR_MOUSE1.189e-15066.28Calreticulin OS=Mus musculus OX=10090 GN=Calr PE=1... [more]
sp|P18418|CALR_RAT1.146e-14965.99Calreticulin OS=Rattus norvegicus OX=10116 GN=Calr... [more]
sp|P29413|CALR_DROME1.725e-14963.91Calreticulin OS=Drosophila melanogaster OX=7227 GN... [more]
sp|P15253|CALR_RABIT6.708e-14964.94Calreticulin OS=Oryctolagus cuniculus OX=9986 GN=C... [more]
sp|P52193|CALR_BOVIN7.718e-14965.23Calreticulin OS=Bos taurus OX=9913 GN=CALR PE=1 SV... [more]
back to top
BLAST of calreticulin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIA60.000e+099.51Calreticulin OS=Schmidtea mediterranea OX=79327 PE... [more]
V9XRS20.000e+073.48Calreticulin OS=Schmidtea mediterranea OX=79327 PE... [more]
A0A267FN871.098e-16070.85Calreticulin OS=Macrostomum lignano OX=282301 GN=B... [more]
A1YB061.004e-15965.93Calreticulin OS=Eisenia andrei OX=168636 PE=2 SV=1[more]
A0A1I8I1821.411e-15866.48Calreticulin OS=Macrostomum lignano OX=282301 PE=3... [more]
back to top
BLAST of calreticulin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019127.26.318e-15364.90calreticulin-like [Source:NCBI gene;Acc:103024869][more]
calr3b3.637e-14565.31calreticulin-like [Source:NCBI gene;Acc:103040817][more]
ENSAMXT00000022283.21.780e-13164.95pep primary_assembly:Astyanax_mexicanus-2.0:5:2505... [more]
clgn3.397e-5339.12calnexin [Source:NCBI gene;Acc:103035256][more]
clgn3.951e-5339.12calnexin [Source:NCBI gene;Acc:103035256][more]
back to top
BLAST of calreticulin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
calr3.069e-14664.74calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3b2.218e-13557.81calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
si:ch211-274f20.21.318e-5033.25si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204... [more]
back to top
BLAST of calreticulin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CNE14.578e-2628.64Calnexin; integral membrane ER chaperone involved ... [more]
back to top
BLAST of calreticulin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481094.457e-15569.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497867.093e-5238.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of calreticulin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003653.21.853e-14660.28calreticulin [Source:NCBI gene;Acc:101160304][more]
calr3b1.042e-14561.16calreticulin [Source:NCBI gene;Acc:101169735][more]
calr3b8.574e-12762.82calreticulin [Source:NCBI gene;Acc:101169735][more]
ENSORLT00000021485.31.688e-11653.52calreticulin [Source:NCBI gene;Acc:101162115][more]
clgn1.370e-4835.99calnexin [Source:NCBI gene;Acc:101159642][more]
back to top
BLAST of calreticulin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009012.10.000e+099.27SMESG000009012.1[more]
SMESG000009012.10.000e+099.26SMESG000009012.1[more]
SMESG000077304.10.000e+073.48SMESG000077304.1[more]
SMESG000077304.10.000e+073.73SMESG000077304.1[more]
SMESG000039107.12.329e-14060.00SMESG000039107.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034254
GenBankAFJ24760.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034254 ID=SMED30034254|Name=calreticulin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1429bp
CTTATATAATTGGCTGTTAGGCTTTACTTAACTAGTAACCAATCACAGTA
TTACACAGTAAGTCTACTGACGTAGAATTTTAAATGATGTATTACATTCT
TGTTATTCTCTTTTCTGCCATAGTAAATGCTGATCCGACTATTTATTTGA
AAGAAGAATTTAGTACAGCTGATTCATTAAAAAAATGGGTTGAATCCACT
TATAAAGGATCTGATCAAGGAAAATTCATTTATACCGCCGGAAAGTTTTA
TGATGATATGGATAAGGATAAAGGAATTCAGACCAGTCAAGATGCGAAAT
TTTATGGCATATCTTATAAATTAGAGAAACCCTTTTCGAATAAAGATAGA
ACATTGGTCGTTCAATTTCAAGTTAAACATGAACAAACAATTGATTGTGG
CGGAGGATACATTAAATTAATGGGTAAAGATCTGGATCAGAAAAATTTTC
ATGGAGAAACACCTTACGAAATAATGTTTGGTCCCGATATTTGTGGTATT
GGAACTAAAAAAGTCCATGTGATTTTCAATTATAATGGGAAAAATCATTT
GATTAAAAAAGATATTCCATGCAAAGATGATGAATTCAGTCATTTATATA
CATTAATTCTAAAATCAGATAACACATATGAAGTGTTAATAGATTTAGAG
AAAGTTGAAAGTGGAAATTTTGAAGATGACTGGGATTTTTTGCAGCCTAA
AAAGATAAATGATCCTAATGCACAAAAACCTGCAGATTGGGTCGATGAAC
CTAAAATGCCAGATGAGAATGATAAAAAACCTGAAGACTGGGATAAACCG
AAAACCATTCCCGATCCTAAAGCTAAAAAGCCTGAGGATTGGGATGATGA
AATGGATGGTGAGTGGGAGGCCCCAAAAATTGACAATCCTGAATATCGAG
GGGATTGGAAACCGAAAGAAATAGATAATCCTAACTATAAAGGCCCTTGG
GTGCATCCAGAAATCGACAATCCAGATTATAAGCCCGATAATACTCTTTA
TTTGCGTGGGGAAATCGGATATGTTGGTTTCGATCTGTGGCAGGTGAAGT
CCGGTACGATTTTCGACAACATTCTAATTACAGATGAACCGGAATATGCG
AAAGACTTCGGTTTGAAAACGTGGCGAGTGACTGCTGATGGAGAAAAAGC
AATGAAGAATAAATTGGACGAGGAAGACCGTAAACGCACCGAAGAAGAAG
ACAAGAAAAAGGAAGCTACAAAACAGGCCGAACCAAAAGTCGAGGAGCAA
GATAAAGCTCCAGAATCAGAAGAGGCAGAATCTAAGGACAAAGTCGACCA
CACCGAGCTGTAAAGGGCTATTCATTGAGATTTCTGGGCGTCGTTGTAAA
ATAAATTGACATTTATTTGTTTACGTATTTGTAATAAAGTTTCATTGGGA
ATAACGTGTTAAAAATTATAGAATTGTAT
back to top

protein sequence of SMED30034254-orf-1

>SMED30034254-orf-1 ID=SMED30034254-orf-1|Name=SMED30034254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MMYYILVILFSAIVNADPTIYLKEEFSTADSLKKWVESTYKGSDQGKFIY
TAGKFYDDMDKDKGIQTSQDAKFYGISYKLEKPFSNKDRTLVVQFQVKHE
QTIDCGGGYIKLMGKDLDQKNFHGETPYEIMFGPDICGIGTKKVHVIFNY
NGKNHLIKKDIPCKDDEFSHLYTLILKSDNTYEVLIDLEKVESGNFEDDW
DFLQPKKINDPNAQKPADWVDEPKMPDENDKKPEDWDKPKTIPDPKAKKP
EDWDDEMDGEWEAPKIDNPEYRGDWKPKEIDNPNYKGPWVHPEIDNPDYK
PDNTLYLRGEIGYVGFDLWQVKSGTIFDNILITDEPEYAKDFGLKTWRVT
ADGEKAMKNKLDEEDRKRTEEEDKKKEATKQAEPKVEEQDKAPESEEAES
KDKVDHTEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005783endoplasmic reticulum
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0051082unfolded protein binding
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000120progenitor cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001580Calret/calnex
IPR009169Calreticulin
IPR013320ConA-like_dom_sf
IPR018124Calret/calnex_CS
IPR009033Calreticulin/calnexin_P_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 354..381
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 279..377
e-value: 1.1E-21
score: 79.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 19..208
e-value: 1.1E-71
score: 243.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 203..256
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 220..254
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 353..409
NoneNo IPR availablePANTHERPTHR11073:SF16CALRETICULINcoord: 6..400
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.814
IPR001580Calreticulin/calnexinPRINTSPR00626CALRETICULINcoord: 100..118
score: 53.12
coord: 215..228
score: 47.84
coord: 126..142
score: 71.55
coord: 313..333
score: 60.47
coord: 280..299
score: 69.77
coord: 242..264
score: 79.37
IPR001580Calreticulin/calnexinPFAMPF00262Calreticulincoord: 259..332
e-value: 9.1E-22
score: 77.4
coord: 24..257
e-value: 1.1E-61
score: 208.7
IPR001580Calreticulin/calnexinPANTHERPTHR11073CALRETICULIN AND CALNEXINcoord: 6..400
IPR009169CalreticulinPIRSFPIRSF002356Calreticulincoord: 1..409
e-value: 1.6E-184
score: 610.8
IPR009033Calreticulin/calnexin, P domain superfamilyGENE3DG3DSA:2.10.250.10coord: 209..278
e-value: 1.2E-27
score: 98.0
IPR009033Calreticulin/calnexin, P domain superfamilySUPERFAMILYSSF63887P-domain of calnexin/calreticulincoord: 201..315
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00803CALRETICULIN_1coord: 98..113
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00804CALRETICULIN_2coord: 130..138
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 19..220