Dual specificity tyrosine-phosphorylation-regulated kinase 2

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 2
Smed IDSMED30034243
Uniprot Best hitDual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3 (E=0)
Length (bp)2614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30034243) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30034243) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30034243) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30034243) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034243

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034243SMESG000058389.1 SmedASXL_009721SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034243SMESG000058389.1 SmedASXL_009722SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034243 SmedASXL_060671SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034243SMESG000058389.1 dd_Smed_v6_10055_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034243SMESG000058389.1 dd_Smed_v6_9782_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034243SMESG000058389.1 dd_Smed_v4_10055_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034243SMESG000058389.1 dd_Smed_v4_10055_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034243SMESG000058389.1 dd_Smed_v4_9782_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034243SMESG000058389.1 dd_Smed_v4_9782_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 286/411 (69.59%), Postives = 337/411 (82.00%), Query Frame = 1
Query:  583 DPLKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            D + R   SS+ +K+   M    +T ++P+ AM+Q+M KLT +EHHEIFSYP I+F+G NAKKR G+ GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSV+L GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:  128 DSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 286/411 (69.59%), Postives = 337/411 (82.00%), Query Frame = 1
Query:  583 DPLKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            D + R   SS+ +K+   M    +T ++P+ AM+Q+M KLT +EHHEIFSYP I+F+G NAKKR G+ GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSV+L GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:   55 DSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR 465          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 269/416 (64.66%), Postives = 319/416 (76.68%), Query Frame = 1
Query:  598 ETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSN 1845
            +++SSSK    V     L+P+ A++Q+   LT YE  EI +YP I+FVG NAKKR GV+GG NN GYDD   +YIHV  DH+AYRYEVLK++GKGSFGQV +  DHK  + VA+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNHVCM FELLSI+LYELIKKNKFQGFS+QLVRKFA SIL  L+ L++NKIIHCDLKPENILLK  GRS  KVIDFGSSC E+Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL TG P+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+  PRYC  +T ADG V+L GGRS+RG+ RGPP SK   TALK CDD LF++F  RCL W P  R+TP +AL+HPW+  K +P    T  K S 
Sbjct:  128 KSNSSSKAPKVVP----LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWI-SKSVPRPLTTIDKVSG 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 269/416 (64.66%), Postives = 319/416 (76.68%), Query Frame = 1
Query:  598 ETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSN 1845
            +++SSSK    V     L+P+ A++Q+   LT YE  EI +YP I+FVG NAKKR GV+GG NN GYDD   +YIHV  DH+AYRYEVLK++GKGSFGQV +  DHK  + VA+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNHVCM FELLSI+LYELIKKNKFQGFS+QLVRKFA SIL  L+ L++NKIIHCDLKPENILLK  GRS  KVIDFGSSC E+Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL TG P+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+  PRYC  +T ADG V+L GGRS+RG+ RGPP SK   TALK CDD LF++F  RCL W P  R+TP +AL+HPW+  K +P    T  K S 
Sbjct:  108 KSNSSSKAPKVVP----LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWI-SKSVPRPLTTIDKVSG 518          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 269/416 (64.66%), Postives = 319/416 (76.68%), Query Frame = 1
Query:  598 ETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSN 1845
            +++SSSK    V     L+P+ A++Q+   LT YE  EI +YP I+FVG NAKKR GV+GG NN GYDD   +YIHV  DH+AYRYEVLK++GKGSFGQV +  DHK  + VA+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNHVCM FELLSI+LYELIKKNKFQGFS+QLVRKFA SIL  L+ L++NKIIHCDLKPENILLK  GRS  KVIDFGSSC E+Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL TG P+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+  PRYC  +T ADG V+L GGRS+RG+ RGPP SK   TALK CDD LF++F  RCL W P  R+TP +AL+HPW+  K +P    T  K S 
Sbjct:  108 KSNSSSKAPKVVP----LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWI-SKSVPRPLTTIDKVSG 518          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 266/383 (69.45%), Postives = 318/383 (83.03%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  395 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 777          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 266/383 (69.45%), Postives = 318/383 (83.03%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  378 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 760          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 266/383 (69.45%), Postives = 318/383 (83.03%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  395 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 777          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 266/383 (69.45%), Postives = 318/383 (83.03%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  378 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 760          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 266/388 (68.56%), Postives = 320/388 (82.47%), Query Frame = 1
Query:  640 STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            ++   P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  108 NSGFRPEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100406)

HSP 1 Score: 521.161 bits (1341), Expect = 1.453e-172
Identity = 256/385 (66.49%), Postives = 307/385 (79.74%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            +SP   M  +M+KLT YE  EI +YP I+F+G NAKKR GV G  NN  YD++Q +YIHV HDH+AYRYE+LK++GKGSFGQV+KA DHKT E VA+K+VRNEKRF RQA EEIR+L  L++ D  +  N+IH+ D F FRNH C+TFELLSINLYELIKKN F+GFSLQLVRKFA+S+L CL+ LY+N IIHCD+KPEN+LLKQQGRSGIKVIDFGSSC E+QRIYTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL +G+ +FPGE+E DQLACI+E+LG P   +    KR+K FF+ + YPRYC   T +DG V+L GG+S+RG+ RGPP SK+LS AL  C D LFL+F   CL W  + R+TP EALKHPWLRR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100404)

HSP 1 Score: 521.161 bits (1341), Expect = 1.453e-172
Identity = 256/385 (66.49%), Postives = 307/385 (79.74%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            +SP   M  +M+KLT YE  EI +YP I+F+G NAKKR GV G  NN  YD++Q +YIHV HDH+AYRYE+LK++GKGSFGQV+KA DHKT E VA+K+VRNEKRF RQA EEIR+L  L++ D  +  N+IH+ D F FRNH C+TFELLSINLYELIKKN F+GFSLQLVRKFA+S+L CL+ LY+N IIHCD+KPEN+LLKQQGRSGIKVIDFGSSC E+QRIYTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL +G+ +FPGE+E DQLACI+E+LG P   +    KR+K FF+ + YPRYC   T +DG V+L GG+S+RG+ RGPP SK+LS AL  C D LFL+F   CL W  + R+TP EALKHPWLRR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100402)

HSP 1 Score: 521.161 bits (1341), Expect = 1.453e-172
Identity = 256/385 (66.49%), Postives = 307/385 (79.74%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            +SP   M  +M+KLT YE  EI +YP I+F+G NAKKR GV G  NN  YD++Q +YIHV HDH+AYRYE+LK++GKGSFGQV+KA DHKT E VA+K+VRNEKRF RQA EEIR+L  L++ D  +  N+IH+ D F FRNH C+TFELLSINLYELIKKN F+GFSLQLVRKFA+S+L CL+ LY+N IIHCD+KPEN+LLKQQGRSGIKVIDFGSSC E+QRIYTYIQSRFYRAPEVILGGKYG  IDMWS GCILAEL +G+ +FPGE+E DQLACI+E+LG P   +    KR+K FF+ + YPRYC   T +DG V+L GG+S+RG+ RGPP SK+LS AL  C D LFL+F   CL W  + R+TP EALKHPWLRR+
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRR 592          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100447)

HSP 1 Score: 426.787 bits (1096), Expect = 1.548e-137
Identity = 204/388 (52.58%), Postives = 272/388 (70.10%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKK---RAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLR 1797
            T ++P   +++F + LT  E  E+  Y  +++ G +A K   +      T N GYDDD  +Y  + HDHIA+RYE+L+++GKGSFGQV++ALDHKT   VAIK++RN+KRF  QA  E+ +L+ L+++D D + NVIH++D   FR H+C+TFEL+S+NLYELIKKN + GFS+ L+R+F  SI+ CL LLY+  IIHCDLKPENILLKQ+G S IKVIDFGSSC   ++IYTYIQSRFYR+PEVILG +YG  IDMWS GCILAELYTG+P+FPGE+E +QLACIME+LG PP  L  + +R ++FF S+  PR C+ +T                  +  P SK+L+  L +C D+ F+DF  RCL W P  RMTP EA  H +L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPR-CITNTKG---------------RKRSPGSKSLAHIL-HCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089289)

HSP 1 Score: 426.787 bits (1096), Expect = 1.548e-137
Identity = 204/388 (52.58%), Postives = 272/388 (70.10%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKK---RAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLR 1797
            T ++P   +++F + LT  E  E+  Y  +++ G +A K   +      T N GYDDD  +Y  + HDHIA+RYE+L+++GKGSFGQV++ALDHKT   VAIK++RN+KRF  QA  E+ +L+ L+++D D + NVIH++D   FR H+C+TFEL+S+NLYELIKKN + GFS+ L+R+F  SI+ CL LLY+  IIHCDLKPENILLKQ+G S IKVIDFGSSC   ++IYTYIQSRFYR+PEVILG +YG  IDMWS GCILAELYTG+P+FPGE+E +QLACIME+LG PP  L  + +R ++FF S+  PR C+ +T                  +  P SK+L+  L +C D+ F+DF  RCL W P  RMTP EA  H +L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPR-CITNTKG---------------RKRSPGSKSLAHIL-HCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 299/486 (61.52%), Postives = 358/486 (73.66%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEENRQQTN------NHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPL---KRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 1857
            V N     V Q+FEEN  +        N   P+  +               + +P+ +  +   ++ + +S K   S      L+P+ AM+Q+MSKL+ +EH EI SY  I+F+G NAKKR GV+GG+NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CLE L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL +  KR K F +S+ +PRYC  +T  D SV+L GGRS+RG+ RGPP S+   TALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+ +P     KT      +G
Sbjct:   72 VGNHQQIHVQQLFEENSNKRTVLTSQPNGLTPVGRAG--------------LAMPEKQQEISQCRQGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LPKPPTEKTTVKRITEG 542          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 299/486 (61.52%), Postives = 358/486 (73.66%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEENRQQTN------NHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPL---KRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 1857
            V N     V Q+FEEN  +        N   P+  +               + +P+ +  +   ++ + +S K   S      L+P+ AM+Q+MSKL+ +EH EI SY  I+F+G NAKKR GV+GG+NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CLE L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL +  KR K F +S+ +PRYC  +T  D SV+L GGRS+RG+ RGPP S+   TALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+ +P     KT      +G
Sbjct:   62 VGNHQQIHVQQLFEENSNKRTVLTSQPNGLTPVGRAG--------------LAMPEKQQEISQCRQGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LPKPPTEKTTVKRITEG 532          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 299/486 (61.52%), Postives = 358/486 (73.66%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEENRQQTN------NHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPL---KRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 1857
            V N     V Q+FEEN  +        N   P+  +               + +P+ +  +   ++ + +S K   S      L+P+ AM+Q+MSKL+ +EH EI SY  I+F+G NAKKR GV+GG+NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CLE L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL +  KR K F +S+ +PRYC  +T  D SV+L GGRS+RG+ RGPP S+   TALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+ +P     KT      +G
Sbjct:   83 VGNHQQIHVQQLFEENSNKRTVLTSQPNGLTPVGRAG--------------LAMPEKQQEISQCRQGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRR-LPKPPTEKTTVKRITEG 553          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 268/400 (67.00%), Postives = 322/400 (80.50%), Query Frame = 1
Query:  637 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRR---KQIPGNSIT 1827
            + + ++P+ A++Q   ++TT E  EI +Y  I+F+G NAKKR  V GGTNN GYDDDQ  YIHV HDH+AYRYE LK++GKGSFGQV K  DHK  + VA+K+VRNEKRF RQAAEEIR+LE LKKQD   + NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L+R+KIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCILAEL TGYP+FPGEDEGDQLAC+ME+LG PP+KL +  KR K F +S+ +PRYC  ST ++G+++L G RS+RG+ RG P SK   TALK C+D  F+DF  +CL W P TRMTP +AL+HPWL +   K  PG   T
Sbjct:  128 LGSPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVSTLSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGCEDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKT 527          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 268/400 (67.00%), Postives = 322/400 (80.50%), Query Frame = 1
Query:  637 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRR---KQIPGNSIT 1827
            + + ++P+ A++Q   ++TT E  EI +Y  I+F+G NAKKR  V GGTNN GYDDDQ  YIHV HDH+AYRYE LK++GKGSFGQV K  DHK  + VA+K+VRNEKRF RQAAEEIR+LE LKKQD   + NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L+R+KIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCILAEL TGYP+FPGEDEGDQLAC+ME+LG PP+KL +  KR K F +S+ +PRYC  ST ++G+++L G RS+RG+ RG P SK   TALK C+D  F+DF  +CL W P TRMTP +AL+HPWL +   K  PG   T
Sbjct:  129 LGSPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVSTLSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGCEDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLPKPAPGGEKT 528          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:100485120])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 298/463 (64.36%), Postives = 361/463 (77.97%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            V +     V Q+FEEN  +     + +  +  N       +   ++   ++E   +R+  SSS +K++  +    S+ L+P+ AM+Q+M KLT +EHHEIF+YP I+F+G NAKKR GV+GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE LKKQD D+N NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILGG+YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K FF+S+ YPRYC  ++  DGSV+L GGRS+RG+ RGPP S+   TALK CDD LFLDF  +CL W P  RMTP +AL+H WLRR+
Sbjct:  106 VTSHGQIQVQQLFEENSNK-----RTVLTTQPNGLTTVGKSTLPVVSERQLESTHRRQ-GSSSSLKSAEGITKLKSSSLTPEQAMKQYMQKLTAFEHHEIFNYPEIYFLGPNAKKRQGVIGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKLHQHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDNNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRGKNFFSSKGYPRYCTVTSLPDGSVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLTQCLEWDPSLRMTPSQALRHHWLRRR 562          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 273/406 (67.24%), Postives = 321/406 (79.06%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGK 1860
            T L+PD A++Q+  +L+ YE  EI S+  I+FVG NAKKR GV+GG NN GYDDDQ  Y  V HDH+AYRYEVLK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSLQLVRKFA+SIL CLE LYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCIL EL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ YPRYC  +T  +G+ +L G RS+RG+ RG P SK    ALK C+D LF+DF   CLTW P  RMTP +AL+H W+  K++P  S+T+      I  +
Sbjct:   98 TYLTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI-SKRLPKPSVTEKASGKRISSQ 502          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 273/403 (67.74%), Postives = 320/403 (79.40%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNI 1851
            T L+PD A++Q+  +L+ YE  EI S+  I+FVG NAKKR GV+GG NN GYDDDQ  Y  V HDH+AYRYEVLK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSLQLVRKFA+SIL CLE LYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCIL EL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ YPRYC  +T  +G+ +L G RS+RG+ RG P SK    ALK C+D LF+DF   CLTW P  RMTP +AL+H W+  K++P  S+T+      I
Sbjct:  120 TYLTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI-SKRLPKPSVTEKASGKRI 521          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 273/406 (67.24%), Postives = 321/406 (79.06%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGK 1860
            T L+PD A++Q+  +L+ YE  EI S+  I+FVG NAKKR GV+GG NN GYDDDQ  Y  V HDH+AYRYEVLK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSLQLVRKFA+SIL CLE LYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCIL EL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ YPRYC  +T  +G+ +L G RS+RG+ RG P SK    ALK C+D LF+DF   CLTW P  RMTP +AL+H W+  K++P  S+T+      I  +
Sbjct:   91 TYLTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI-SKRLPKPSVTEKASGKRISSQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 273/406 (67.24%), Postives = 321/406 (79.06%), Query Frame = 1
Query:  643 TCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGK 1860
            T L+PD A++Q+  +L+ YE  EI S+  I+FVG NAKKR GV+GG NN GYDDDQ  Y  V HDH+AYRYEVLK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSLQLVRKFA+SIL CLE LYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCIL EL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ YPRYC  +T  +G+ +L G RS+RG+ RG P SK    ALK C+D LF+DF   CLTW P  RMTP +AL+H W+  K++P  S+T+      I  +
Sbjct:   81 TYLTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWI-SKRLPKPSVTEKASGKRISSQ 485          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:MGI Symbol;Acc:MGI:1330301])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 283/409 (69.19%), Postives = 335/409 (81.91%), Query Frame = 1
Query:  589 LKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            + R   SS+ +K+   M    ++ ++P+ AM+Q+M KLT +EHHEIFSYP I+F+G NAKKR G+ GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRS IKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSV+L GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:  128 IHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:MGI Symbol;Acc:MGI:1330300])

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 269/450 (59.78%), Postives = 327/450 (72.67%), Query Frame = 1
Query:  520 GNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMST------CLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK--------QIPGNSIT 1827
            GN+  N + ++   I   +   P  +   S S      N+S+       L+P+ A++Q+   LT YE  EI SYP I+FVG NAKKR GV+GG NN GYDD   +YIHV  DH+AYRYEVLK++GKGSFGQV +  DHK  + VA+KMVRNEKRF RQAAEEIR+LE LKKQD   + NVIH+++ F FRNHVCM FELLSI+LYELIKKNKFQGFS+QLVRKFA SIL  L+ L++NKIIHCDLKPENILLK  GRS  KVIDFGSSC E+Q++YTYIQSRFYRAPE+ILG +Y  PID+WSFGCILAEL TG P+FPGEDEGDQLAC++E+LG PP KL +  KR K F  S+  PRYC  ST  DG V+L GGRS+RG+ RGPP SK  +TALK C D LF++F  RCL W P  R+TP +AL+HPW+ +         ++PG  + 
Sbjct:   93 GNRRSNTLQSDG--ISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRVV 540          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:MGI Symbol;Acc:MGI:1330292])

HSP 1 Score: 438.343 bits (1126), Expect = 7.376e-143
Identity = 207/382 (54.19%), Postives = 267/382 (69.90%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            L+   A++ F ++L+ YE  EI  Y  ++F+G  AKK   V    +   +DD+  SY+ V HDHIAYRYEVL+++GKGSFGQV K LDHK  E VA+K++RN+KRF  QA  E+++LE L+++D D+N NV+H+ D F FRNH+C+TFELL INLYEL+K N F GF+L +VR+F +SIL CL +LY  KIIHCDLKPENI+L Q+G+  +KVIDFGSSC EHQ++YTYIQSRFYR+PEVILG  Y M IDMWS GCI+AELYTGYP+FPGE+E +QLACIME+LG PP   T    R ++FF S+  P+    + +  G                 P SK L+  +K  D   FLDF  RCL W P  RMTP++ALKH W+
Sbjct:  151 LTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPKNI--NNNRGGKRY--------------PDSKDLTMVVKTYDSS-FLDFLRRCLVWEPSLRMTPEQALKHAWI 515          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 295.434 bits (755), Expect = 1.134e-88
Identity = 160/361 (44.32%), Postives = 216/361 (59.83%), Query Frame = 1
Query:  745 TNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRN----KIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQST-----DADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRR 1800
            ++ KK   VL    N GYDDD + YI  + +    RYE+  L+GKGSFGQVVKA DH+T E VAIK+++N+K F  QA  E+RLLEL+ + D +    ++H+   F+FRNH+C+ FELLS NLY+L++   F+G SL L RK A    LC  LL+       IIHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCIL E++TG P+F G +E DQ++ I+E+LG PP  + +   + + +F       + ++ T     D  G    +       +  GP   +         D   F D  LR L + P  R++P  AL+H + RR
Sbjct:   79 SSTKKEKKVL----NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQ--LCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 433          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 295.049 bits (754), Expect = 8.636e-88
Identity = 160/361 (44.32%), Postives = 216/361 (59.83%), Query Frame = 1
Query:  745 TNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRN----KIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQST-----DADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRR 1800
            ++ KK   VL    N GYDDD + YI  + +    RYE+  L+GKGSFGQVVKA DH+T E VAIK+++N+K F  QA  E+RLLEL+ + D +    ++H+   F+FRNH+C+ FELLS NLY+L++   F+G SL L RK A    LC  LL+       IIHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCIL E++TG P+F G +E DQ++ I+E+LG PP  + +   + + +F       + ++ T     D  G    +       +  GP   +         D   F D  LR L + P  R++P  AL+H + RR
Sbjct:  139 SSTKKEKKVL----NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQ--LCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Match: sp|Q92630|DYRK2_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 286/411 (69.59%), Postives = 337/411 (82.00%), Query Frame = 1
Query:  583 DPLKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            D + R   SS+ +K+   M    +T ++P+ AM+Q+M KLT +EHHEIFSYP I+F+G NAKKR G+ GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSV+L GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:  128 DSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Match: sp|Q5ZIU3|DYRK2_CHICK (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus OX=9031 GN=DYRK2 PE=2 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 287/403 (71.22%), Postives = 336/403 (83.37%), Query Frame = 1
Query:  595 RETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            + TD + K+K SV     ++P+ AM+Q+M KLTT+EH+EIF Y  I+F+G NAKKR GV+GG NNCGYDDDQ SYI V HDHIAYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+N NVIH+++ F FR+H+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGS+IL GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:   66 KSTDGTGKVKASV-----MTPEQAMKQYMQKLTTFEHNEIFGYTEIYFLGPNAKKRQGVIGGPNNCGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKMHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRSHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSPKLLDSSKRAKNFVSSKGYPRYCTITTLSDGSIILNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAIRMTPSQALRHPWLRRR 463          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Match: sp|Q5U4C9|DYRK2_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1)

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 283/409 (69.19%), Postives = 335/409 (81.91%), Query Frame = 1
Query:  589 LKRETDSSSKMKTSVNM----STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            + R   SS+ +K+   M    ++ ++P+ AM+Q+M KLT +EHHEIFSYP I+F+G NAKKR G+ GG NN GYDDDQ SY+ V HDH+AYRYEVLK++GKGSFGQVVKA DHK  + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRS IKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSV+L GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:  128 IHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRR 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Match: sp|Q9XTF3|MBK2_CAEEL (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 266/383 (69.45%), Postives = 318/383 (83.03%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  +E +EI++Y  +FFVG++AKK+AGV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPPAS++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  395 PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 777          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Match: sp|A8WJR8|MBK2_CAEBR (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae OX=6238 GN=mbk-2 PE=3 SV=2)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 265/383 (69.19%), Postives = 316/383 (82.51%), Query Frame = 1
Query:  655 PDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            P+ A++ F +KL  YE +EI++Y  +FFVG++AKK+ GV+GG NN GYDD+  SY  V HDHIAYRYEVLK++GKGSFGQV+KA DHK  + VA+K+VRNEKRF RQA EEIR+L+ L++QD D   N+IH++D F FRNH C+TFELLSINLYELIK+NKFQGFSL LVRKFAYS+LLCL+LL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC + QRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+ PGEDE DQLA I+E+LG PP K  +  KR + F TS+ YPRYC  ++  DGSV+L G RSKRG+ RGPP S++ STALKN  D+LF+DF  RCL W PETRMTP +ALKH WLRR+
Sbjct:  394 PEDAVQTFGAKLVPYEKNEIYNYTRVFFVGSHAKKQPGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPESRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRR 776          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18185047 (tr|A0A1I8JL07|A0A1I8JL07_9PLAT Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 287/385 (74.55%), Postives = 337/385 (87.53%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            ++P++AM+ +M KL+T+EHHEIFS+P ++FVG NA KR GV+GG NN GYDD+Q SY H AHDHI+YRYEVLK++GKGSFGQV+K  DHKT   VA+KMVRNEKRFTRQA+EEIR+LE L +QD D++ NV+HI++ F FRNHVC+TFELLS+NLYELIKKNKFQGFSLQLVRKFA+SIL CL++L+RNKIIHCDLKPENILLK QGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWS GCILAELYTG PIFPGEDEGDQLAC ME+LG PPT+L +  KRT++FF+S+ +PRYC   TDADG+  LKGGRS+RG+FRGPP SKTLSTAL+ C+D+ FLDF  RCL W P+ RMTP EAL+H WL+R+
Sbjct: 1237 MTPETAMKLYMQKLSTFEHHEIFSFPQVYFVGQNANKRQGVVGGPNNSGYDDEQGSYQHTAHDHISYRYEVLKIIGKGSFGQVLKCHDHKTNSQVALKMVRNEKRFTRQASEEIRILEQLLRQDRDNSHNVVHILEHFTFRNHVCITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDMLHRNKIIHCDLKPENILLKCQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSLGCILAELYTGVPIFPGEDEGDQLACAMEVLGAPPTRLLEASKRTRVFFSSRGHPRYCSVETDADGATQLKGGRSRRGKFRGPPGSKTLSTALRGCEDRHFLDFLTRCLHWAPDERMTPHEALRHDWLKRR 1621          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20312521 (tr|A0A076G429|A0A076G429_CERLA Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Cerebratulus lacteus OX=6221 PE=2 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 296/465 (63.66%), Postives = 360/465 (77.42%), Query Frame = 1
Query:  412 QKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKM-KTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            Q    + N  +  V Q++E+++ + ++H    N    ++         Q++       P  R + S+  + K S   S+ +SP++AM+Q+M KL+++EHHEIF+YP I+FVG NAKKR GV+GG NN GYDDDQ SY+H+ HDHI+YRYEVLK++GKGSFGQVVKA DHK+   VA+KMVRNEKRF RQA EEIR+LE LKKQD D+  N+IHI + F+FRNH+C+TFELLS+NLYELIKKNKFQGFSLQLVRKFA+SIL CL+ L +N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG KYGMPIDMWS GCILAEL TGYP+FPGEDEGDQLAC++E+LG PP KL D  KR + F +S+ YPRYC  +T  DGS +L  GRS+RG+ RGPP SK + T LK CDD LFLDF  RCL W P TRM+P +AL+H WLRR+
Sbjct:   49 QHGPHLSNHGTVKVQQLYEDSKHRDSSHHHRENQDGAHQQQQSTENTKQVL-------PAVRPSSSAGSLYKNSGKRSSAVSPETAMKQYMHKLSSFEHHEIFNYPQIYFVGHNAKKRQGVIGGPNNNGYDDDQGSYVHIPHDHISYRYEVLKVIGKGSFGQVVKAYDHKSNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHITEHFVFRNHICITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDALNKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGAKYGMPIDMWSLGCILAELLTGYPLFPGEDEGDQLACVIELLGMPPQKLLDQSKRARNFISSKGYPRYCTVTTLPDGSTVLGPGRSRRGKTRGPPGSKEMVTGLKGCDDPLFLDFMRRCLDWDPATRMSPGQALRHAWLRRR 506          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|174477032 (tr|A0A3Q3N826|A0A3Q3N826_9TELE Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 305/477 (63.94%), Postives = 361/477 (75.68%), Query Frame = 1
Query:  451 VTQMFEENRQQ------TNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK--QIPGNSITKTKYSNNIDG 1857
            VTQ++EEN  +        N   PL+++     L   +T+    H  +      + TDS  K+         LSP+  M+QFMSK++++EHHE+FSY  +FF G NAKKR+GV+GG NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHK    VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS+ NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+LLY+N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDE DQLACI+E+LG P  KL D  KR K F +S+ YPRYC  +T  DG+ +L GGRS+RG+ RGPP SK  S ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+  + P  +    K S++  G
Sbjct:   69 VTQLYEENTNKRPVLTSQPNGLAPLSSTRPGLPLPDRHTSEPAQHCRQGSATSNKSTDSKPKVNP-------LSPEQVMKQFMSKMSSFEHHEVFSYTEVFFAGPNAKKRSGVMGGANNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKLQSHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDLLYKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLPDGTTVLNGGRSRRGKVRGPPGSKDWSAALKGCDDPLFLDFLKQCLEWDPSIRMTPSQALRHPWLRRRLPKPPAGTSVGEKVSSSKRG 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|174320191 (tr|K7GF33|K7GF33_PELSI Dual specificity tyrosine phosphorylation regulated kinase 2 OS=Pelodiscus sinensis OX=13735 GN=DYRK2 PE=4 SV=1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 304/464 (65.52%), Postives = 362/464 (78.02%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEEN-RQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMK----TSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            V +     V Q+FE+N  ++T    +P   ++ +K    +  + QI       D   R+  SSS +K    T    ++ ++P+ AM+Q+M KL+ +EHHEIFSYP IFF+G NAKKR GVLGG NNCGYDDDQ SY+ V HDHIAYRYEVLK++GKGSFGQVVKA DHKT + VA+KMVRNEKRF RQAAEEIR+LE L+KQD D+N NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  +T +DGSVIL GGRS+RG+ RGPP S+    ALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:   79 VGSHGQIQVQQLFEDNSNKRTVLTTQPNGLAAVSKSGLSVVQDRQI-------DSAHRQQGSSSSLKLTDGTGKLKASFMTPEQAMKQYMQKLSAFEHHEIFSYPEIFFLGPNAKKRQGVLGGPNNCGYDDDQGSYVQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPAQKLLDSSKRAKNFVSSKGYPRYCTITTLSDGSVILNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAIRMTPSQALRHPWLRRR 535          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|173027093 (tr|A0A4W6CXM1|A0A4W6CXM1_LATCA Protein kinase domain-containing protein OS=Lates calcarifer OX=8187 GN=dyrk2 PE=4 SV=1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 307/485 (63.30%), Postives = 366/485 (75.46%), Query Frame = 1
Query:  451 VTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMST-------CLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRR---KQIPGNSITKTKYSNNIDGKDDPNG 1875
            VTQ++EEN  +     +P+  S  N  L  +++    + LP  +      T    +   + N ST        LSP+ AM+QFMSK++++EHHE+FSYP ++FVG NAKKR+GV+GG NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHK+   VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS+ NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDE DQLACI+E+LG P  KL D  KR K F +S+ YPRYC  +T  DG+ +L GGRS+RG+ RGPP SK  S ALK CDD LFLDF  + L W P  RMTP +AL+HPWLRR   K   G + T  K S++  G    +G
Sbjct:   69 VTQLYEENTNK-----RPVLTSQPNG-LAPLSSTRPGLPLPDRQTSASEPTHHCRQGSATSNKSTDSKPKPNPLSPEQAMKQFMSKMSSFEHHEVFSYPEVYFVGPNAKKRSGVMGGANNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKSQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLPDGTTVLNGGRSRRGKVRGPPGSKDWSAALKGCDDPLFLDFLKQSLEWDPALRMTPSQALRHPWLRRRLPKPPAGTATTGEKTSSSKRGTTTSDG 547          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:103042530])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 301/465 (64.73%), Postives = 352/465 (75.70%), Query Frame = 1
Query:  427 VENFNSFTVTQMFEENRQQTN------NHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            V N     V Q+FEEN  +        N   P+  +       Q  T              ++ + +S K   S      L+P+ AM+Q++SKL+T+EH EIF+YP IFFVG NAKKR GV+GG+NN GYDDDQ SYIHV HDHIAYRYEVLK++GKGSFGQVVKA DHKT + VA+KMVRNEKRF RQAAEEIR+LE L+KQD DS  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDEGDQLAC++E+LG P  KL D  KR K F +S+ YPRYC  ++  DG+V L GGRS+RG+ RGPP SK   TALK CDD LFLDF  +CL W P  RMTP +AL+HPWLRR+
Sbjct:   70 VGNHQQIHVQQLFEENSNKRTVLTTQPNGLTPVTRAGLALPERQQETTQ-----------CRQGSSTSIKSTDSKPKPAPLTPEQAMKQYLSKLSTFEHQEIFNYPEIFFVGPNAKKRPGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIELLGMPSQKLLDSSKRAKNFISSKGYPRYCTVTSLPDGTVALNGGRSRRGKLRGPPGSKDWVTALKGCDDPLFLDFLKQCLEWDPTLRMTPSQALRHPWLRRR 523          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 267/385 (69.35%), Postives = 313/385 (81.30%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            L  + A++Q+  +LT  E  E+ +Y  IFFVG NAKKR  V GG+NNCGYDDDQ  YIHV HDHIAYRYE LK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L R+KIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCILAEL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ +PRYC  +T ++G+++L G RS+RG+ RGPP SK   TALK CDD  F+DF  +CL W P TRMTP  AL+HPWL ++
Sbjct:  136 LGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTTLSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKR 520          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 267/385 (69.35%), Postives = 313/385 (81.30%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            L  + A++Q+  +LT  E  E+ +Y  IFFVG NAKKR  V GG+NNCGYDDDQ  YIHV HDHIAYRYE LK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQAAEEIR+LE LKKQD   + NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L R+KIIHCDLKPENILLKQQGRSGIKVIDFGSSC +HQR+YTYIQSRFYRAPEVILG +YGMPIDMWSFGCILAEL TGYP+FPGEDEGDQLAC+ME+LG PP KL +  KR K F  S+ +PRYC  +T ++G+++L G RS+RG+ RGPP SK   TALK CDD  F+DF  +CL W P TRMTP  AL+HPWL ++
Sbjct:  128 LGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTTLSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKR 512          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 464.922 bits (1195), Expect = 2.526e-153
Identity = 218/393 (55.47%), Postives = 281/393 (71.50%), Query Frame = 1
Query:  616 KMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            K++T       +SP +A++ F S+LT YE  EI  Y  I+++G + KK  G  G   N GYDD+  SY+ V HDHIAYRYEVL+++GKGSFGQV+K LDHKT E VAIK++RN+KRF +QA  E+++L+ ++++D DS  NVIH+ + F FRNH+C++FELL  NLYELIKKN FQGFSL L+R+FA+S+L CL++L+R KIIHCDLKPENILL Q+G+  IKV+DFGSSC E QR+YTYIQSRFYR+PEVILG  Y M IDMWS GCILAELYTGYP+FPGE E +Q+ACIME++G PP        R ++FF S+  PR     T++ G              +  P SK L++ LK  +D LFLDF  RCL W P  RMTP E ++H W+
Sbjct:  120 KIRTYEGQRLPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNV---TNSKGK-------------KRRPNSKELASVLKT-NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWI 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 464.537 bits (1194), Expect = 4.194e-153
Identity = 218/393 (55.47%), Postives = 281/393 (71.50%), Query Frame = 1
Query:  616 KMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            K++T       +SP +A++ F S+LT YE  EI  Y  I+++G + KK  G  G   N GYDD+  SY+ V HDHIAYRYEVL+++GKGSFGQV+K LDHKT E VAIK++RN+KRF +QA  E+++L+ ++++D DS  NVIH+ + F FRNH+C++FELL  NLYELIKKN FQGFSL L+R+FA+S+L CL++L+R KIIHCDLKPENILL Q+G+  IKV+DFGSSC E QR+YTYIQSRFYR+PEVILG  Y M IDMWS GCILAELYTGYP+FPGE E +Q+ACIME++G PP        R ++FF S+  PR     T++ G              +  P SK L++ LK  +D LFLDF  RCL W P  RMTP E ++H W+
Sbjct:  128 KIRTYEGQRLPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNV---TNSKGK-------------KRRPNSKELASVLKT-NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWI 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 266/384 (69.27%), Postives = 314/384 (81.77%), Query Frame = 1
Query:  640 STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPW 1791
            S   SPD A+R +  KLT YEH EI++Y  I+FVG NAKKR GV+GG +NCGYDD+Q SY+HVAHDH+AYRYEVLK++GKGSFGQVVKA DHKT   VA+KMVRNEKRF RQAAEEIR+LE L+KQD +++ N+IH+++ F FR HVCMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L+RN+IIHCDLKPENILLKQ GRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEV+LG +YG PIDMWS GCILAEL TG P+ PGEDEGDQLAC ME+LG PP +L    KR++ F +S+ +PRYC  +   DG+V+L  GRS+RG+ RGPP S+ L  AL+ CDD L LDF   CL W P  R+TP +AL+HPW
Sbjct:   91 SQLASPDQAVRLYGQKLTAYEHQEIYNYAEIYFVGHNAKKRPGVVGGASNCGYDDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 265/391 (67.77%), Postives = 324/391 (82.86%), Query Frame = 1
Query:  640 STCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIK-VIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQI 1809
            ST +SP+ AMR++M +L+ +EHHEIF+Y  ++FVG +AKKR   L G NN G+DD+Q SYIHV HDH+AYRYEVL+++GKGSFGQVVKA DH+T + VA+KMVRNEKRF RQAAEEIR+LE LKKQD ++  NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSLQ+VRKFA+SILLCL  L++N+IIHCDLKPENILL+QQGRSGIK +IDFGSSC EHQR+YTYIQSRFYRAP    GG+YG+PIDMWS GCILAEL TG P+ PGEDEGDQLAC ME+ G PP +L +  KR + FF+S  +PRYC  +T   G V+L GGR++RG+ RGPP+S+  +TALK CDD LF+DF  +CL W P TR+TP +ALKHPWLRR+ +
Sbjct:  101 STAMSPEQAMRKYMHRLSMFEHHEIFNYHEVYFVGPSAKKRQATLSGVNNNGFDDEQGSYIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLNGGRTRRGKLRGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWLRRRPL 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 289.271 bits (739), Expect = 1.121e-85
Identity = 158/348 (45.40%), Postives = 208/348 (59.77%), Query Frame = 1
Query:  850 RYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRN----KIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQST-------DADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQL-FLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPG-NSITKTKYSNNID 1854
            RYE+  L+GKGSFGQVVKA DH+  E VAIK+++N+K F  QA  E+RLLEL+ K D D    ++H+   F+FRNH+C+ FELLS NLY+L++   F+G SL L RKFA    +C  LL+       IIHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCIL E++TG P+F G +E DQ+  I+E+LG PPT + +   + + +F       + V+ T          GS  L             P  + +  A     D L F D  LR L + P+TR+TP  AL+H + ++    G N+      S  ID
Sbjct:  161 RYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQ--MCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKTKDSKREYKTAGSRKLHDIIGVESGG---PGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTNTSNSVSTSPAID 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.743 bits (626), Expect = 9.083e-75
Identity = 139/330 (42.12%), Postives = 189/330 (57.27%), Query Frame = 1
Query:  826 VAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKK-QDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIP 1812
            V H+H+ YRYEVL++LG+GSFG+V+K LDHK+ E VAIK++ N  RF        R +E+LK+ Q    +  +I +++ F FR   C+ FELL+ NL   +K    QGF L++VR FA S+L  LE L    +IH DLKP NI +       +K+ DFG SC +H+  +T IQ+R YRAPEVIL   Y  P DMWS GC LAEL++G  +FPG    DQL  IME+ G PP  + +  +    FF  +          D   +V L  G  +       P S+ L  AL+  D+  F DF   CL W PE R+TP  A+ H W+R  ++P
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHR--REIEILKRLQTARESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACK----------DFSSNVRLNRGLVRV------PGSRALPLALRTTDEH-FTDFIRSCLQWDPEWRLTPHGAMDHEWVRAPRMP 311          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.202 bits (622), Expect = 3.679e-74
Identity = 135/325 (41.54%), Postives = 184/325 (56.62%), Query Frame = 1
Query:  826 VAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKK-QDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLR 1797
            V H+H+ YRYEVL++LG+GSFG+V+K LDHK+ E VAIK++ N  RF        R +E+LK+ Q    +  +I +++ F FR   C+ FELL+ NL   +K    QGF L++VR FA S+L  LE L    +IH DLKP NI +       +K+ DFG SC +H+  +T IQ+R YRAPEVIL   Y  P DMWS GC LAEL++G  +FPG    DQL  IME+ G PP  + +  +    FF   +   + + +      V               P S+ L  AL+  D+  F DF   CL W PE R+TP  A+ H W+R
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHR--REIEILKRLQTARESSKIIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFAITKPTHWDINNHRGLVRV---------------PGSRALPLALRTTDEH-FTDFIRSCLQWDPEWRLTPHGAMDHEWVR 307          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 261.536 bits (667), Expect = 1.468e-75
Identity = 144/372 (38.71%), Postives = 221/372 (59.41%), Query Frame = 1
Query:  778 GTNNCGYDDDQNSYIHVAHDHIAY----RYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELL-KKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFF----------TSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPA------SKTLSTALKNCDDQL-----FLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPG 1815
            G  N G+D+  + YI   +D +      +Y VL +LG+G+FGQVVK  +  T E +A+K+V++   +  Q+  E ++LELL +K DP +  + + + D F+ +NH+C+ FELLS NLYEL+K+NKF G S+QL+R F   IL  L +L  +K+IHCDLKPENILL    +  +K+IDFGSSC E + +YTYIQSRFYRAPE+ILG  Y   IDMWS GCI+AEL+ G PIFPG  E +QL  I++ LG PP+ + D+ K +  F           ++Q++    ++    + +++ K  +      + P         K++  + +  D ++      + F    L   P  R TP++A+ HP++ +++  G
Sbjct:  340 GKCNNGFDNINSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITKQEFTG 711          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 142.124 bits (357), Expect = 6.878e-38
Identity = 99/327 (30.28%), Postives = 162/327 (49.54%), Query Frame = 1
Query:  850 RYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVR--NEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKK----NKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTY---IQSRFYRAPEVILGGK-YGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTS--QRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            +++ L+ LG G++  V K L+  TG  VA+K V+  +E+     A  EI L++ LK +      N++ + D     N + + FE +  +L + +      N  +G  L LV+ F + +L  L   + NKI+H DLKP+N+L+ ++G+  +K+ DFG +      + T+   + + +YRAP+V++G + Y   ID+WS GCILAE+ TG P+FPG ++ +QL  I +I+G P   L     +   +  +  QR PR   Q                            L    K   D   +DF    L   P+ R++ K+AL HPW 
Sbjct:    6 QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHE------NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQ--LKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQ---------------------------VLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 139.813 bits (351), Expect = 1.196e-34
Identity = 84/289 (29.07%), Postives = 144/289 (49.83%), Query Frame = 1
Query:  802 DDQNSYIHVAHDHIAY--RYEVLKLLGKGSFGQVVKALDHK-TGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILL---------------------KQQGRSG---------IKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQP-PTKLTDICKRTKIFFTSQ 1566
            D    Y++  +D      R+ V  LLG+G+FG+V+K +D+K     VA+K++R   R+   A  E+R+L+ +   DP      + + + F ++NH+C+  +L   ++Y+ +  N    F    ++  A  ++  +  L+   IIH DLKPENIL+                     +++   G         IK+IDFGS+   ++     I +R YRAPE++LG  +  P D+WS  C+L EL  G  ++P  +  + +A +  I G P PT + D     K+F+ S+
Sbjct:  294 DKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIID-----KMFYKSK 577          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 135.961 bits (341), Expect = 1.378e-34
Identity = 98/350 (28.00%), Postives = 165/350 (47.14%), Query Frame = 1
Query:  841 IAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVR---NEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFR-NHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGG-KYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTD-ICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNS-ITKTKYSNNIDGKDDP 1869
            I  RY  L  +G G+FG V  A D  T + VAIK +    +     ++   E++LL+ L+ +      N+I + D F+     +    EL   +L+ L++    +    Q V+ F Y IL  L+ ++   +IH DLKP NIL+ +     +K+ DFG +  +  ++  Y+ +R+YRAPE++L   KY + +D+WS GCI AE+  G P+FPG+D   Q + I ++LG PP  + + IC    + F +    R  +                        P S+   T   +      +D   + L + P+ R+T  +AL HP+      P +  +   K+  + +  D P
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHE------NLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEK---QFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINEN--CDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPI------------------------PFSERFKTVEPDA-----VDLLEKMLVFDPKKRITAADALAHPYSAPYHDPTDEPVADAKFDWHFNDADLP 328          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 129.798 bits (325), Expect = 4.395e-33
Identity = 100/346 (28.90%), Postives = 169/346 (48.84%), Query Frame = 1
Query:  841 IAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVR--NEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQF----IFR-NHVCMTFELLSINLYELI--KKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQR----------IYTYIQSRFYRAPEVILG-GKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGN 1818
            I  +Y+++ L+G+G++G V  A+   +G  VAIK ++  ++K F  +   EI+LL    + +     N+I I+D+     I + N V +  EL+  +L ++I  + + F   S   V+ F Y IL  L+ ++  ++IH D+KP N+LL       +KV DFG + C              +  Y+ +R+YRAPE++L   +Y   +D+WS GCILAE+ +G P+FPG D   QL  I+E+LG P  +  +  K       S+R   Y                         PP       +  + +  + +D   + L + P+ R++  EAL+HP+L     P +
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHE-----NIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIK-------SKRAKEYIAN------------------LPMRPPLPWETVWSKTDLNPDM-IDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSD 321          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 306/493 (62.07%), Postives = 362/493 (73.43%), Query Frame = 1
Query:  433 NFNSFTVTQMFEENRQQTNNHFK----PLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPG--------NSITKTKYSNNIDGKDDPNG 1875
            +  S  V Q+FEE   +TNN  +    P+ +  G   +++   +  +I         +R++ +S    T    S   + + AM+Q+M KL+ YE HEIF+Y  I+FVG  AKKR GV+GG NNCGYDD+Q SYIHV  DHIAYRYEVLK++GKGSFGQVVKALDHKT   VA+KMVRNEKRF RQA EEIR+LE LKKQD D+  N+IH+++ F FRNHVCMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG +YGMPIDMWSFGCILAEL TGYP+FPGEDEGDQLAC ME+LG  P KL +  KR K F  S+ YPRYC  +T  DGSV + GGRS+RG+ RG P SKT   ALK CDD +F+DF  RCL W P  RMTP +AL+HPWLRR+ +P          S T T+   +  GK  P G
Sbjct:   38 HLGSIQVQQLFEE---ETNNKLQGKSMPVVHDHGLPSVSRTGRSPSVIE--------RRQSSNS----TGSQKSRSFTAEVAMKQYMHKLSGYETHEIFNYSQIYFVGEAAKKRQGVVGGANNCGYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVAVSGGRSRRGKTRGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALPRAPESNNNLASATSTEKRRSAVGKFPPTG 515          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 436.802 bits (1122), Expect = 4.152e-147
Identity = 208/351 (59.26%), Postives = 272/351 (77.49%), Query Frame = 1
Query:  685 KLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCL 1737
            ++TT+E  EI  YP ++F+G +AKK  GV G   N  YDDD  SY+   HDH+AYRYEVL++LGKGSFGQVVKALDHKTG+ VA+K++RN+KRF +QA  E+++L+ L+K+D D+  N+IH+I+ F FRNH+C+TFEL+ +NLYELIKKN FQGFSL L+R+FA+++L CL+++++ KIIHCDLKPENILL+Q+G++ IKVIDFGSSC EHQR+YTYIQSRFYR+PEVILG  Y M IDMWSFGCILAELYTGYP+FPGE+E +QLACIME+LG P  KL +   R ++FF S+  PR C+  T++ G              +  P+S+ +S ALK  +D LFLDF  +CL
Sbjct:    4 RITTFEQSEILDYPEVWFLGLDAKKIDGVPGAPQNNNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFDSKGIPR-CI--TNSKGK-------------KRRPSSRDISAALKT-NDALFLDFLKQCL 337          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 284.648 bits (727), Expect = 3.108e-87
Identity = 159/361 (44.04%), Postives = 213/361 (59.00%), Query Frame = 1
Query:  787 NCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLY----RNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRY-CVQSTD------ADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQL-FLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKT 1833
            N GYDD+   YI  A +    RYE+  L+GKGSFGQV KA DH+  E +A+K+++N+K F  QA  E++LLEL+ K DPD    ++ +   F++RNH+C+ FELLS NLY+L++   F+G SL L RKFA    +C  LL+       IIHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG  Y + IDMWS GCIL E++TG P+F G +E DQ+  I+E+LG PP  + D   + + FF       Y C++  D      + GS  L             P  + L  A     D L F D  LR L +  +TR+ P  AL H + ++    G + T +
Sbjct:   57 NDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQ--MCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCLKVKDGVKEYLSPGSRKLHDILGCETGG---PGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKKTAEEGTNTTHS 412          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 196.823 bits (499), Expect = 5.165e-55
Identity = 110/349 (31.52%), Postives = 186/349 (53.30%), Query Frame = 1
Query:  799 DDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILL-------------KQQGR----SGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            DD+    I+   D +  RYEV  LLG+G+FG+V++  D KTG+ VA+K+++N +++   A  EI++LE + +++       I ++D F    H+C+ FE + +++++ +K N ++ + L  VR  +Y +++ ++ L+  K+ H DLKPEN+L              KQ  R    S +++IDFGS+  EH+   T + +R YRAPEVIL   +  P D+WS GCI+ ELYTG+ +F   +  + LA +  I+G  P+      ++TK F+      +       + G  +             P     LS +  +   QLF +     L + PE R+T KEA++HP+ 
Sbjct:  107 DDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKG----KLEWDEKSSSGKYV--------RENCKPLKKYMLSDSEGH---QLFFNLLDYLLEYDPEKRITAKEAMQHPFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 189.504 bits (480), Expect = 1.744e-53
Identity = 120/332 (36.14%), Postives = 178/332 (53.61%), Query Frame = 1
Query:  859 VLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILL----KQQGRSGIKVIDFGSSCCEHQRI-YTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQ--------RYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTAL-------KNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            VL+ LG+G+FGQVVK     T E VAIK++++   + RQ   EI +L  L  ++ ++  N +  I+ F  +NH C+ FE+L  NLY+ +K++KF    L+ +R     +L+ L  L    +IH DLKPENI+L    KQ  R  +KVIDFGS+    + +  TY+QSR+YRAPEVILG  +   IDMWS GC++AEL+ G+P++PG  E DQ+  I++  G P   L +   +T  FF            +        + +  +  K  R          A   LS++L       +  D   F+    R LT   E R+TP+EAL H ++
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAENSEAY-NFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFR--VKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFV 329          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:101170635])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 298/482 (61.83%), Postives = 364/482 (75.52%), Query Frame = 1
Query:  451 VTQMFEENRQQ------TNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK-------QIPGNSITKTKYSNNIDG 1857
            VT ++EEN  +        N   PL+++     L +  ++    H        ++ + +S+K   S   +  L+ + AM+QFMSK++++EHHE+FS+  ++F+G +AKKR+GVLGG NN GYDDDQ SYI V HDHIAYRYEVLK++GKGSFGQVVKA DHKT   VA+KMVRNEKRF RQAAEEIR+LE LKKQD DS+ NVIH+++ F FRNH+CMTFELLS+NLYELIKKNKFQGFSL LVRKFA+SIL CL+ L++N+IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YGMPIDMWS GCILAEL TGYP+ PGEDE DQLACI+E+LG P  K+ D  KR K F +S+ YPRYC  +T +DG+ +L GGRS+RG+ RGPP SK  STALK CDD LFLDF  +CL W P  RMTP +AL+H WLRR+         PG+  + +K +   DG
Sbjct:   60 VTPLYEENMNKRPVLTSQPNGLAPLSSTRPGLPLPERQSSEAAQHG-------RQSSATSNKPADSKPKTNPLTAEQAMKQFMSKMSSFEHHEVFSFSEVYFIGPSAKKRSGVLGGPNNGGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKILDASKRAKNFVSSKGYPRYCTVTTLSDGTTVLNGGRSRRGKVRGPPGSKVWSTALKGCDDPLFLDFLKQCLEWDPAHRMTPSQALRHSWLRRRLPKPPTGTTPGDKTSSSKRATT-DG 533          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 312/389 (80.21%), Query Frame = 1
Query:  637 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            M   L+PD A+R + S+L+  E  EI SYP ++FVG NAKKR  V GG+NNCGYDD+Q  YIHV HDH+AYRYE LK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQA EEIR+LE L KQD +   NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L R++IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL TGYP+FPGEDE DQLAC ME+LG PP K+ +  KR K F  S+ +PRYC  +T   G+ +L G RS+RG+ RGPPASK  + ALK C+D  F+DF  +CL W P +R+TP +AL+HPWL R+
Sbjct:  146 MCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRR 534          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 312/389 (80.21%), Query Frame = 1
Query:  637 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            M   L+PD A+R + S+L+  E  EI SYP ++FVG NAKKR  V GG+NNCGYDD+Q  YIHV HDH+AYRYE LK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQA EEIR+LE L KQD +   NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L R++IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL TGYP+FPGEDE DQLAC ME+LG PP K+ +  KR K F  S+ +PRYC  +T   G+ +L G RS+RG+ RGPPASK  + ALK C+D  F+DF  +CL W P +R+TP +AL+HPWL R+
Sbjct:  146 MCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRR 534          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 312/389 (80.21%), Query Frame = 1
Query:  637 MSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            M   L+PD A+R + S+L+  E  EI SYP ++FVG NAKKR  V GG+NNCGYDD+Q  YIHV HDH+AYRYE LK++GKGSFGQV K  DHK  + +A+KMVRNEKRF RQA EEIR+LE L KQD +   NV+H+++ F FRNH+CMTFELLS+NLYELIK+NKFQGFSL LVRKFA+SIL CLE L R++IIHCDLKPENILLKQQGRSGIKVIDFGSSC EHQR+YTYIQSRFYRAPEVILG +YG+PIDMWSFGCILAEL TGYP+FPGEDE DQLAC ME+LG PP K+ +  KR K F  S+ +PRYC  +T   G+ +L G RS+RG+ RGPPASK  + ALK C+D  F+DF  +CL W P +R+TP +AL+HPWL R+
Sbjct:   88 MCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRR 476          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 460.685 bits (1184), Expect = 6.686e-152
Identity = 217/382 (56.81%), Postives = 275/382 (71.99%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWL 1794
            +SP  A+  F  +LT +E  EI +Y  ++F+G  ++K  G  G  +N GYDD+  SYI V HDHIAYR+EVL+++GKGSFGQV+K LDHKT E VAIKM+RN+KRF  QA  E+++LE++KK+D D+  NVIH+ + F FRNH+C++FELL +NLYELIKKN FQGFSL L+R+FA+++L CL++L++ KIIHCDLKPENILL Q+G   IKV+DFGSSC E QR+YTYIQSRFYR+PEVILG  Y M IDMWS GCILAEL+TGYP+FPGE E +Q+ACIME+LG PP        R K+FF S+  PR     T++ G              +  P SK LS ALK  D  LFL+F   CLTW P  RMTP E L+H W+
Sbjct:  132 MSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNLHNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPRNI---TNSKGK-------------KRRPNSKELSAALKTTDP-LFLEFIKGCLTWDPTKRMTPDEGLQHQWI 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 561/561 (100.00%), Postives = 561/561 (100.00%), Query Frame = 1
Query:  202 MYTMDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGXXXXXXXXXXXXXXXXXXXXSLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL 1884
            MYTMDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGAANNIEKTNNNFTNNTISNASLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL
Sbjct:    1 MYTMDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGAANNIEKTNNNFTNNTISNASLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL 561          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 1090.87 bits (2820), Expect = 0.000e+0
Identity = 558/558 (100.00%), Postives = 558/558 (100.00%), Query Frame = 1
Query:  211 MDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGXXXXXXXXXXXXXXXXXXXXSLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL 1884
            MDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGAANNIEKTNNNFTNNTISNASLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL
Sbjct:    1 MDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGAANNIEKTNNNFTNNTISNASLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFKPLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDGKDDPNGLNL 558          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 289/403 (71.71%), Postives = 338/403 (83.87%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 1857
            ++ ++AM+ +M+KLT++EHHEIFSYP I+FVG NAKKR GV+GGT+NCGYDD+QNSY++V HDHIAYR+EV+K+LGKGSFGQVVKA DHK    VA+KM+RNEKRFTRQAAEEIR+LE LKKQDP SN N++HI++ F FRNHVCMTFELL+INLYELIKKNKFQGFSLQLVRKFA+SILLCL+LL+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG  Y M IDMWSFGCILAEL+TG P+FPGEDE DQLACI+E+LG PP  L +  KR K+F  S+ YPRYC    D DG +ILKG RSKRG++RGPP +K++ + LKNC D  F+ F  RCL W+P+ RMTP+EALK  WLRRK  P N       S  +DG
Sbjct:  153 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRK--PPNHFQDNCPSTAVDG 553          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 289/403 (71.71%), Postives = 338/403 (83.87%), Query Frame = 1
Query:  649 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILXXXXXXXXXXXXPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 1857
            ++ ++AM+ +M+KLT++EHHEIFSYP I+FVG NAKKR GV+GGT+NCGYDD+QNSY++V HDHIAYR+EV+K+LGKGSFGQVVKA DHK    VA+KM+RNEKRFTRQAAEEIR+LE LKKQDP SN N++HI++ F FRNHVCMTFELL+INLYELIKKNKFQGFSLQLVRKFA+SILLCL+LL+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG  Y M IDMWSFGCILAEL+TG P+FPGEDE DQLACI+E+LG PP  L +  KR K+F  S+ YPRYC    D DG +ILKG RSKRG++RGPP +K++ + LKNC D  F+ F  RCL W+P+ RMTP+EALK  WLRRK  P N       S  +DG
Sbjct:  107 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRK--PPNHFQDNCPSTAVDG 507          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 271/417 (64.99%), Postives = 329/417 (78.90%), Query Frame = 1
Query:  634 NMSTCLSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDAD---GSVI-------LXXXXXXXXXXXXPPASKTLSTALK----------NCDDQL-------FLDFTLRCLTWIPETRMTPKEALKHPWLRRK 1803
            N+ + L+PD AM+ +M +L+T+EHHEIF+YP I+FVG NAKK+ G+  G NN GYDD+  SY HVAHDH++YRYE+LK+LGKGSFGQVVKA DHKTG  VA+KMVRNEKRF +QA EEI++LE LK QD D+N N++HI++ F FRNHVCMTFELL+INLY LIKKNKFQGFSL LV+KFAYSIL+CL+LL++NK+IHCDLKPENILLKQQGRSGIKVIDFGSSC +HQRIYTYIQSRFYRAPEVILGGKY + IDMWSFGCIL E+ TGYP+FPGEDE DQLACI+E+LG PP    D CKR+K FF S+ YPRYC   T+ +   G  I       LKG +SKRG++RG P SK+L++ +           N D ++       F++F L+CL W+P+ R TPKEAL+H WLRRK
Sbjct:   73 NVPSPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTNFINFLLKCLEWVPDDRFTPKEALRHEWLRRK 489          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+069.59dual specificity tyrosine phosphorylation regulate... [more]
DYRK20.000e+069.59dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+064.66dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+064.66dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+064.66dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-20.000e+069.45Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+069.45Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+069.45Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+069.45Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+068.56Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk31.453e-17266.49gene:FBgn0027101 transcript:FBtr0100406[more]
Dyrk31.453e-17266.49gene:FBgn0027101 transcript:FBtr0100404[more]
Dyrk31.453e-17266.49gene:FBgn0027101 transcript:FBtr0100402[more]
Dyrk21.548e-13752.58gene:FBgn0016930 transcript:FBtr0100447[more]
Dyrk21.548e-13752.58gene:FBgn0016930 transcript:FBtr0089289[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+061.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+061.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+061.52dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+067.00dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+067.00dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+064.36dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+067.24dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+067.74dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+067.24dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+067.24dual specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk20.000e+069.19dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk30.000e+059.78dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk47.376e-14354.19dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.134e-8844.32dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b8.636e-8844.32dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92630|DYRK2_HUMAN0.000e+069.59Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5ZIU3|DYRK2_CHICK0.000e+071.22Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5U4C9|DYRK2_MOUSE0.000e+069.19Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9XTF3|MBK2_CAEEL0.000e+069.45Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|A8WJR8|MBK2_CAEBR0.000e+069.19Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|181850470.000e+074.55tr|A0A1I8JL07|A0A1I8JL07_9PLAT Protein kinase doma... [more]
gnl|BL_ORD_ID|203125210.000e+063.66tr|A0A076G429|A0A076G429_CERLA Dual specificity ty... [more]
gnl|BL_ORD_ID|1744770320.000e+063.94tr|A0A3Q3N826|A0A3Q3N826_9TELE Dual-specificity ty... [more]
gnl|BL_ORD_ID|1743201910.000e+065.52tr|K7GF33|K7GF33_PELSI Dual specificity tyrosine p... [more]
gnl|BL_ORD_ID|1730270930.000e+063.30tr|A0A4W6CXM1|A0A4W6CXM1_LATCA Protein kinase doma... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+064.73dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+069.35dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+069.35dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk42.526e-15355.47dual specificity tyrosine phosphorylation regulate... [more]
dyrk44.194e-15355.47dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+069.27dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+067.77dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa1.121e-8545.40dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007952.19.083e-7542.12pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
ENSPMAT00000007958.13.679e-7441.54pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK11.468e-7538.71Serine-threonine protein kinase; component of a gl... [more]
PHO856.878e-3830.28Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KNS11.196e-3429.07Protein kinase involved in negative regulation of ... [more]
HOG11.378e-3428.00Mitogen-activated protein kinase involved in osmor... [more]
KSS14.395e-3328.90Mitogen-activated protein kinase (MAPK); involved ... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461440.000e+062.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362944.152e-14759.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451873.108e-8744.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337585.165e-5531.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492381.744e-5336.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+061.83dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+067.35dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+067.35dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+067.35dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk46.686e-15256.81dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058389.10.000e+0100.00SMESG000058389.1[more]
SMESG000058389.10.000e+0100.00SMESG000058389.1[more]
SMESG000042409.10.000e+071.71SMESG000042409.1[more]
SMESG000042409.10.000e+071.71SMESG000042409.1[more]
SMESG000064198.10.000e+064.99SMESG000064198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034243 ID=SMED30034243|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2614bp
CTTTGACAAGATGCAATTCTTTTAATGAAATTTCTGTAAAAGCAATTCAA
AATTAAACTTGTTTATTTATAGATCTGTATAAAGAGTATATATTATGACA
CTCGATCTGAATCATATTACATCATTAAATCAACTGCAGGCATGATGTGT
GTTCTACCGAGATAGTATAGCGAATAGTAAATCATATTTCACTTGCTAAC
AATGTATACGATGGATAAAATTCCCAATAATACTCACCTACCATCATTAT
CTACTAATAGACATCATAATCTCGTGTCTTCCACTGCAAATAGTTATAAT
GATGACAATAAAACCGGAGCTGCAAACAATATTGAGAAAACTAACAACAA
TTTTACCAACAATACCATAAGCAATGCTTCACTTCTTAACAAACAAAGAC
CATTTCAACAACAGAAACAAAAAGACGTAGAAAATTTCAACAGTTTTACT
GTCACTCAAATGTTTGAGGAGAATCGACAACAAACGAACAACCATTTTAA
ACCTTTGAATAATAGCAGTGGCAATAAATATCTCAATCAGATCAACACCA
ACAGTCAAATCATCCATTTGCCGAAAATTGAAGATCCATTGAAAAGAGAA
ACCGATTCATCGTCGAAAATGAAAACCTCTGTCAACATGTCTACTTGCTT
GTCGCCCGATTCTGCAATGCGTCAGTTCATGAGCAAATTAACGACCTATG
AGCACCATGAAATTTTCTCCTACCCCAGCATTTTCTTTGTCGGAACTAAC
GCGAAAAAACGAGCAGGTGTTCTTGGGGGCACCAATAACTGTGGATATGA
TGATGACCAAAATTCCTATATTCACGTAGCTCATGACCACATCGCCTATC
GATATGAGGTATTGAAATTATTGGGAAAAGGCAGTTTCGGACAAGTCGTA
AAGGCACTTGACCACAAAACTGGTGAATGTGTTGCAATAAAAATGGTGAG
AAATGAAAAACGGTTTACACGACAAGCAGCGGAAGAAATTCGTTTATTGG
AATTGTTGAAGAAACAAGATCCCGATTCGAATTGCAACGTGATCCACATA
ATAGACCAGTTCATTTTTCGAAATCACGTTTGCATGACATTTGAGCTGCT
AAGCATAAATCTCTATGAATTGATTAAAAAGAACAAATTCCAGGGATTCT
CTCTTCAGCTTGTTCGAAAATTTGCCTATTCTATTCTGCTATGCCTTGAA
CTGCTTTATAGAAATAAAATTATTCATTGTGATCTCAAACCAGAGAATAT
CCTCTTGAAACAACAAGGCCGCAGTGGAATCAAAGTAATCGATTTCGGTT
CAAGTTGTTGTGAACATCAGCGGATTTACACGTACATTCAATCACGGTTC
TATCGAGCTCCAGAGGTGATTCTTGGCGGCAAATATGGAATGCCAATTGA
TATGTGGAGCTTTGGATGTATTCTAGCGGAGTTGTATACAGGATATCCCA
TATTTCCCGGTGAAGATGAAGGTGATCAGTTAGCATGCATAATGGAAATC
CTAGGTCAGCCTCCCACTAAATTAACTGACATTTGTAAACGAACAAAGAT
TTTTTTCACATCACAACGATATCCTCGTTACTGTGTACAAAGTACAGATG
CCGATGGTTCGGTGATATTGAAAGGTGGTCGATCAAAACGTGGCCGCTTT
CGAGGCCCTCCGGCATCAAAAACCTTGAGCACTGCTCTGAAAAACTGTGA
TGACCAACTGTTTCTTGATTTCACTCTGAGATGTTTGACTTGGATTCCTG
AAACGCGAATGACCCCAAAAGAAGCCCTGAAACATCCATGGTTAAGACGA
AAACAAATCCCAGGAAATTCCATAACAAAAACAAAATATTCGAACAACAT
AGACGGCAAGGACGACCCAAACGGATTGAATTTATGATCAATAATCTCAC
TAATGTTTGTAATAAAGAAAAAAAAGAAATAACTAAATGAGAAAAAAATG
AAAACGTTTTGATTTTTTTCTTTCAAATTTTCCATACTATTTAATTTAGT
GCCTCGTTTTTATTCCTATTGAAGTCTGGATCTCGTATGTGAGTTCCATT
CCGGGTGTACATTACATTATTTATTTCGGTTTTCATTTGCTTATTTTGTC
AGAGTTTCTACATTTTGCTCTGTAAATTTATCGCTTTTCCAATATCAAAA
AACAAAAACAAAAGAGGTACAAATTTAGCTGGAAACTATCTCAAATCCAA
CGAGAAAGTTTTTCTATAGAGAATTGTGAAATGTATTTTTCTATTGGTCG
ATTAATTTCATTGGTAGATTTGTAATTATTTTTTATTTTTAATTATAACA
ATAATAATAATAACTATTATTATTATTACATTTGGTTTGACTGCTTAGTT
TCCAAGCAGAACCTCTCCAATAAAAAATGTAACTATTTCTGAAAAAGAAA
AAAATGTTTATTTATTTATTGATAATTTTAACGCGGTGGAACCGGAAAAT
CTGTAGGAACAGAAAATGTTTAACATTTAGTCTGTGAGTTTGATGTGGAT
CTTGTGTGTAAGAGTTTTTGTAAGAATTTAATTTTACACTTAGAACCGGT
CTTGTTTTGCAGCTGATGTTTTGTGGTCATTCTGTTGCAGTAAGACAATG
ATGATGATGATGAT
back to top

protein sequence of SMED30034243-orf-1

>SMED30034243-orf-1 ID=SMED30034243-orf-1|Name=SMED30034243-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MYTMDKIPNNTHLPSLSTNRHHNLVSSTANSYNDDNKTGAANNIEKTNNN
FTNNTISNASLLNKQRPFQQQKQKDVENFNSFTVTQMFEENRQQTNNHFK
PLNNSSGNKYLNQINTNSQIIHLPKIEDPLKRETDSSSKMKTSVNMSTCL
SPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYD
DDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVR
NEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELL
SINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENI
LLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPID
MWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKI
FFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCD
DQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNI
DGKDDPNGLNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042521DYRK
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0043130ubiquitin binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007224smoothened signaling pathway
GO:0016310phosphorylation
GO:0045725positive regulation of glycogen biosynthetic process
GO:0051534negative regulation of NFAT protein import into nucleus
GO:1901796regulation of signal transduction by p53 class mediator
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 218..531
e-value: 1.6E-84
score: 296.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 218..531
e-value: 2.2E-54
score: 184.6
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 218..531
score: 38.506
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 200..299
e-value: 8.4E-123
score: 411.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 274..531
e-value: 8.4E-123
score: 411.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..561
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 541..555
NoneNo IPR availablePANTHERPTHR24058:SF112DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 3 HOMOLOG-RELATEDcoord: 50..540
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 50..540
IPR042521Dual specificity tyrosine-phosphorylation-regulated kinaseGENE3DG3DSA:1.10.8.980coord: 103..192
e-value: 1.3E-16
score: 62.7
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 224..247
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 340..352
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 208..535