Cell cycle control protein 50A

Overview
NameCell cycle control protein 50A
Smed IDSMED30034222
Length (bp)2437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell cycle control protein 50A (SMED30034222) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell cycle control protein 50A (SMED30034222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell cycle control protein 50A (SMED30034222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell cycle control protein 50A (SMED30034222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034222SMESG000023184.1 SmedASXL_009603SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034222SMESG000023184.1 SMESG000023186.1 dd_Smed_v6_22194_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30B (transmembrane protein 30B [Source:HGNC Symbol;Acc:HGNC:27254])

HSP 1 Score: 162.925 bits (411), Expect = 1.734e-43
Identity = 101/311 (32.48%), Postives = 153/311 (49.20%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFK---DSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYIS--SNSTIAVPWTSVNISWETDRNELYGKPS--------SFNNTVKPINWKYSALERS---SNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            +++P +  F Q +L      L A    P+    G+ FI +G+ L    + I+E   DYT      N  + C        +      C C   FS+   F+G V  YY+LTNFYQN + Y +S+DD QL G     +   + C PY  ++     APCGAI NS+FND+F L++        + VP     I+W TD +  +  P         +F  T  P NW+    E S   +N+   +++ +VWM+ AA PTFRKL+ R+ Q N ++ GL +G Y + I Y++PV  F G K    ++  W+  K+P
Sbjct:   10 AHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGNCSV-CAAAGQGRALPP---PCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGN-YSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNP 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 162.155 bits (409), Expect = 3.641e-43
Identity = 109/310 (35.16%), Postives = 164/310 (52.90%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNS-TIAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINW---KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ RP +  F Q +L      L A  + P+  ++G++FI IGI +    + I+E  IDYT       P   C     N  ++ +   CFC  NF++  +F+G+V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +L+ I ++S  I +      I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L + Y++PV  F+G K   ++T  W+  K+P
Sbjct:   24 KTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGT----EPSSPC-----NKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRN-EDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNP 323          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 137.117 bits (344), Expect = 7.711e-35
Identity = 79/211 (37.44%), Postives = 116/211 (54.98%), Query Frame = 3
Query: 1755 FKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNS-TIAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINW---KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
             +G+V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +L+ I ++S  I +      I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L + Y++PV  F+G K   ++T  W+  K+P
Sbjct:   78 IEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRN-EDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNP 287          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 134.035 bits (336), Expect = 1.097e-34
Identity = 77/205 (37.56%), Postives = 112/205 (54.63%), Query Frame = 3
Query: 1773 FYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNS-TIAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINW---KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
             YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +L+ I ++S  I +      I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L + Y++PV  F+G K   ++T  W+  K+P
Sbjct:    1 MYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRN-EDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNP 204          
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Match: TMEM30A (transmembrane protein 30A [Source:HGNC Symbol;Acc:HGNC:16667])

HSP 1 Score: 134.035 bits (336), Expect = 1.097e-34
Identity = 77/205 (37.56%), Postives = 112/205 (54.63%), Query Frame = 3
Query: 1773 FYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNS-TIAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINW---KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
             YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +L+ I ++S  I +      I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L + Y++PV  F+G K   ++T  W+  K+P
Sbjct:    1 MYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRN-EDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNP 204          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 167.933 bits (424), Expect = 8.831e-46
Identity = 104/305 (34.10%), Postives = 151/305 (49.51%), Query Frame = 3
Query: 1464 NRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMN-SQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIA-VPWTSVNISWETDRNELYGKP--------SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQ-TNP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            NRPK     Q +L      L A  + P + V+G +F+ IG++L    D + E  ++YT C S                         C    ++ + F GDV  YY L N+YQN++ Y  S++D Q  G     KD C P+ ++ +  +  APCGAI NSIFNDTF L + +    +  VP T+  + W  D++  +  P         +FNNT KP NW  +  E       E+ + IVWM+ AA P F+KL R + + TNP F+ GL QG Y+L +  ++PV  F G K F I+T  W   K+
Sbjct:   29 NRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP------------------------CQLQINLPNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNVKD-CAPFDIDPATKKPIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGG---FENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKN 305          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 167.933 bits (424), Expect = 8.831e-46
Identity = 104/305 (34.10%), Postives = 151/305 (49.51%), Query Frame = 3
Query: 1464 NRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMN-SQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIA-VPWTSVNISWETDRNELYGKP--------SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQ-TNP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            NRPK     Q +L      L A  + P + V+G +F+ IG++L    D + E  ++YT C S                         C    ++ + F GDV  YY L N+YQN++ Y  S++D Q  G     KD C P+ ++ +  +  APCGAI NSIFNDTF L + +    +  VP T+  + W  D++  +  P         +FNNT KP NW  +  E       E+ + IVWM+ AA P F+KL R + + TNP F+ GL QG Y+L +  ++PV  F G K F I+T  W   K+
Sbjct:   29 NRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP------------------------CQLQINLPNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNVKD-CAPFDIDPATKKPIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGG---FENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKN 305          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: F20C5.4 (pep chromosome:WBcel235:IV:8764867:8767450:1 gene:WBGene00008969.1 transcript:F20C5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F20C5.4)

HSP 1 Score: 159.073 bits (401), Expect = 1.628e-42
Identity = 103/318 (32.39%), Postives = 159/318 (50.00%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYL---MNSQNQYYAPCGAIPNSIFNDTFQLYYI---SSNSTIAVPWTSVNISWETDRNELYGKP---------SSFNNTVKPINWKYSALERSSNSYK-------EDEELIVWMKLAAFPTFRKLHRRL-IQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            K N+PKD P+ Q +L  +    +     P+ L+ G+  + +GI L    +   E  I YT C   N    T    ++ T + +    C      +++  + G+V FYY L+ FYQN + Y  S++D QL GK     D C P     +N      APCG + +S+FNDTF+L+YI   +SN+   VPWT+  +   T+    +  P           F  T+ P +W+Y   +   NS         E+ + +VWMK+AA P FRKL+R L  Q + F+ GL +G Y L INY++PV  ++G K F I   +W+  ++
Sbjct:   14 KKNQPKDTPWKQQKLPALRPHYNITSAIPVTLITGVATLAMGIALYFGHNGSLEQEIVYTDCALSNG---TQASRIMRTEMGNQTFKC--AYTITLNDDYTGEVKFYYGLSKFYQNNRLYFNSRNDQQLRGKVTE-TDGCDPLEYVDVNGTKVPIAPCGKVADSMFNDTFELFYINDKASNAVTRVPWTTRGVLGATEMKRKFRNPIRAENQTLCDVFAGTMPPPSWRYPICQLGLNSIDPDVGIGFENIDFMVWMKVAALPKFRKLYRILNRQVDMFSNGLPKGQYQLTINYNYPVDMYSGDKYFVIANENWVGPRN 325          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.133e-16
Identity = 47/126 (37.30%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 1995 VPWTSVNISWETDRNELYGKP--------SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQT-NP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            VP T+  + W  D++  +  P         +FNNT KP NW  +  E       E+ + IVWM+ AA P F+KL R + +T NP F+ GL QG Y+L +  ++PV  F G K F I+T  W   K+
Sbjct:    2 VPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGG---FENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKN 124          
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Match: chat-1 (CDC50 family protein chat-1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0H3])

HSP 1 Score: 78.5666 bits (192), Expect = 1.133e-16
Identity = 47/126 (37.30%), Postives = 67/126 (53.17%), Query Frame = 3
Query: 1995 VPWTSVNISWETDRNELYGKP--------SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQT-NP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            VP T+  + W  D++  +  P         +FNNT KP NW  +  E       E+ + IVWM+ AA P F+KL R + +T NP F+ GL QG Y+L +  ++PV  F G K F I+T  W   K+
Sbjct:    2 VPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGG---FENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKN 124          
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Match: CDC50 (gene:FBgn0030752 transcript:FBtr0343350)

HSP 1 Score: 184.496 bits (467), Expect = 1.285e-51
Identity = 121/317 (38.17%), Postives = 161/317 (50.79%), Query Frame = 3
Query: 1437 NKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVL-LNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFG--KGPPFKDSCKPYLMN-SQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPS-----SFNNTVKPINWKYSAL----ERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            N+ S   KS RP D  F Q +L      L A+ + P   V+G++FI IG+ L    +T  E  IDYT C   +    TC + L  N  VT     C C   F + S F G V  YY LTN+YQN++ Y  S+DD QL G     P  D C P+  +    +  APCGAI NS+FNDT  L    S     +      I+W +D+   +  P      S     KPI W+        E   N+  ++E+LIVWM+ AA P+FRKL+RRL QTN  +  GL  GNY L I Y++PV  F+GTK   ++T   L  K+P
Sbjct:    8 NEESAAAKSKRPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFIPIGVVLLHLSNTANELIIDYTKCRR-SGGNTTCAEYLEANPGVT-----CPCEVPFVLPSDFNGVVYMYYGLTNYYQNHRRYVKSRDDEQLLGHLSQTPSTD-CAPFAYDPDSGKPIAPCGAIANSLFNDTLTLLQGGSE----IKLLKTGIAWPSDKRVKFRNPEGNLNVSLEGFSKPIFWQKGLADLDPENPDNNGFQNEDLIVWMRTAALPSFRKLYRRLNQTNTNYANGLKSGNYTLNIKYNYPVVSFDGTKRMILSTTSVLGGKNP 313          
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Match: CDC50 (gene:FBgn0030752 transcript:FBtr0074301)

HSP 1 Score: 184.882 bits (468), Expect = 1.339e-51
Identity = 123/317 (38.80%), Postives = 164/317 (51.74%), Query Frame = 3
Query: 1437 NKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVL-LNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFG--KGPPFKDSCKPYLMN-SQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPS-----SFNNTVKPINWKYSAL----ERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            N+ S   KS RP D  F Q +L      L A+ + P   V+G++FI IG+ L    +T  E  IDYT C   +    TC + L  N  VT     C C   F + S F G V  YY LTN+YQN++ Y  S+DD QL G     P  D C P+  +    +  APCGAI NS+FNDT  L  +   S I +  T   I+W +D+   +  P      S     KPI W+        E   N+  ++E+LIVWM+ AA P+FRKL+RRL QTN  +  GL  GNY L I Y++PV  F+GTK   ++T   L  K+P
Sbjct:    8 NEESAAAKSKRPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFIPIGVVLLHLSNTANELIIDYTKCRR-SGGNTTCAEYLEANPGVT-----CPCEVPFVLPSDFNGVVYMYYGLTNYYQNHRRYVKSRDDEQLLGHLSQTPSTD-CAPFAYDPDSGKPIAPCGAIANSLFNDTLTL--LQGGSEIKLLKTG--IAWPSDKRVKFRNPEGNLNVSLEGFSKPIFWQKGLADLDPENPDNNGFQNEDLIVWMRTAALPSFRKLYRRLNQTNTNYANGLKSGNYTLNIKYNYPVVSFDGTKRMILSTTSVLGGKNP 313          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30ab (transmembrane protein 30Ab [Source:ZFIN;Acc:ZDB-GENE-030131-5884])

HSP 1 Score: 191.815 bits (486), Expect = 9.488e-54
Identity = 112/311 (36.01%), Postives = 164/311 (52.73%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD---SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-IAVPWTSVNISWETDRNELYGKPSS--------FNNTVKPINWKYSALERSSNSYKE---DEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            ++ +P +  F Q +L      L A  + P   V+G++FI IGI L    + I+E  IDYT    +++P   C       + T     C C  +FS+   F+ +V  YY L+NFYQN++ Y  S+DD QL G     K+    C+PY +N  N+  APCGAI NS+FNDT  L+YI  N T   +P     I+W TD++  +  P          F +T KPINW+    E  ++       +E+ IVWM+ AA PTFRKL+R + + N     L +GNY L + Y++PV  F G K   ++T  W+  K+P
Sbjct:   27 RTRKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLYVTSNNIKEFEIDYTGT-DMSSPCFNCSQSFSWNSTT----PCKCTLSFSLDQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDERSLKEPSKECEPYRIN-DNKRIAPCGAIANSMFNDTLDLFYIDPNGTKTQIPMIKKGIAWWTDKHVKFRNPGGNNPNLTAVFIDTAKPINWRKPVYELDTDPENNGFINEDFIVWMRTAALPTFRKLYRIIQKKNNMTPTLPRGNYSLEVTYNYPVRSFEGRKRMILSTISWMGGKNP 331          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30c (transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GENE-040426-1127])

HSP 1 Score: 187.193 bits (474), Expect = 2.139e-52
Identity = 109/312 (34.94%), Postives = 163/312 (52.24%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSN-STIAVPWTSVNISWETDRNELYGKP---------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            S RP +  F Q +L      L A+ + P+  ++ +V + +GIWL   +    +  +DYT   +       C+++  N T T     C C  NF +   F GDV FYY L NF+QN + Y  S+DD Q+ G+    K     C P+  ++     APCGA+ NS+FND+F L Y  +N + + VP     I+W TD+N  +  P          +F  T +P+ W++S  E     S+N+   +++LIVWM+ AAFP F+KL+  L +   PF EGL  GNY + INY+FPV PF G K   I+   W   ++
Sbjct:   12 SRRPDNSAFKQQRLPAWSPSLTAQTVLPIFYILAVVCLLLGIWLLITVQNTHQLKVDYTDAGTCER----CFELHANNTRT----VCTCSVNFYVPRPFPGDVFFYYGLRNFHQNLRRYMDSRDDAQMVGRKKNLKAPSSYCAPFHYDANGVPIAPCGAVANSMFNDSFTLVYHQANGAEVQVPLYRKGIAWYTDKNVKFRNPPTNNTFSLRQAFEGTTRPLYWQHSVYELDDTDSNNNGFINDDLIVWMREAAFPNFKKLYGVLNRAQEPFTEGLPAGNYNISINYNFPVEPFRGRKELVISMVTWFGGQN 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30c (transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GENE-040426-1127])

HSP 1 Score: 185.267 bits (469), Expect = 1.256e-51
Identity = 108/312 (34.62%), Postives = 163/312 (52.24%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSN-STIAVPWTSVNISWETDRNELYGKP---------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            S RP +  F Q +L      L A+ + P+  ++ +V + +GIWL   +    +  +DYT   +       C+++  N T T     C C  NF +   F GDV FYY L NF+QN + Y  S+DD Q+ G+    K     C P+  ++     APCGA+ NS+FND+F L Y  +N + + VP     I+W TD+N  +  P          +F  T +P+ W++S  E     S+N+   +++LIVWM+ AAFP F+KL+  L +   PF EGL  GNY + I+Y+FPV PF G K   I+   W   ++
Sbjct:   12 SRRPDNSAFKQQRLPAWSPSLTAQTVLPIFYILAVVCLLLGIWLLITVQNTHQLKVDYTDAGTCER----CFELHANNTRT----VCTCSVNFYVPRPFPGDVFFYYGLRNFHQNLRRYMDSRDDAQMVGRKNNLKAPSSYCAPFHYDANGVPIAPCGAVANSMFNDSFTLMYHQANGAEVQVPLYRKGIAWYTDKNVKFRNPPTNNTFSLRQAFEGTTRPLYWQHSVYELDDTDSNNNGFINDDLIVWMREAAFPNFKKLYGVLNRAQEPFTEGLPAGNYNISIDYNFPVEPFRGRKELVISMVTWFGGQN 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: cmss1 (cms1 ribosomal small subunit homolog [Source:NCBI gene;Acc:450027])

HSP 1 Score: 185.267 bits (469), Expect = 1.256e-51
Identity = 108/312 (34.62%), Postives = 163/312 (52.24%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSN-STIAVPWTSVNISWETDRNELYGKP---------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            S RP +  F Q +L      L A+ + P+  ++ +V + +GIWL   +    +  +DYT   +       C+++  N T T     C C  NF +   F GDV FYY L NF+QN + Y  S+DD Q+ G+    K     C P+  ++     APCGA+ NS+FND+F L Y  +N + + VP     I+W TD+N  +  P          +F  T +P+ W++S  E     S+N+   +++LIVWM+ AAFP F+KL+  L +   PF EGL  GNY + I+Y+FPV PF G K   I+   W   ++
Sbjct:   12 SRRPDNSAFKQQRLPAWSPSLTAQTVLPIFYILAVVCLLLGIWLLITVQNTHQLKVDYTDAGTCER----CFELHANNTRT----VCTCSVNFYVPRPFPGDVFFYYGLRNFHQNLRRYMDSRDDAQMVGRKNNLKAPSSYCAPFHYDANGVPIAPCGAVANSMFNDSFTLMYHQANGAEVQVPLYRKGIAWYTDKNVKFRNPPTNNTFSLRQAFEGTTRPLYWQHSVYELDDTDSNNNGFINDDLIVWMREAAFPNFKKLYGVLNRAQEPFTEGLPAGNYNISIDYNFPVEPFRGRKELVISMVTWFGGQN 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 184.882 bits (468), Expect = 1.294e-51
Identity = 111/313 (35.46%), Postives = 166/313 (53.04%), Query Frame = 3
Query: 1449 KNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPS--------SFNNTVKPINWKYSALERSS----NSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            + + + RP +  F Q +L      L A  + P  LV+G+ FI IG+ L     TIQ   +DYT   + +    +C+   + ++      +C C   FS+   F G V FYY L+N+YQN++ Y +S D  QL G    F   +  C PY  ++QN+   PCGAI NS+FNDTF+LY I + +   VP     I+W TD N  Y  PS        +F  TVKPINW   A +  S    N+   +++ +VWM+ AA P FRKL+RR+ + N +  GL  GNY + ++Y++PV  F+G K    +   W+  ++
Sbjct:    4 EGETAQRPDNTAFTQQRLPAWQPILSAGIVIPGFLVIGLAFIGIGVGLFLTSQTIQVLEMDYTGVATDS----SCFRCSMTSS-----QNCTCEITFSLDKLFTGPVFFYYGLSNYYQNFRKYGVSLDYYQLSGDTQYFTSPQSVCSPYSYDNQNRPIVPCGAIANSMFNDTFELYQIINGTKNLVPLDGKGIAWWTDYNIKYRNPSFVNGSLANAFAGTVKPINWPKPAYDLDSTDPNNNGFLNQDFLVWMRRAALPQFRKLYRRITEGN-YAAGLPAGNYSMTVHYNYPVLTFDGRKKVVFSNVSWMGGRN 306          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: arhgap40 (Rho GTPase activating protein 40 [Source:Xenbase;Acc:XB-GENE-6050151])

HSP 1 Score: 194.897 bits (494), Expect = 8.179e-55
Identity = 117/311 (37.62%), Postives = 162/311 (52.09%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD---SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSS--------FNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            KS +P +  F Q +L      L A  + P   ++GIVFI IGI +    + I+E  IDYT      +P   CY  L    VT N   C C  NF++   F+ +V  YY L+NFYQN++ Y  S+DD QL G      +    C+PY  N   +  APCGAI NS+FNDT  LY I + +   +P     I+W TD+N  +  P+         F  T KPINWK    E       N+   +E+ IVWM+ AA PTFRKL+R + +T+     L  GNY L + Y++PV  F+G K   ++T  W+  K+P
Sbjct:   26 KSKKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGIVFIPIGIGIFVTSNNIREFEIDYTGI----DPSSPCYKCL---NVTLNDPPCTCTINFTLDYAFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKNSLTNPSKECEPYRTNGS-KPIAPCGAIANSMFNDTLVLYQIVNGAEKQIPLVKKGIAWWTDKNVKFKNPTGNASNLEAVFAGTTKPINWKKPVYELDPSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIEKTDATYPTLAPGNYSLVVEYNYPVRSFDGRKRMILSTISWMGGKNP 328          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: btf3l4 (basic transcription factor 3-like 4 [Source:Xenbase;Acc:XB-GENE-948236])

HSP 1 Score: 181.415 bits (459), Expect = 4.257e-50
Identity = 114/317 (35.96%), Postives = 162/317 (51.10%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYT------YCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFG-----KGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSS--------FNNTVKPINW---KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            S RP +  F Q +L      L A  + P     G+ FI IG+ L    ++I+ES  DYT      YCY+  N                    C C   F+I+  F+G V  YY+L+N+YQN+  Y +S D  QL G     K P   + C PY  +S+N   APCGA+ NS+FND   L+Y  + + + VP T   ISW +D N  +  P++        FN T KP NW    Y+  +  SN+   +E+ IVWM+ AA P+FRKL+RR I++  F  GL  G Y+L I Y++PV  F+G K    ++  W+  K+P
Sbjct:   16 SQRPDNTAFTQQRLPAWQPLLSASIVIPFFFFAGLSFIAIGLGLYYSSNSIKESEFDYTGAVLGDYCYNCRNESR----------------GCTCNVPFNITEFFQGPVCMYYELSNYYQNHYRYMISVDPKQLGGLIDNLKAP--SNYCSPYQWDSKNLPIAPCGAVANSMFNDVISLHYKDNGTYVEVPLTRKGISWWSDYNVKFQNPTNGNETLAQVFNGTAKPSNWLTPAYNLSDDPSNTGFINEDFIVWMRRAALPSFRKLYRR-IESGNFTTGLPPGEYLLKIVYNYPVLSFDGRKKIVFSSLSWMGGKNP 313          
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Match: tmem30cp (transmembrane protein 30C, pseudogene [Source:NCBI gene;Acc:448286])

HSP 1 Score: 164.466 bits (415), Expect = 5.271e-44
Identity = 105/310 (33.87%), Postives = 165/310 (53.23%), Query Frame = 3
Query: 1470 PKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGI-WLKAEIDTIQESFIDYT-YCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS------CKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-IAVPWTSVNISWETDRNELYGKPSSFNNTV-------KPINWKYSALERSSNSYK---EDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            P +  F Q ++    + L AK +     ++G   + +GI W+ A ++ ++E  I+Y+ YC       +TC D+  N++ ++    C C+ NF++    +GDV  YY L NF+QN++ Y +S+ D QL G+     ++      C P+         APCGAI NS+FNDT  LYY ++ +T I VP      +W +D+N  +  P   NN V       +P  W+       S+ Y    E+++ I+WM++AAFP FRKL+RRL +   F  GL  GNY   I+Y+FPVS F G K  ++TT  W   ++
Sbjct:   20 PDNTAFKQQRVPAWRLTLSAKAVLSSFFLIGSFCLAVGISWIVATVN-VKEIAINYSDYC-------VTCSDLRQNSSNSEK--PCNCVVNFTVPGELQGDVFMYYGLNNFFQNHRRYVISRYDTQLLGRNVTNSETITKSTNCAPFSTYQNGTPMAPCGAIANSLFNDTITLYYYTTATTKIPVPLLRTGNTWWSDKNIKFKNPQPVNNLVQAFAGSARPPYWQKPPYLLDSDPYNNGYENDDFIIWMRVAAFPNFRKLYRRLSRVQQFANGLPAGNYSYSIDYNFPVSKFKGQKYIYLTTLSWCGGRN 319          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30a (transmembrane protein 30A [Source:MGI Symbol;Acc:MGI:106402])

HSP 1 Score: 176.407 bits (446), Expect = 2.606e-48
Identity = 113/313 (36.10%), Postives = 168/313 (53.67%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST---IAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ RP +  F Q +L      L A  + P   ++G++FI IGI +    + I+E  IDYT       P   C     N  ++ N  SC C  NF++  +F+G+V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +LY +++ S    I +P     I+W TD+N  +  P         F +T+KP+NW  +  E      SN+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   24 KTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGT----EPSSPC-----NKCLSPNVTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRN-EDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNP 326          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30c (transmembrane protein 30C [Source:MGI Symbol;Acc:MGI:1918277])

HSP 1 Score: 163.31 bits (412), Expect = 6.238e-44
Identity = 104/303 (34.32%), Postives = 156/303 (51.49%), Query Frame = 3
Query: 1455 DKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYY-ISSNSTIAVPWTSVNISWETDRNELYGKP------SSFNNTVKPINWKYSA----LERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWL 2330
            D S  P++    Q  L    + L A  +  +  + G   + IGI L     + ++  I+YT   +       C  +  N++  D   +C C   F +    +GDV  YYKL  FYQN   Y LS+ + QL GK      +C P+ ++  +    PCGAI NSIFNDT  L Y ++S++ I VP     ++W TD+   +  P      S+F  + KP++W        L+   N+   +E+ IVWM+ AAFPTF+KL+RRL + + F EGL  GNY L I+Y+FPV+ F G K   ++T  W+
Sbjct:    8 DLSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAKSTKKIEINYTKTCA------NCAQLRENSSNFDK--ACNCSLPFYLPEKMEGDVYMYYKLYGFYQNLYQYILSRSNSQLVGKDIWDTTNCDPFQVSHNDTPIIPCGAIANSIFNDTITLSYNLNSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGNNGFLNEDFIVWMRTAAFPTFKKLYRRLKRVHAFAEGLPAGNYSLSISYNFPVTMFQGEKSIVLSTLTWI 302          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30c (transmembrane protein 30C [Source:MGI Symbol;Acc:MGI:1918277])

HSP 1 Score: 163.31 bits (412), Expect = 6.238e-44
Identity = 104/303 (34.32%), Postives = 156/303 (51.49%), Query Frame = 3
Query: 1455 DKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYY-ISSNSTIAVPWTSVNISWETDRNELYGKP------SSFNNTVKPINWKYSA----LERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWL 2330
            D S  P++    Q  L    + L A  +  +  + G   + IGI L     + ++  I+YT   +       C  +  N++  D   +C C   F +    +GDV  YYKL  FYQN   Y LS+ + QL GK      +C P+ ++  +    PCGAI NSIFNDT  L Y ++S++ I VP     ++W TD+   +  P      S+F  + KP++W        L+   N+   +E+ IVWM+ AAFPTF+KL+RRL + + F EGL  GNY L I+Y+FPV+ F G K   ++T  W+
Sbjct:    8 DLSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAKSTKKIEINYTKTCA------NCAQLRENSSNFDK--ACNCSLPFYLPEKMEGDVYMYYKLYGFYQNLYQYILSRSNSQLVGKDIWDTTNCDPFQVSHNDTPIIPCGAIANSIFNDTITLSYNLNSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGNNGFLNEDFIVWMRTAAFPTFKKLYRRLKRVHAFAEGLPAGNYSLSISYNFPVTMFQGEKSIVLSTLTWI 302          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30b (transmembrane protein 30B [Source:MGI Symbol;Acc:MGI:2442082])

HSP 1 Score: 163.31 bits (412), Expect = 8.711e-44
Identity = 102/312 (32.69%), Postives = 152/312 (48.72%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLT-CYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFK---DSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYIS--SNSTIAVPWTSVNISWETDRNELYGKPS--------SFNNTVKPINWKYSALERS---SNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            +++P +  F Q +L      L A    P+    G+ FI +G+ L    + I+E   DYT      NP    C               C C  +F++   F G V  YY+L+NFYQN + Y +S+DD QL G     +   + C PY   S     APCGAI NS+FND+F L++    S+  + VP     I+W TD +  +  P         +F  T  P NW     E S   +N+   +++ +VWM+ AA PTFRKL+ R+ Q N ++ GL +G Y + I Y++PV  F G K   ++   W+  K+P
Sbjct:   10 AHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGIKELEYDYT-----GNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYLYYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGN-YSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNP 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Match: Tmem30c (transmembrane protein 30C [Source:MGI Symbol;Acc:MGI:1918277])

HSP 1 Score: 146.362 bits (368), Expect = 1.453e-38
Identity = 97/283 (34.28%), Postives = 144/283 (50.88%), Query Frame = 3
Query: 1455 DKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYY-ISSNSTIAVPWTSVNISWETDRNELYGKP------SSFNNTVKPINWKYSA----LERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYS 2270
            D S  P++    Q  L    + L A  +  +  + G   + IGI L     + ++  I+YT   +       C  +  N++  D   +C C   F +    +GDV  YYKL  FYQN   Y LS+ + QL GK      +C P+ ++  +    PCGAI NSIFNDT  L Y ++S++ I VP     ++W TD+   +  P      S+F  + KP++W        L+   N+   +E+ IVWM+ AAFPTF+KL+RRL + + F EGL  GNY L I+YS
Sbjct:    8 DLSRLPENTALKQQTLPTQQLNLSASVVLSIFFITGGFCLSIGIILLLSAKSTKKIEINYTKTCA------NCAQLRENSSNFDK--ACNCSLPFYLPEKMEGDVYMYYKLYGFYQNLYQYILSRSNSQLVGKDIWDTTNCDPFQVSHNDTPIIPCGAIANSIFNDTITLSYNLNSSTQIEVPMLKSGLTWWTDKYVKFRNPRSSNFTSTFAGSSKPLHWAKPIYELDLDDPGNNGFLNEDFIVWMRTAAFPTFKKLYRRLKRVHAFAEGLPAGNYSLSISYS 282          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q8VEK0|CC50A_MOUSE (Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.823e-47
Identity = 113/313 (36.10%), Postives = 168/313 (53.67%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST---IAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ RP +  F Q +L      L A  + P   ++G++FI IGI +    + I+E  IDYT       P   C     N  ++ N  SC C  NF++  +F+G+V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +LY +++ S    I +P     I+W TD+N  +  P         F +T+KP+NW  +  E      SN+   +E+ IVWM+ AA PTFRKL+R + + +  +  L  G Y L I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   24 KTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGT----EPSSPC-----NKCLSPNVTSCACTINFTLKQSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRN-EDRPIAPCGAIANSMFNDTLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKAVYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYNYPVHSFDGRKRMILSTISWMGGKNP 326          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q17QL5|CC50A_BOVIN (Cell cycle control protein 50A OS=Bos taurus OX=9913 GN=TMEM30A PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.770e-45
Identity = 110/310 (35.48%), Postives = 163/310 (52.58%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIA-VPWTSVNISWETDRNELYGKP-------SSFNNTVKPINWK---YSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ RP +  F Q +L      L A  + P   ++G++FI IGI +    + I+E  IDYT      +P   C     N  ++ N   C C  NF++  +F+G+V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +L+ + + S +  +P     I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + N  +  L  G Y L I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   24 KTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGT----DPSSPC-----NKCLSPNVTPCVCTINFTLEQSFEGNVFMYYGLSNFYQNHRRYVKSRDDGQLNGDPSALLNPSKECEPYRRN-EDKPIAPCGAIANSMFNDTLELFQVGNASDLTPIPLKKKGIAWWTDKNVKFRNPPGTDPLEERFKGTTKPVNWVKPVYMLDSDEDNNGFINEDFIVWMRTAALPTFRKLYRLIERKNDLHPTLPAGRYYLNITYNYPVHSFDGRKRMILSTISWMGGKNP 323          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|H2L0H3|CHAT1_CAEEL (CDC50 family protein chat-1 OS=Caenorhabditis elegans OX=6239 GN=chat-1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.123e-44
Identity = 104/305 (34.10%), Postives = 151/305 (49.51%), Query Frame = 3
Query: 1464 NRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMN-SQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIA-VPWTSVNISWETDRNELYGKP--------SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQ-TNP-FNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            NRPK     Q +L      L A  + P + V+G +F+ IG++L    D + E  ++YT C S                         C    ++ + F GDV  YY L N+YQN++ Y  S++D Q  G     KD C P+ ++ +  +  APCGAI NSIFNDTF L + +    +  VP T+  + W  D++  +  P         +FNNT KP NW  +  E       E+ + IVWM+ AA P F+KL R + + TNP F+ GL QG Y+L +  ++PV  F G K F I+T  W   K+
Sbjct:   29 NRPKASALRQQKLPAWQPILTATTVIPTVFVIGAIFLPIGVFLFIASDAVSEFTVEYTNCLSP------------------------CQLQINLPNAFDGDVFLYYNLENYYQNHRRYVKSRNDQQYLGDLTNVKD-CAPFDIDPATKKPIAPCGAIANSIFNDTFTLAHRADTGIVTMVPVTTQGVIWNVDKDRKFKNPPLNDGNLCDAFNNTTKPPNWSKNPCEVGG---FENVDFIVWMRTAALPYFKKLWRIVDRTTNPLFSNGLPQGTYILTVENNYPVQSFGGKKEFVISTTSWAGGKN 305          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q2T9P5|CC50C_BOVIN (Cell cycle control protein 50C OS=Bos taurus OX=9913 GN=TMEM30C PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 2.854e-44
Identity = 105/309 (33.98%), Postives = 150/309 (48.54%), Query Frame = 3
Query: 1434 VNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYY-ISSNSTIAVPWTSVNISWETDRNELYGKP------SSFNNTVKPINWKYSALERSSNSYKE----DEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHW 2327
            + +  ++ +S  P +    Q QL    + L A  I      +G+  + +GI L     +I+E  I+YT          TC  +    T  D    C C  +F +    +G+V  YYKL  FYQN   Y LS+ ++QL G       +C P+  +      APCGAI NS+FNDT  L+Y  +S++ I VP      +W TD+   +  P      S+F  T KP NW     E   N        +++ IVWM+ AAFP F+KL+RRL +   F EGL  G+Y   INY+FPVS F G K   ++T  W
Sbjct:    1 MKRKCQDYESRLPDNTAVKQQQLPAFRLQLTASEILSGFFAIGLFCLGMGIILLLSAKSIKEVEINYT------EKCATCAKLREEATNFDK--ECNCSISFYLPQKMEGNVYLYYKLYGFYQNLYRYILSRSNIQLVGADVKDVRNCAPFRTSDNGLPIAPCGAIANSMFNDTIVLWYNFNSSTHIRVPMVRTETAWWTDKYVKFQNPAFQNLSSAFAGTAKPPNWPKPVYELDENDPGNNGFINDDFIVWMRTAAFPNFKKLYRRLHRIGNFTEGLPAGSYSFIINYNFPVSRFQGQKAVVLSTLTW 301          
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Match: sp|Q5F362|CC50A_CHICK (Cell cycle control protein 50A OS=Gallus gallus OX=9031 GN=TMEM30A PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 8.795e-44
Identity = 108/309 (34.95%), Postives = 164/309 (53.07%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSS-------FNNTVKPINWK---YSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ +P +  F Q +L      L A  + P   ++G++FI IGI +    + I+E  IDYT     ++P   C +V  ++T       C C  NF++  +F+ +V  YY L+NFYQN++ Y  S+DD QL G           C+PY  N +++  APCGAI NS+FNDT +LY+I +++  A+      I+W TD+N  +  P         F  T KP+NW    Y       N+   +E+ IVWM+ AA PTFRKL+R + + +     L  G Y L I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   33 KTRKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGLIFIPIGIGIFVTSNNIREYEIDYT-GVEPSSPCNKCLNVSWDSTP-----PCTCTINFTLEHSFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDNSSLLNPSKECEPYRTN-EDKPIAPCGAIANSMFNDTLELYHIENDTRTAITLIKKGIAWWTDKNVKFRNPKGDGNLTALFQGTTKPVNWPKPVYMLDSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSNLQPTLQAGKYSLNITYNYPVHSFDGRKRMILSTISWMGGKNP 334          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A4E0R1Q3 (Transcription regulator OS=Fasciola hepatica OX=6192 GN=D915_007179 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.231e-85
Identity = 146/312 (46.79%), Postives = 195/312 (62.50%), Query Frame = 3
Query: 1446 SKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVT-----DNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-----IAVPWTSVNISWETDRNELYGKPSS--FNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            S+ +  N+PKD  FHQ +L      L A+ +FP+ LV+GI+FI IGI L      + E  I+YT+C   +    + + VL +  V        Y SC C  +FS+ S  KGDV FYY L+NFYQN++ Y +SKDDMQL G   P   +C P+  N + + YAPCGAI  S+FNDTFQL Y   NS      + VP T+  I+W TD  + +GKPS+  + NTVKP +W  +ALERS N+Y  DEELIVWM++AA PTFRKLHR L+  + F+EGL  GNY + I Y++PV+ F GTK F I+T  WL  ++P
Sbjct:    8 SQQELVNKPKDSSFHQQRLPAWRPILTARFVFPIFLVIGILFIPIGIVL-----LVFERVIEYTHCERSDANNTSSFRVLCSEEVRKPSFFSQYSSCPCQQSFSLDSDLKGDVYFYYGLSNFYQNHRRYVMSKDDMQLHGDSNPLSAACDPFRTNPEGKSYAPCGAIAMSLFNDTFQLMYNGQNSAPLSPPVNVPLTNRGIAWRTDVEQKFGKPSASIWANTVKPDSWPRTALERSPNAYSGDEELIVWMRVAALPTFRKLHRILVAQDRFSEGLPAGNYTVNIGYAYPVTQFGGTKRFIISTSSWLGGRNP 314          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A504YJI3 (Cell cycle control protein 50A OS=Fasciola gigantica OX=46835 GN=FGIG_00294 PE=3 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 6.347e-83
Identity = 142/312 (45.51%), Postives = 192/312 (61.54%), Query Frame = 3
Query: 1446 SKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVT-----DNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-----IAVPWTSVNISWETDRNELYGKP--SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            S+ +  N+PKD  FHQ +L      L A+ + P+ LV+GI+FI IGI L      + E  I+YT+C   +    + + VL +  V        Y  C C  +F++ S  KGDV FYY L+NFYQN++ Y +SKDDMQL G   P   +C P+  N + + YAPCGAI  S+FNDTFQL Y   +S      + VP TS  I+W TD  + +G+P  S + NTVKP +W  +ALERS N+Y  DEELIVWM++AA PTFRKLHR L+  + F+EGL  G+Y L I Y++PV+ F GTK F I+T  WL  ++P
Sbjct:    8 SQQELVNKPKDSSFHQQRLPAWRPILTARFVSPIFLVIGILFIPIGIVLLVTSSRVFERVIEYTHCERSDANNTSSFRVLCSEEVRKPSFFSQYSFCPCQQSFTLDSDLKGDVYFYYGLSNFYQNHRRYVMSKDDMQLHGDSNPLSAACDPFRTNPEGKSYAPCGAIAMSLFNDTFQLMYNGQSSAPLSPPVNVPLTSSGIAWRTDVEQKFGRPPASIWANTVKPDSWPRTALERSPNAYSGDEELIVWMRVAALPTFRKLHRILVAHDRFSEGLPAGDYTLNIGYAYPVTQFGGTKRFIISTSSWLGGRNP 319          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: A0A1I8J5W3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007709g1 PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.427e-78
Identity = 138/314 (43.95%), Postives = 190/314 (60.51%), Query Frame = 3
Query: 1431 PVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFG-KGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST--IAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQ-----TNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDPA 2348
            P    + +    +P D  FHQ +L      L AK  F +  ++GIVF+ +G +L     +++E   DYT C    N    C  ++       N+ SC C+ +  + +   G V  YY LTNFYQN++ Y  S+DD QL G K     D C PY  +   Q+YAPCGAI NS+FNDTFQL+Y   + +  +AVPWTS  I+W++DR   + + SS+NNTVKP+NW  SA ER++++Y+ DEELIVWM+ AA P+FRKLH R+IQ     TN F +GL  GNY L +NY++PVS F GTK F +TT  WL  ++PA
Sbjct:   19 PKEAEADSGAVRKPNDSRFHQQRLPAWQPLLTAKPAFCLFFIIGIVFVPLGAFLLTTSQSVEEIKTDYTNC---KNGSSFCLALVSTPEYYANFQSCQCMVDIKLPNNLTGQVYAYYALTNFYQNHRRYVKSRDDGQLQGTKMDNLLDDCNPYRQSPSGQWYAPCGAIANSLFNDTFQLFYNRPDGSGRVAVPWTSTGIAWDSDRARKFARISSWNNTVKPVNWPKSAKERNADAYQGDEELIVWMRTAALPSFRKLH-RIIQHDSAATNLFKDGLPAGNYSLVVNYAYPVSSFAGTKSFILTTSTWLGGRNPA 328          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: C1LHI1 (Cell cycle control protein OS=Schistosoma japonicum OX=6182 GN=EWB00_005356 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 1.301e-76
Identity = 135/308 (43.83%), Postives = 187/308 (60.71%), Query Frame = 3
Query: 1443 ASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-----IAVPWTSVNISWETDRNELYGKP--SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
             +K  KSN+PKD  FHQ +L      L AK+  P+ L VG++ I +GI L    +++ E  ++YT+C       + C +++        Y  C C  +F +   FKG V FYY L+NF+QN++ Y +SKDD QL G     K SC+PY  +   + YAPCGAI  S+FND+F L Y+  +S      I VP T+  I+W TD  E +GKP   S+ NTVKP++WK SALERS  +Y EDEEL+VWM++AA PTFRKLHR +     F+ GL  GNY + I+YS+PV+ F GTK   ++T  WL  ++P
Sbjct:    5 GTKLKKSNKPKDTRFHQQRLKSWRPILTAKNASPIFLAVGLLSIPVGIVLLTFSNSVLEFVVEYTHCEDTTR-HIRCSELVRLPDFYRTYNICSCKVDFELKEDFKGQVYFYYGLSNFFQNHRRYVISKDDNQLHGSVDTPKQSCEPYRFDPNGKVYAPCGAIAMSLFNDSFTLNYLGKSSGPPAKPIKVPMTNKGIAWRTDVEEKFGKPPADSWTNTVKPVSWKRSALERSPGAYNEDEELLVWMRVAALPTFRKLHRLVNHVGTFSTGLPAGNYSVDIDYSYPVTQFGGTKRIILSTMSWLGGRNP 311          
BLAST of Cell cycle control protein 50A vs. TrEMBL
Match: G4LVJ0 (Cdc50-related OS=Schistosoma mansoni OX=6183 GN=Smp_014020.1 PE=3 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 2.101e-76
Identity = 132/307 (43.00%), Postives = 186/307 (60.59%), Query Frame = 3
Query: 1446 SKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-----IAVPWTSVNISWETDRNELYGKP--SSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            +K  K N+PKD PFHQ +L      L A++ FP+ L +G++ I +GI L    +++ E  ++YT+C         C +++        Y  C C   F +   FKG V FYY L+NF+QN++ Y +SKDD QL G     K SC+PY  +   + YAPCGAI  S+FND+F L Y+  +S      + VP T+  I+W TD  E +GKP   S+ NTVKP++WK SALERSS +Y EDEEL+VWM+++A PTFRKL+R +   N F+ GL  G Y + I YS+PV+ F GTK   ++T  WL  ++P
Sbjct:    6 TKPKKLNKPKDTPFHQQRLKSWRPILTARNAFPIFLTIGLLSIPVGIVLLTFSNSVSEVVVEYTHCEDTVR-HTRCSELVRLPEFYRTYNICSCKVEFELKEEFKGQVYFYYGLSNFFQNHRRYVISKDDYQLHGSVETPKASCEPYRFDPSGKVYAPCGAIAMSLFNDSFTLTYLGKSSEPLAKPLQVPMTNKGIAWRTDVEEKFGKPPADSWANTVKPLSWKKSALERSSGAYSEDEELLVWMRVSALPTFRKLYRLITHVNAFSNGLPAGIYSVNIEYSYPVTQFGGTKRIILSTMSWLGGRNP 311          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30ab (cell cycle control protein 50A [Source:NCBI gene;Acc:103037759])

HSP 1 Score: 188.734 bits (478), Expect = 8.392e-53
Identity = 112/316 (35.44%), Postives = 165/316 (52.22%), Query Frame = 3
Query: 1443 ASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFK---DSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNST-IAVPWTSVNISWETDRNELYGKPSS--------FNNTVKPINWKYSALERSSNSYKE---DEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            A   +   +P +  F Q +L      L A  + P   ++G++FI IGI L    + I+E  IDYT   S +     CY+   N +   +   C C   F++   F+ +V  YY L+NFYQN++ Y  S+DD QL G     K     C+PY +N +N+  APCGAI NS+FNDT +LYYI  N T   +P     I+W TD++  +  P          F  + KP+NW+    E  S+       +E+ IVWM+ AA PTFRKL+R + + N     L +GNY L + Y++PV+ F G K   ++T  W+  K+P
Sbjct:   21 AGNANSGKKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGLIFIPIGIGLFVTSNNIKEFEIDYTGTDSWS----PCYNCAQNYSWNSS-TPCRCTLPFTLEQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDLSSLKYPSKECEPYRLN-ENKPIAPCGAIANSMFNDTLELYYIDPNGTQTLIPLMKKGIAWWTDKHVKFRNPGGSNANLTAVFQVSTKPVNWRNPVYELDSDPENNGFINEDFIVWMRTAALPTFRKLYRIIQKKNNMTPTLPRGNYTLEVVYNYPVNSFEGRKRMILSTISWMGGKNP 330          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30aa (cell cycle control protein 50A-like [Source:NCBI gene;Acc:103045771])

HSP 1 Score: 186.422 bits (472), Expect = 6.509e-52
Identity = 120/314 (38.22%), Postives = 168/314 (53.50%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD---SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSN-STIAVPWTSVNISWETDRNELYGKPS--------SFNNTVKPINWKYSALERSSNSYKE----DEELIVWMKLAAFPTFRKLHRRLIQTNPFN--EGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            KS +P +  F Q +L      L A  + P   V+G++FI IGI L    + I+E  IDYT     N+P   C     + T + N +SC C   FS+   F+ +V  YY L+NFYQN++ Y  S+DD QL G      +    C+PY + S+ +  APCGAI NS+FNDT +LYYI  N S   +P     I+W TD++  +  P         +F +T KP+NW     E   N        +E+ IVWM+ AA PTFRKL+ R+IQ N  N    L +GNY L I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   28 KSKKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLFVTSNNIREFEIDYT-GVDTNSPCNRC-----SQTYSWN-ISCTCSVPFSLEQPFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDKSSLTNPSKECEPYRI-SEKKPIAPCGAIANSLFNDTLELYYIYPNGSRTLIPLVKKGIAWWTDKHVKFRNPPGNNDNLTITFQDTTKPVNWHKPVYELDPNDPDNNGFINEDFIVWMRTAALPTFRKLY-RIIQKNKDNMTPTLPRGNYSLEIAYNYPVRSFDGRKRMILSTISWMGGKNP 332          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:111191273])

HSP 1 Score: 180.259 bits (456), Expect = 5.837e-50
Identity = 106/310 (34.19%), Postives = 163/310 (52.58%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFNDTFQL-YYISSNSTIAVPWTSVNISWETDRNELYGKPS-------SFNNTVKPINWKYSALERS----SNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            + RP +  F Q +L      L    + P+  ++ +V + +G+WL   ++   E  +DYT         + C+++  +     N  SC C+ NF+I  TF GDV FYY L NF+QN + Y  S+D+ QL G+    K     C+P+  +   +  APCGAI NS+FND+F L Y+    + + VP     I+W TD+N  +  P        +F  T +P+ W+    E      SN+   +++LIVWM+ AAFP F+KL+  LI+   PF+EGL  GNY + I Y+FPV  F G K   ++T  W   ++
Sbjct:   12 ARRPDNSAFKQQRLPAWSPSLTPYTVLPVFYLLAVVCVLLGVWLFITVENTHELKVDYTE----EGTCIRCFELRKDPIQARN--SCDCVVNFNIPKTFPGDVFFYYGLVNFHQNLRRYMDSRDEDQLVGRKKSLKSPSSYCEPFAHDEHGEPIAPCGAIANSMFNDSFTLTYHPPDGAEVPVPLYRRGITWYTDKNVKFRNPPTNTTLQLAFQGTAQPLFWQQPVYELDPADPSNNGFINDDLIVWMREAAFPNFKKLYGILIRAETPFSEGLPAGNYSVNIIYNFPVQYFQGRKEVVLSTVSWFGGQN 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:111191273])

HSP 1 Score: 165.236 bits (417), Expect = 2.184e-44
Identity = 106/337 (31.45%), Postives = 163/337 (48.37%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFN---------------------------DTFQL-YYISSNSTIAVPWTSVNISWETDRNELYGKPS-------SFNNTVKPINWKYSALERS----SNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            + RP +  F Q +L      L    + P+  ++ +V + +G+WL   ++   E  +DYT         + C+++  +     N  SC C+ NF+I  TF GDV FYY L NF+QN + Y  S+D+ QL G+    K     C+P+  +   +  APCGAI NS+FN                           D+F L Y+    + + VP     I+W TD+N  +  P        +F  T +P+ W+    E      SN+   +++LIVWM+ AAFP F+KL+  LI+   PF+EGL  GNY + I Y+FPV  F G K   ++T  W   ++
Sbjct:   12 ARRPDNSAFKQQRLPAWSPSLTPYTVLPVFYLLAVVCVLLGVWLFITVENTHELKVDYTE----EGTCIRCFELRKDPIQARN--SCDCVVNFNIPKTFPGDVFFYYGLVNFHQNLRRYMDSRDEDQLVGRKKSLKSPSSYCEPFAHDEHGEPIAPCGAIANSMFNGETHLLVTYKENTLNIDLFKTLFNLCSDSFTLTYHPPDGAEVPVPLYRRGITWYTDKNVKFRNPPTNTTLQLAFQGTAQPLFWQQPVYELDPADPSNNGFINDDLIVWMREAAFPNFKKLYGILIRAETPFSEGLPAGNYSVNIIYNFPVQYFQGRKEVVLSTVSWFGGQN 342          
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 161.77 bits (408), Expect = 1.204e-43
Identity = 100/264 (37.88%), Postives = 142/264 (53.79%), Query Frame = 3
Query: 1596 AEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPS--------SFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            AE+ T    ++DYT    +N+   +C  V  +         C C   FS S  F+G V FYY L+N+YQNY+ Y +SKD  QL G    F   +D+C PY  +S  +   PCG+I NS FNDTF+LY + +     VP+    I+W TD N  Y  P+        +F+ TVKP NW   A E     ++N+   +++ +VWM+ AA P FRKL+ R I    +++GL  GNY L INY++PV  F GTK    +   W+  K+
Sbjct:   44 AELCTNNGHWLDYTGT-EMNSSCFSCSSVKPD---------CVCELTFSFSQLFEGPVFFYYGLSNYYQNYRQYGVSKDANQLSGDTTYFLSPQDTCSPYQYDSSGKPIVPCGSIANSKFNDTFKLYLMVNGVKTLVPFDGKGIAWWTDYNVKYRNPATVNGSLAKAFDGTVKPPNWPKPAYELDPSDAANNGFVNQDFLVWMRRAALPNFRKLYGR-ITGGDYSQGLPAGNYTLQINYNYPVVNFKGTKKVIFSNVSWMGGKN 296          
BLAST of Cell cycle control protein 50A vs. Ensembl Sea Lamprey
Match: tmem30b (transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GENE-040704-17])

HSP 1 Score: 190.274 bits (482), Expect = 3.924e-54
Identity = 114/310 (36.77%), Postives = 163/310 (52.58%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPF---KDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKP-------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            +S RP +  F Q +L      L A  + P   ++ ++FI +GI L    + I E  +DYT     +N    C +V   T   +++ SC C   F+++  FKG V  YY L+NFYQN++ Y  S+DD QL+G           C PY  N      APCGAI NS+FNDT  LY  ++   + VP     I+W TD+N     P       S+F  T KP+ W  S  E     S+N+   +E+ IVWM+ AA PTFRKL+RR+  T   + GL  G+Y+L ++Y+FPV  F G K   ++T  W+  K+P
Sbjct:   27 RSRRPDNTAFKQQRLPAWQPILTAGTVLPAFFIIAVIFIPLGIGLLITSNNILEHEVDYT----DSNDCAHCAEV--RTYWNNSFQSCSCSIAFNLTEHFKGPVYMYYGLSNFYQNHRRYVKSRDDNQLYGVKASLLNPSSECAPYEKNGTIP-IAPCGAIANSMFNDTLTLYMANATDNVPVPMIKTGIAWWTDKNVDGQNPEPKNNLTSAFAGTTKPLYWNKSVYELDELDSNNNGFMNEDFIVWMRTAALPTFRKLYRRVNMT---DNGLPAGSYLLKVDYNFPVKSFGGRKRMILSTTSWMGGKNP 326          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: CDC50 (Endosomal protein that interacts with phospholipid flippase Drs2p; interaction with Cdc50p is essential for Drs2p catalytic activity; mutations affect cell polarity and polarized growth; similar to Lem3p; CDC50 has a paralog, YNR048W, that arose from the whole genome duplication [Source:SGD;Acc:S000000690])

HSP 1 Score: 129.798 bits (325), Expect = 6.184e-33
Identity = 95/317 (29.97%), Postives = 148/317 (46.69%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCF-----------------CLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD----SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKED--------EELIVWMKLAAFPTFRKLHRRLIQTNPFNE--GLIQGNYVLYINYSFPVSPFNGTKGFFITT 2318
            S +P +  F Q +L      L  + + P+L+ V  +F  IGI L      +Q+  IDY++C +      T ++ +    +  ++ S                   C   F I +  K  +  YYK+TNFYQN++ Y  S D  Q+ G+ P  KD    SC P + + +++   PCG I NS+FNDTF       + T     T+ +ISW  DR+       + ++ V P NW    +++  + Y ++        EE  VWM+ AAFP F KL  +       NE   L +G Y + I  ++P+S F GTK F +TT
Sbjct:   20 SKKPPNTAFRQQRLKAWQPILSPQSVLPLLIFVACIFTPIGIGLIVSATKVQDLTIDYSHCDT--KASTTAFEDIPKKYIKYHFKSKVENKPQWRLTENENGEQSCELQFEIPNDIKKSIFIYYKITNFYQNHRRYVQSFDTKQILGE-PIKKDDLDTSCSP-IRSREDKIIYPCGLIANSMFNDTFSQVLSGIDDTEDYNLTNKHISWSIDRHRFKTTKYNASDIVPPPNW----MKKYPDGYTDENLPDIHTWEEFQVWMRTAAFPKFYKLTLK-------NESASLPKGKYQMNIELNYPISLFGGTKSFVLTT 321          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: YNR048W (Potential noncatalytic subunit for phospholipid translocase Dnf3p; YNR048W has a paralog, CDC50, that arose from the whole genome duplication [Source:SGD;Acc:S000005331])

HSP 1 Score: 127.872 bits (320), Expect = 2.902e-32
Identity = 99/315 (31.43%), Postives = 143/315 (45.40%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPK--------LTCYDVLLNTTVTDNYLSCF--------CLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGK---GPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPS-SFNNTVKPINWKYSALERSSNSYKED--------EELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITT 2318
            KS +P +  F Q +L      L  + + P+L+++  VF  IGI L     ++Q   ++YT C ++   K           Y       V   ++           C   F + +  K     YY+LTNF QNY+ Y  S D  QL GK   G     +C P L   +N+   PCG I NS+FNDTF       N T     T+  I+W+TD +  YGK   + ++ V P NW     +   N Y +D        E+  +WM+ AA P F KL  +  +TN    GL +G Y+  I  ++PV  F GTK F +TT
Sbjct:   21 KSRKPANTSFRQQRLKAWQPILSPQSVLPLLILMACVFAPIGIGLVVSTISVQRLVVNYTECDALAPAKHFETIPSEYVDYHFSKKVAVQPQWMVLTDPELGNQTCRIQFEVPNHIKKSTYVYYRLTNFNQNYREYVQSLDLDQLKGKALIGNDLDPNCDP-LRTVENKTIFPCGLIANSMFNDTFGTTLTGVNDTADYLLTTKGIAWDTDSHR-YGKTEYNASDIVPPPNWA----KLFPNGYTDDNIPDLQNWEQFKIWMRTAALPNFYKLAMK-NETN----GLGKGIYIADIELNYPVRSFYGTKSFVLTT 324          
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Match: LEM3 (Membrane protein of the plasma membrane and ER; interacts specifically in vivo with the phospholipid translocase (flippase) Dnf1p; involved in translocation of phospholipids and alkylphosphocholine drugs across the plasma membrane; null mutant requires tryptophan due to mislocalization of tryptophan permease Tat2p [Source:SGD;Acc:S000005267])

HSP 1 Score: 112.464 bits (280), Expect = 5.390e-27
Identity = 89/329 (27.05%), Postives = 142/329 (43.16%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNP---------------KLTCYDVLLNTTVTDNYLSCF------CLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD-------SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYIS-SNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKED----EELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            K+ RPK+D F Q +L  I+  L  + + P+ L++ +VF+ +G  + A+   + E  I Y  C +                   K   Y+        D+    F      C   F+  S  K +V   Y L  F  N++ Y LS  + Q+ G+   ++        +CKP   N+  + Y PCG I NS+FNDTF L   +  +++     T+  I+WE+D+        ++     P  W+    +  + +   D    EE   WM+  AF    K    LI+ N  N+ L  G Y L I   +PV  FNG KG ++T    L  ++P
Sbjct:   49 KNRRPKEDAFTQQRLAAINPVLTPRTVLPLYLLIAVVFVIVGGCILAQNSKVDEVTIYYQDCMTNATSSWSDIPSEHWQFVFHKYKTYNTAPQWRFVDDESDDFTKQRGTCQIRFTTPSDMKNNVYLNYVLEKFAANHRRYVLSFSEDQIRGEDASYETVHDATGINCKPLSKNADGKIYYPCGLIANSMFNDTFPLQLTNVGDTSNNYSLTNKGINWESDKKRYKKTKYNYTQIAPPPYWEKMYPDGYNETNIPDIQDWEEFQNWMRPGAFDKITK----LIRINK-NDTLPAGEYQLDIGLHWPVLEFNGKKGIYLTHGSHLGGRNP 372          
BLAST of Cell cycle control protein 50A vs. Ensembl Nematostella
Match: EDO47858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL17])

HSP 1 Score: 200.675 bits (509), Expect = 9.077e-58
Identity = 120/311 (38.59%), Postives = 177/311 (56.91%), Query Frame = 3
Query: 1446 SKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGK-GPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNS-TIAVPWTSVNISWETDRNELYGKPS-----SFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            S    S +P +  F Q +L      L A    P+  +VG+VF+ IG  L    D +QE  I+YT C S    +  C D      V ++   C C  +FS++S F GDV  YY ++NFYQN++ Y  S+DD+QL G+   P    C P+  N+     APCGAI NS+FND+F+ +Y  S+S  I +  T  +I+WE+DR   +  PS     +F+   KP +W+    E     SSN+   +++ IVWM+ AAF TFRKL+R+++ T+PF EGL +G+Y + INY++PV  F+G K   I+T  W+  K+P
Sbjct:    4 SAEKTSRKPSNTAFKQQRLKAWQPILTASTALPVFFIVGVVFVPIGAILLVASDGVQEKVIEYTKCNSTTTNE-GC-DAFFKK-VNNSGKVCHCKIDFSLASKFSGDVYIYYGMSNFYQNHRRYVRSRDDLQLNGQLQTPVNKDCAPFNKNASGTPTAPCGAIANSLFNDSFKFFYKKSSSDIIPLDLTYKDIAWESDREVKFKNPSGNLESAFSKYSKPRDWQKPVYELDKNDSSNNGFLNQDFIVWMRTAAFSTFRKLYRKVVATDPFKEGLPKGDYTVEINYAYPVGRFDGEKRIIISTTSWIGGKNP 311          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30b (cell cycle control protein 50A [Source:NCBI gene;Acc:101172542])

HSP 1 Score: 186.808 bits (473), Expect = 2.055e-52
Identity = 116/312 (37.18%), Postives = 169/312 (54.17%), Query Frame = 3
Query: 1446 SKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFK---DSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKP------SSFNNTVKPINWKYSALE----RSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
             + + +NRP +  F Q +L      L A  + P  L++G+ FI IG+ L     +IQ   +DYT     ++P   CY   ++     N  +C C  +FSI + FKG V FYY LTN++QN + Y +SKD  QL G    FK     C+PY      +   PCGAI NS+FNDTF+LY I +     VP+    I+W TD N  Y  P      ++FN+T KP+ W   A E     +SN+   +++ +VWM+ AA P FRKL+RR+ + N + +GL  GNY L I+Y++PV  F GTK    +   W+  ++
Sbjct:    3 EEGNYANRPSNTAFTQQRLPAWQPMLSAGVVIPGFLLIGLAFIGIGVGLLITSRSIQVLELDYTGT-ETSSP---CYQCTMS-----NQSNCVCKLSFSIGTLFKGPVFFYYGLTNYFQNQRKYGVSKDFNQLIGDVSYFKSPSSDCQPY-QRVNGKPIVPCGAIANSMFNDTFKLYQIINGKEELVPFDGKGIAWWTDYNIKYRNPDYTPLKNAFNDTEKPVFWTKPAYELDTSDASNNGFINQDFLVWMRRAALPNFRKLYRRITEGN-YKDGLPAGNYSLEISYNYPVISFEGTKKVTFSNVSWMGGQN 303          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30c (cell cycle control protein 50A-like [Source:NCBI gene;Acc:101166445])

HSP 1 Score: 186.037 bits (471), Expect = 5.655e-52
Identity = 109/322 (33.85%), Postives = 164/322 (50.93%), Query Frame = 3
Query: 1428 MPVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS---CKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGK--------PSSFNNTVKPINW-----KYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTN-PFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            M   K+     + RP +  F Q +L      L A  + P   ++ ++ + +G+WL   +   QE  +DYT   S N     C+++  N  V++    C C+  FSI   FKGDV  YY L NF+QN + Y  S+DD Q+ G+    K     CKP+ ++ +    APCGA+ NS+FND+F L Y + N    VP     ++W TD+N  Y          P  F  T +P  W     +    + ++N +  D +L+VWM+ AAFP F+KL+  L + N PF +GL  GNY + I+Y+FPV  F G K   +TT  W   ++
Sbjct:    1 MGKEKSKSGPLARRPDNSAFKQQRLPAWSPMLTASAVLPFFYLLALICMLLGVWLLLTVQNTQEMKVDYTEAGSCN----LCFEMRKN--VSNAGQRCTCMIMFSIEKAFKGDVFIYYGLRNFHQNLRRYMDSRDDGQMLGRKSNLKSPSSYCKPFDVDEKGVPIAPCGAVANSMFNDSFILTYYTINGPTVVPLLRKGLTWYTDKNVKYRNPKMDNLTLPEVFEGTTRPPYWQKPVYQLDPFDPNNNGFIND-DLLVWMREAAFPNFKKLYGFLYRANKPFTKGLPAGNYSVTISYNFPVQYFKGRKEVVLTTVSWFGGQN 315          
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Match: tmem30aa (transmembrane protein 30A [Source:NCBI gene;Acc:101158900])

HSP 1 Score: 185.652 bits (470), Expect = 1.270e-51
Identity = 117/312 (37.50%), Postives = 166/312 (53.21%), Query Frame = 3
Query: 1458 KSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKD---SCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIA-VPWTSVNISWETDRNELYGKPS-------SFNNTVKPINWKYSAL----ERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNE-GLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDP 2345
            KS +P +  F Q +L      L A  + P   V+G++FI IGI L    + I+E  IDYT    I++P   C       + T    SC C  NF++   F+ +V  YY L+NFYQN++ Y  S+DD QL G     K     C+PY   S     APCGAI NS+FNDT +L++I+ N T   V  T   I+W TD++  +  P        +F  T KP+NW+ +      E   N+   +E+ IVWM+ AA PTFRKL+ R+IQ  P +   L  G YV+ I Y++PV  F+G K   ++T  W+  K+P
Sbjct:   28 KSKKPDNTAFKQQRLPAWQPILTAGTVLPAFFVIGLIFIPIGIGLFVTSNNIKEFEIDYT-GVEIDSPCYICAKNFSWNSTT----SCVCSVNFTLDQPFESNVYMYYGLSNFYQNHRRYVKSRDDSQLNGVESNLKQPSKECEPY-RTSDGLPIAPCGAIANSLFNDTLELFHINQNGTKQRVNVTKKGIAWWTDKHVKFRNPGGSSNLSVAFQGTAKPVNWRKAVYDLDPEDPENNGFINEDFIVWMRTAALPTFRKLY-RIIQKKPNSTPTLSSGRYVMEITYNYPVLSFDGRKRMILSTISWMGGKNP 332          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000023183.1 (SMESG000023183.1)

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 392/392 (100.00%), Postives = 392/392 (100.00%), Query Frame = 2
Query:   59 MNQLINKLDDNEVDFTSKAWKLKEVPLKKQIYKLKKNLVKLHKESILRDNQINEILQCPXXXXXXXXXXXXXXYHKNVCQAELIVSYVRATTAQNDLVIQKLETETQMHSVKSLTKDKNVLQEINAKQKVAIEMLKEEIIDFRKSRDHYENSIQIHQQTISDLKKGIENLKDHIEIQDFKHSNINYDLEKAEETSIKSKGELENIVASVSDGEGLVDVDSAIQKIKFILNENKAMKTHIQFFEKQINSFKCEQELSRETINRLAKEVEIERLKRIDCIGKISELTEKLLVNSENETLVNKHITCLGNQLSEMREFLANSMQENLDKSILISQLENQNKVLVPFSDFIESLDSFIITAEDIISNDQKVNTDEAMFLIQCVKKLNAILKPSNSD 1234
            MNQLINKLDDNEVDFTSKAWKLKEVPLKKQIYKLKKNLVKLHKESILRDNQINEILQCPTKENSEMKEETNEEYHKNVCQAELIVSYVRATTAQNDLVIQKLETETQMHSVKSLTKDKNVLQEINAKQKVAIEMLKEEIIDFRKSRDHYENSIQIHQQTISDLKKGIENLKDHIEIQDFKHSNINYDLEKAEETSIKSKGELENIVASVSDGEGLVDVDSAIQKIKFILNENKAMKTHIQFFEKQINSFKCEQELSRETINRLAKEVEIERLKRIDCIGKISELTEKLLVNSENETLVNKHITCLGNQLSEMREFLANSMQENLDKSILISQLENQNKVLVPFSDFIESLDSFIITAEDIISNDQKVNTDEAMFLIQCVKKLNAILKPSNSD
Sbjct:    1 MNQLINKLDDNEVDFTSKAWKLKEVPLKKQIYKLKKNLVKLHKESILRDNQINEILQCPTKENSEMKEETNEEYHKNVCQAELIVSYVRATTAQNDLVIQKLETETQMHSVKSLTKDKNVLQEINAKQKVAIEMLKEEIIDFRKSRDHYENSIQIHQQTISDLKKGIENLKDHIEIQDFKHSNINYDLEKAEETSIKSKGELENIVASVSDGEGLVDVDSAIQKIKFILNENKAMKTHIQFFEKQINSFKCEQELSRETINRLAKEVEIERLKRIDCIGKISELTEKLLVNSENETLVNKHITCLGNQLSEMREFLANSMQENLDKSILISQLENQNKVLVPFSDFIESLDSFIITAEDIISNDQKVNTDEAMFLIQCVKKLNAILKPSNSD 392          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000023184.1 (SMESG000023184.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 336/336 (100.00%), Postives = 336/336 (100.00%), Query Frame = 3
Query: 1428 MPVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDPAXXXXXXXXXXXXXXXXXXXXXXSQIKTKI 2435
            MPVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDPAIFILFILCGIIHIIGFAILLTISQIKTKI
Sbjct:    1 MPVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSCKPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKDPAIFILFILCGIIHIIGFAILLTISQIKTKI 336          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000035028.1 (SMESG000035028.1)

HSP 1 Score: 247.284 bits (630), Expect = 1.176e-74
Identity = 136/298 (45.64%), Postives = 184/298 (61.74%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS-CKPY-LMNSQNQY-YAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQT-NPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            S RP    FHQ +L G    +  K+++     +GI+F+ +G  L      I E  IDYT C  +N+    C DVLL    T  Y SC C  N +I +  K  V  YY LTNF+QN++ Y  S+DD QL G   P  +S C+PY   NS N   YAPCG I NS+FNDTFQL Y+ +++ I VPWTS  I+W ++ N  YGKP+S+ NT+KP NW  SAL+RS ++Y  DE+L+VWM+ AA P F+K+HR+ I   +PF  G+ +G YVL INYS+PV+PF G K F ++T + L  K+
Sbjct:   10 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC--LNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKN 305          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000035028.1 (SMESG000035028.1)

HSP 1 Score: 246.899 bits (629), Expect = 3.735e-74
Identity = 136/298 (45.64%), Postives = 184/298 (61.74%), Query Frame = 3
Query: 1461 SNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDS-CKPY-LMNSQNQY-YAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQT-NPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            S RP    FHQ +L G    +  K+++     +GI+F+ +G  L      I E  IDYT C  +N+    C DVLL    T  Y SC C  N +I +  K  V  YY LTNF+QN++ Y  S+DD QL G   P  +S C+PY   NS N   YAPCG I NS+FNDTFQL Y+ +++ I VPWTS  I+W ++ N  YGKP+S+ NT+KP NW  SAL+RS ++Y  DE+L+VWM+ AA P F+K+HR+ I   +PF  G+ +G YVL INYS+PV+PF G K F ++T + L  K+
Sbjct:   10 SKRPNASAFHQQKLKGWKPIIATKNMYLPFFAIGIIFMVVGSVLTYYSYQIIEVNIDYTNC--LNSDGQQCSDVLLKNNYTYRYQSCQCKINMTIPTDIKSPVFSYYGLTNFFQNHRRYVKSRDDKQLKGLYVPLLNSNCQPYQYTNSSNSIGYAPCGIIANSLFNDTFQLDYLQNDTLITVPWTSTGIAWPSETNVRYGKPTSWANTMKPPNWPISALDRSPDAYSGDEDLLVWMRTAALPNFKKMHRKFIHNFDPFLNGIPRGFYVLSINYSYPVTPFQGVKTFSLSTTNILGGKN 305          
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Match: SMESG000061468.1 (SMESG000061468.1)

HSP 1 Score: 236.498 bits (602), Expect = 1.274e-70
Identity = 134/298 (44.97%), Postives = 173/298 (58.05%), Query Frame = 3
Query: 1473 KDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFICIGIWLKAEIDTIQESFIDYTYCYSI----NNPKLTCYDVLLNTTVTDNYLSCFCLANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKG-PPFKDSCKPYLMNSQN---QYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWETDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFPTFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHWLDSKD 2342
            KD  FHQ  L   +  +    I+P+    GIVFI IGI L     ++ E   DYT+C       NN        +LN+  T+NY SC C   F +   F G V FYY L NF+QN++ Y  SKDD QL GK      D CKP+   S     Q YAPCG I NS+FNDTFQL +I+S ++I V      I+W+ D + LYG P+ + NT+KP NWKYSA ERS++SYK DE+L+VWM+ A   TF+KL   +   +PF  GL  GNY L INY++PVS F GTK  F+TT   +  K+
Sbjct:   13 KDSNFHQQNLPSWNPVILISTIYPLFGSFGIVFILIGIGLLLSSISVNEFQYDYTHCKEYDKLNNNYSNRICSGILNSNYTNNYQSCLCNIKFRLDKQFSGQVYFYYSLQNFFQNHRRYFSSKDDKQLMGKSIQSASDYCKPFDKLSNGSFLQNYAPCGLIANSLFNDTFQLSFINSTNSIPVSMKKKGIAWKVDVDLLYGTPTDWANTLKPTNWKYSAEERSNSSYKGDEDLLVWMRTAPLSTFKKLSGIIKHESPFQNGLPAGNYELLINYAYPVSIFGGTKMVFLTTTSAMGGKN 310          
The following BLAST results are available for this feature:
BLAST of Cell cycle control protein 50A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM30B1.734e-4332.48transmembrane protein 30B [Source:HGNC Symbol;Acc:... [more]
TMEM30A3.641e-4335.16transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30A7.711e-3537.44transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30A1.097e-3437.56transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
TMEM30A1.097e-3437.56transmembrane protein 30A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chat-18.831e-4634.10CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
chat-18.831e-4634.10CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
F20C5.41.628e-4232.39pep chromosome:WBcel235:IV:8764867:8767450:1 gene:... [more]
chat-11.133e-1637.30CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
chat-11.133e-1637.30CDC50 family protein chat-1 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CDC501.285e-5138.17gene:FBgn0030752 transcript:FBtr0343350[more]
CDC501.339e-5138.80gene:FBgn0030752 transcript:FBtr0074301[more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem30ab9.488e-5436.01transmembrane protein 30Ab [Source:ZFIN;Acc:ZDB-GE... [more]
tmem30c2.139e-5234.94transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem30c1.256e-5134.62transmembrane protein 30C [Source:ZFIN;Acc:ZDB-GEN... [more]
cmss11.256e-5134.62cms1 ribosomal small subunit homolog [Source:NCBI ... [more]
tmem30b1.294e-5135.46transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arhgap408.179e-5537.62Rho GTPase activating protein 40 [Source:Xenbase;A... [more]
btf3l44.257e-5035.96basic transcription factor 3-like 4 [Source:Xenbas... [more]
tmem30cp5.271e-4433.87transmembrane protein 30C, pseudogene [Source:NCBI... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmem30a2.606e-4836.10transmembrane protein 30A [Source:MGI Symbol;Acc:M... [more]
Tmem30c6.238e-4434.32transmembrane protein 30C [Source:MGI Symbol;Acc:M... [more]
Tmem30c6.238e-4434.32transmembrane protein 30C [Source:MGI Symbol;Acc:M... [more]
Tmem30b8.711e-4432.69transmembrane protein 30B [Source:MGI Symbol;Acc:M... [more]
Tmem30c1.453e-3834.28transmembrane protein 30C [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Cell cycle control protein 50A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VEK0|CC50A_MOUSE1.823e-4736.10Cell cycle control protein 50A OS=Mus musculus OX=... [more]
sp|Q17QL5|CC50A_BOVIN4.770e-4535.48Cell cycle control protein 50A OS=Bos taurus OX=99... [more]
sp|H2L0H3|CHAT1_CAEEL1.123e-4434.10CDC50 family protein chat-1 OS=Caenorhabditis eleg... [more]
sp|Q2T9P5|CC50C_BOVIN2.854e-4433.98Cell cycle control protein 50C OS=Bos taurus OX=99... [more]
sp|Q5F362|CC50A_CHICK8.795e-4434.95Cell cycle control protein 50A OS=Gallus gallus OX... [more]
back to top
BLAST of Cell cycle control protein 50A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R1Q33.231e-8546.79Transcription regulator OS=Fasciola hepatica OX=61... [more]
A0A504YJI36.347e-8345.51Cell cycle control protein 50A OS=Fasciola giganti... [more]
A0A1I8J5W31.427e-7843.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
C1LHI11.301e-7643.83Cell cycle control protein OS=Schistosoma japonicu... [more]
G4LVJ02.101e-7643.00Cdc50-related OS=Schistosoma mansoni OX=6183 GN=Sm... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem30ab8.392e-5335.44cell cycle control protein 50A [Source:NCBI gene;A... [more]
tmem30aa6.509e-5238.22cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30c5.837e-5034.19cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30c2.184e-4431.45cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30b1.204e-4337.88transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem30b3.924e-5436.77transmembrane protein 30B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CDC506.184e-3329.97Endosomal protein that interacts with phospholipid... [more]
YNR048W2.902e-3231.43Potential noncatalytic subunit for phospholipid tr... [more]
LEM35.390e-2727.05Membrane protein of the plasma membrane and ER; in... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO478589.077e-5838.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem30b2.055e-5237.18cell cycle control protein 50A [Source:NCBI gene;A... [more]
tmem30c5.655e-5233.85cell cycle control protein 50A-like [Source:NCBI g... [more]
tmem30aa1.270e-5137.50transmembrane protein 30A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cell cycle control protein 50A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023183.10.000e+0100.00SMESG000023183.1[more]
SMESG000023184.10.000e+0100.00SMESG000023184.1[more]
SMESG000035028.11.176e-7445.64SMESG000035028.1[more]
SMESG000035028.13.735e-7445.64SMESG000035028.1[more]
SMESG000061468.11.274e-7044.97SMESG000061468.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034222 ID=SMED30034222|Name=Cell cycle control protein 50A|organism=Schmidtea mediterranea sexual|type=transcript|length=2437bp
TTTGTTTCTAATATAATATAATCTAAAATTAGTAATAGTTATTTCAATTC
CAATAGAAATGAATCAATTAATTAACAAATTAGACGACAATGAAGTAGAT
TTTACATCGAAAGCGTGGAAGTTGAAAGAAGTACCACTTAAAAAACAAAT
ATATAAATTGAAAAAGAATTTGGTAAAACTGCATAAAGAGTCAATTCTTC
GCGACAATCAAATAAATGAAATTTTACAATGTCCAACAAAGGAAAACTCT
GAGATGAAGGAAGAAACAAATGAAGAATACCATAAAAATGTTTGCCAAGC
TGAATTAATTGTTTCTTATGTTAGAGCTACAACCGCTCAAAATGATCTTG
TCATTCAAAAATTGGAAACTGAAACCCAGATGCATTCAGTTAAATCTCTA
ACAAAAGATAAAAACGTTTTACAGGAAATAAATGCCAAACAAAAAGTTGC
GATTGAGATGTTAAAAGAAGAAATTATAGACTTCCGAAAATCTCGTGATC
ACTATGAAAATTCCATACAAATTCACCAGCAAACAATTTCTGATTTGAAA
AAAGGAATTGAAAATCTAAAAGACCATATAGAAATCCAAGATTTTAAACA
TTCGAACATCAATTATGATCTTGAGAAAGCCGAAGAAACCAGTATAAAGT
CAAAAGGTGAATTAGAGAACATAGTGGCAAGCGTATCTGATGGGGAAGGC
CTAGTTGACGTAGATTCTGCAATTCAAAAAATAAAATTCATTCTAAATGA
AAATAAAGCCATGAAAACCCACATACAATTTTTTGAAAAACAAATAAACT
CTTTCAAATGTGAACAAGAATTGAGCCGAGAGACCATTAATAGGTTGGCA
AAAGAAGTCGAGATTGAAAGATTAAAAAGAATTGATTGCATTGGAAAAAT
AAGTGAATTAACTGAGAAATTACTTGTGAATTCTGAAAATGAAACCCTTG
TAAATAAGCATATAACTTGTTTGGGTAATCAACTGTCTGAAATGCGTGAA
TTTCTCGCCAATTCTATGCAAGAAAATTTAGACAAATCCATTCTCATTTC
ACAATTGGAAAACCAAAATAAAGTCCTAGTGCCGTTCTCAGATTTCATTG
AAAGTCTAGATTCATTCATAATAACAGCGGAAGACATCATATCCAACGAT
CAAAAAGTCAACACTGATGAAGCGATGTTTCTTATTCAATGCGTCAAAAA
ATTGAATGCTATTTTAAAGCCCTCAAATTCCGATTAATTTATGTATCTGA
GTGGAGAATTTTTACAAAAATAAAAATTTTCACAAAATCTCTTTGTCAAC
TTTTCATTTTTTCATTGATTATTCATTCTTTTAATGTATCATTTGATAGT
TACAAATAAATAGCAATTATTAAATGAAAGAGTTTAATATTCATTTTATA
AATATTTATTTATCACAACTGTAATTAATGCCTGTCAATAAAGCTTCGAA
GAATGACAAATCCAATCGACCGAAAGATGATCCGTTTCATCAGCATCAGC
TATGCGGAATACACGTTTTCCTCGATGCGAAACACATTTTCCCAATGCTC
TTAGTCGTTGGGATTGTGTTTATCTGTATTGGGATTTGGTTGAAAGCAGA
AATCGACACGATTCAAGAGAGTTTCATCGATTATACTTATTGTTATTCGA
TAAATAATCCAAAATTGACGTGCTACGATGTTTTGTTGAATACAACTGTG
ACCGATAATTATCTCTCATGCTTTTGTTTGGCTAACTTTTCCATCTCATC
GACATTTAAGGGAGATGTTAATTTTTATTACAAACTCACGAATTTCTATC
AGAATTACAAAACATATGCCTTATCTAAAGATGACATGCAGCTATTTGGC
AAAGGTCCTCCATTTAAGGATTCTTGTAAGCCTTACTTGATGAACTCTCA
AAACCAATATTATGCACCTTGTGGGGCCATTCCTAATAGCATATTTAATG
ATACTTTTCAACTCTATTACATTTCCTCAAATTCTACAATTGCTGTGCCT
TGGACTAGTGTAAATATATCCTGGGAAACTGATAGAAACGAATTATATGG
GAAACCGAGTTCTTTCAACAACACTGTGAAACCAATTAATTGGAAATATT
CTGCTTTGGAACGAAGTTCTAATTCTTATAAAGAAGACGAAGAATTAATC
GTTTGGATGAAATTGGCAGCTTTTCCCACATTCAGAAAACTTCACCGGAG
ATTAATTCAGACAAATCCATTTAATGAAGGTCTCATCCAAGGAAATTATG
TTTTATATATTAATTATTCTTTTCCTGTATCTCCATTTAATGGGACGAAA
GGATTTTTTATAACTACCCCTCACTGGCTCGATAGCAAAGATCCAGCCAT
TTTTATATTATTTATTCTCTGTGGAATCATTCACATCATTGGATTTGCAA
TTCTACTAACCATTTCTCAGATTAAAACTAAAATCCG
back to top

protein sequence of SMED30034222-orf-1

>SMED30034222-orf-1 ID=SMED30034222-orf-1|Name=SMED30034222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MNQLINKLDDNEVDFTSKAWKLKEVPLKKQIYKLKKNLVKLHKESILRDN
QINEILQCPTKENSEMKEETNEEYHKNVCQAELIVSYVRATTAQNDLVIQ
KLETETQMHSVKSLTKDKNVLQEINAKQKVAIEMLKEEIIDFRKSRDHYE
NSIQIHQQTISDLKKGIENLKDHIEIQDFKHSNINYDLEKAEETSIKSKG
ELENIVASVSDGEGLVDVDSAIQKIKFILNENKAMKTHIQFFEKQINSFK
CEQELSRETINRLAKEVEIERLKRIDCIGKISELTEKLLVNSENETLVNK
HITCLGNQLSEMREFLANSMQENLDKSILISQLENQNKVLVPFSDFIESL
DSFIITAEDIISNDQKVNTDEAMFLIQCVKKLNAILKPSNSD*
back to top

protein sequence of SMED30034222-orf-2

>SMED30034222-orf-2 ID=SMED30034222-orf-2|Name=SMED30034222-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=336bp
MPVNKASKNDKSNRPKDDPFHQHQLCGIHVFLDAKHIFPMLLVVGIVFIC
IGIWLKAEIDTIQESFIDYTYCYSINNPKLTCYDVLLNTTVTDNYLSCFC
LANFSISSTFKGDVNFYYKLTNFYQNYKTYALSKDDMQLFGKGPPFKDSC
KPYLMNSQNQYYAPCGAIPNSIFNDTFQLYYISSNSTIAVPWTSVNISWE
TDRNELYGKPSSFNNTVKPINWKYSALERSSNSYKEDEELIVWMKLAAFP
TFRKLHRRLIQTNPFNEGLIQGNYVLYINYSFPVSPFNGTKGFFITTPHW
LDSKDPAIFILFILCGIIHIIGFAILLTISQIKTKI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005045CDC50/LEM3_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 118..173