PPM-type phosphatase domain-containing protein

Overview
NamePPM-type phosphatase domain-containing protein
Smed IDSMED30034219
Length (bp)1537
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PPM-type phosphatase domain-containing protein (SMED30034219) t-SNE clustered cells

Violin plots show distribution of expression levels for PPM-type phosphatase domain-containing protein (SMED30034219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PPM-type phosphatase domain-containing protein (SMED30034219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PPM-type phosphatase domain-containing protein (SMED30034219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30034219SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034219SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000032921.1 SMESG000032910.1 Contig29374uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000032921.1 SMESG000032910.1 Contig29374newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000032910.1 SMESG000032921.1 Contig2861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000032910.1 SMESG000032921.1 Contig2861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000065325.1 Contig2861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034219SMESG000065325.1 Contig2861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30034219SMESG000032910.1 SMESG000032921.1 dd_Smed_v6_286_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034219SMESG000032910.1 SMESG000032921.1 dd_Smed_v4_286_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30034219SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30034219SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30034219SMESG000032910.1 SMESG000032921.1 SMED30034219smed_20140614PMID:27441386
Arnold et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 442.195 bits (1136), Expect = 1.079e-152
Identity = 212/372 (56.99%), Postives = 277/372 (74.46%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K+ ELDK L+  V++ + K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 370          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 441.81 bits (1135), Expect = 1.783e-151
Identity = 212/372 (56.99%), Postives = 277/372 (74.46%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K+ ELDK L+  V++ + K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:   74 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 443          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 435.261 bits (1118), Expect = 5.141e-150
Identity = 211/372 (56.72%), Postives = 276/372 (74.19%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+        +  SV+ +++GIR GFL +DE +R   +     D+SGSTAV V++SPKHI+F NCGDSRA+L R+G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE ++LACDGIWDVM+N+++C++++ R+  SDDL  +CN  +DTCL+KGSRDNMSIVLV F NAPK+ +    KD ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KR++IE +Y+ L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN 371          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Match: AC013717.1 (novel protein, PPM1B-SLC3A1 readthrough)

HSP 1 Score: 435.261 bits (1118), Expect = 7.536e-150
Identity = 211/372 (56.72%), Postives = 276/372 (74.19%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAP---SVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+      +    SV+ +++GIR GFL +DE +R   +     D+SGSTAV V++SPKHI+F NCGDSRA+L R+G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE ++LACDGIWDVM+N+++C++++ R+  SDDL  +CN  +DTCL+KGSRDNMSIVLV F NAPK+ +    KD ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KR++IE +Y+ L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN 371          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Match: PPM1B (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:HGNC Symbol;Acc:HGNC:9276])

HSP 1 Score: 434.876 bits (1117), Expect = 8.246e-150
Identity = 211/372 (56.72%), Postives = 276/372 (74.19%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+        +  SV+ +++GIR GFL +DE +R   +     D+SGSTAV V++SPKHI+F NCGDSRA+L R+G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE ++LACDGIWDVM+N+++C++++ R+  SDDL  +CN  +DTCL+KGSRDNMSIVLV F NAPK+ +    KD ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KR++IE +Y+ L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILR-AEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN 371          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 306.99 bits (785), Expect = 4.102e-100
Identity = 171/394 (43.40%), Postives = 254/394 (64.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCA--ITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQE------------IRDGIREGFLTLDERIRKMIEGELSDD--KSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPT-EQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKL-------DESYASKDKE-LDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNE-LSKRD 1143
            MGAFLDKPKTDK N  G GNG+R+G++SMQGWRI MED+H A  I   S     WSFFAVFDGHAG  ++   ++QLL++++ +EEF+    EM  +++E            +  GI++GFL+ DE I K      S+D  KSG TAVC +V+P H    N GDSRA++    ++ F T DHKP    E++RI+ AGGSVMIQR+NGSLAVSRA GD+EYK+ D + P  +QLVSPEP+V + +R+  ND+ +V+ACDGI+DVMTN+++ +F++ R+    DL ++C++ +D CL KGSRDNM++V+V F  AP++       +E++ S+ K  +++ L E V     K E+ D++ + + ++ +      P  +    H +  +  + L++RD
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFR----EMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKT-----SNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEVNIHRKEAEEAWVSRVKTVINQFLDEAVAAEDFKQEE-DMVTLKSILDKVTANGLLPTDLRVPEHTVTTLAQKILTQRD 381          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 306.99 bits (785), Expect = 4.102e-100
Identity = 171/394 (43.40%), Postives = 254/394 (64.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCA--ITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQE------------IRDGIREGFLTLDERIRKMIEGELSDD--KSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPT-EQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKL-------DESYASKDKE-LDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNE-LSKRD 1143
            MGAFLDKPKTDK N  G GNG+R+G++SMQGWRI MED+H A  I   S     WSFFAVFDGHAG  ++   ++QLL++++ +EEF+    EM  +++E            +  GI++GFL+ DE I K      S+D  KSG TAVC +V+P H    N GDSRA++    ++ F T DHKP    E++RI+ AGGSVMIQR+NGSLAVSRA GD+EYK+ D + P  +QLVSPEP+V + +R+  ND+ +V+ACDGI+DVMTN+++ +F++ R+    DL ++C++ +D CL KGSRDNM++V+V F  AP++       +E++ S+ K  +++ L E V     K E+ D++ + + ++ +      P  +    H +  +  + L++RD
Sbjct:    1 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFR----EMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKT-----SNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEVNIHRKEAEEAWVSRVKTVINQFLDEAVAAEDFKQEE-DMVTLKSILDKVTANGLLPTDLRVPEHTVTTLAQKILTQRD 381          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 308.145 bits (788), Expect = 1.651e-99
Identity = 171/394 (43.40%), Postives = 254/394 (64.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCA--ITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQE------------IRDGIREGFLTLDERIRKMIEGELSDD--KSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPT-EQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKL-------DESYASKDKE-LDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNE-LSKRD 1143
            MGAFLDKPKTDK N  G GNG+R+G++SMQGWRI MED+H A  I   S     WSFFAVFDGHAG  ++   ++QLL++++ +EEF+    EM  +++E            +  GI++GFL+ DE I K      S+D  KSG TAVC +V+P H    N GDSRA++    ++ F T DHKP    E++RI+ AGGSVMIQR+NGSLAVSRA GD+EYK+ D + P  +QLVSPEP+V + +R+  ND+ +V+ACDGI+DVMTN+++ +F++ R+    DL ++C++ +D CL KGSRDNM++V+V F  AP++       +E++ S+ K  +++ L E V     K E+ D++ + + ++ +      P  +    H +  +  + L++RD
Sbjct:   84 MGAFLDKPKTDKTNVHGEGNGIRYGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFR----EMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKT-----SNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEVNIHRKEAEEAWVSRVKTVINQFLDEAVAAEDFKQEE-DMVTLKSILDKVTANGLLPTDLRVPEHTVTTLAQKILTQRD 464          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Match: ppm-1.A (Protein phosphatase ppm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19775])

HSP 1 Score: 271.552 bits (693), Expect = 1.504e-86
Identity = 153/371 (41.24%), Postives = 235/371 (63.34%), Query Frame = 1
Query:  109 FGLASMQGWRIEMEDAHCA--ITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQE------------IRDGIREGFLTLDERIRKMIEGELSDD--KSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPT-EQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKL-------DESYASKDKE-LDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNE-LSKRD 1143
            +G++SMQGWRI MED+H A  I   S     WSFFAVFDGHAG  ++   ++QLL++++ +EEF+    EM  +++E            +  GI++GFL+ DE I K      S+D  KSG TAVC +V+P H    N GDSRA++    ++ F T DHKP    E++RI+ AGGSVMIQR+NGSLAVSRA GD+EYK+ D + P  +QLVSPEP+V + +R+  ND+ +V+ACDGI+DVMTN+++ +F++ R+    DL ++C++ +D CL KGSRDNM++V+V F  AP++       +E++ S+ K  +++ L E V     K E+ D++ + + ++ +      P  +    H +  +  + L++RD
Sbjct:    6 YGMSSMQGWRICMEDSHIAEAIMSQSSPYKDWSFFAVFDGHAGHHIANRASSQLLEHLISSEEFR----EMTKTLEENNGVLTDSTLKLLEKGIKKGFLSFDE-ISKT-----SNDISKSGCTAVCAIVTPTHFIIGNLGDSRAVVAGKNEI-FGTEDHKPYLEKERKRIEGAGGSVMIQRINGSLAVSRAFGDYEYKD-DPRLPADQQLVSPEPDVYIRERNLENDQFMVVACDGIYDVMTNEELAEFVKDRLSVHSDLREVCDDVLDECLVKGSRDNMTMVVVCFPAAPEVNIHRKEAEEAWVSRVKTVINQFLDEAVAAEDFKQEE-DMVTLKSILDKVTANGLLPTDLRVPEHTVTTLAQKILTQRD 363          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 207.994 bits (528), Expect = 2.455e-62
Identity = 119/299 (39.80%), Postives = 172/299 (57.53%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAF 918
            MG  L +P T K + S        G + MQGWR++MEDAH  +  L  +    +FFAV+DGH G++VS+     L K +V  +EF         S   +++ I +GFL LD+++R  ++ E  DD SG+TAV VL+    ++  N GDSRA+    G+    + DHKP++  E  RI  AGG V   RVNG+LA+SRA+GDF +KN D K   EQ+V+  P+V + D+   + E +VLACDGIWDVMTN ++  F++ ++    D   IC E +  CL    +      DNM++VLV  
Sbjct:    1 MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDD-PKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEF---------SEGNMKEAIEKGFLELDQQMR--VDEETKDDVSGTTAVVVLIKEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDV-ITDKLTPDHEFIVLACDGIWDVMTNQEVVDFVREKLAEKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGL 286          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085442)

HSP 1 Score: 366.311 bits (939), Expect = 1.838e-123
Identity = 188/366 (51.37%), Postives = 248/366 (67.76%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDK-SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENL-KLLNFPP-CGIHSKRHLIEKIYNE 1128
            MG FLDKPKT KHN+ G GN L FG++SMQGWR EMEDA+ A   L   L  WSFFAVFDGHAG +VSE CA  LL++I+ TEEF   D            GIR GFL +DE +R++ E     +K  G+TAVC  V    ++ ANCGDSRA+L R G   FAT DHKP  P EKERI NAGGSVMI+RVNG+LAVSRA+GD+++KNV  KG  EQLVSPEPE+    R  ++DE LVLACDGIWDVM+N+D+C F+  R+R + +L+ I N+ +DTCL+KGSRDNMSI+++AF  APK  E     +  L+K +++  +D +  ++  D + ++  ++N   +   PP  G+ SK H+IE+ + +
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH---------VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSR-QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085445)

HSP 1 Score: 366.311 bits (939), Expect = 1.838e-123
Identity = 188/366 (51.37%), Postives = 248/366 (67.76%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDK-SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENL-KLLNFPP-CGIHSKRHLIEKIYNE 1128
            MG FLDKPKT KHN+ G GN L FG++SMQGWR EMEDA+ A   L   L  WSFFAVFDGHAG +VSE CA  LL++I+ TEEF   D            GIR GFL +DE +R++ E     +K  G+TAVC  V    ++ ANCGDSRA+L R G   FAT DHKP  P EKERI NAGGSVMI+RVNG+LAVSRA+GD+++KNV  KG  EQLVSPEPE+    R  ++DE LVLACDGIWDVM+N+D+C F+  R+R + +L+ I N+ +DTCL+KGSRDNMSI+++AF  APK  E     +  L+K +++  +D +  ++  D + ++  ++N   +   PP  G+ SK H+IE+ + +
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH---------VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSR-QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085446)

HSP 1 Score: 366.311 bits (939), Expect = 1.838e-123
Identity = 188/366 (51.37%), Postives = 248/366 (67.76%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDK-SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENL-KLLNFPP-CGIHSKRHLIEKIYNE 1128
            MG FLDKPKT KHN+ G GN L FG++SMQGWR EMEDA+ A   L   L  WSFFAVFDGHAG +VSE CA  LL++I+ TEEF   D            GIR GFL +DE +R++ E     +K  G+TAVC  V    ++ ANCGDSRA+L R G   FAT DHKP  P EKERI NAGGSVMI+RVNG+LAVSRA+GD+++KNV  KG  EQLVSPEPE+    R  ++DE LVLACDGIWDVM+N+D+C F+  R+R + +L+ I N+ +DTCL+KGSRDNMSI+++AF  APK  E     +  L+K +++  +D +  ++  D + ++  ++N   +   PP  G+ SK H+IE+ + +
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH---------VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSR-QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085443)

HSP 1 Score: 365.925 bits (938), Expect = 3.069e-123
Identity = 188/366 (51.37%), Postives = 248/366 (67.76%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDK-SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENL-KLLNFPP-CGIHSKRHLIEKIYNE 1128
            MG FLDKPKT KHN+ G GN L FG++SMQGWR EMEDA+ A   L   L  WSFFAVFDGHAG +VSE CA  LL++I+ TEEF   D            GIR GFL +DE +R++ E     +K  G+TAVC  V    ++ ANCGDSRA+L R G   FAT DHKP  P EKERI NAGGSVMI+RVNG+LAVSRA+GD+++KNV  KG  EQLVSPEPE+    R  ++DE LVLACDGIWDVM+N+D+C F+  R+R + +L+ I N+ +DTCL+KGSRDNMSI+++AF  APK  E     +  L+K +++  +D +  ++  D + ++  ++N   +   PP  G+ SK H+IE+ + +
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH---------VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSR-QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085444)

HSP 1 Score: 365.925 bits (938), Expect = 3.582e-123
Identity = 188/366 (51.37%), Postives = 248/366 (67.76%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDK-SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENL-KLLNFPP-CGIHSKRHLIEKIYNE 1128
            MG FLDKPKT KHN+ G GN L FG++SMQGWR EMEDA+ A   L   L  WSFFAVFDGHAG +VSE CA  LL++I+ TEEF   D            GIR GFL +DE +R++ E     +K  G+TAVC  V    ++ ANCGDSRA+L R G   FAT DHKP  P EKERI NAGGSVMI+RVNG+LAVSRA+GD+++KNV  KG  EQLVSPEPE+    R  ++DE LVLACDGIWDVM+N+D+C F+  R+R + +L+ I N+ +DTCL+KGSRDNMSI+++AF  APK  E     +  L+K +++  +D +  ++  D + ++  ++N   +   PP  G+ SK H+IE+ + +
Sbjct:    1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH---------VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSR-QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGLPPGGGLQSKYHVIERTFKQ 356          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 435.647 bits (1119), Expect = 2.484e-150
Identity = 211/378 (55.82%), Postives = 275/378 (72.75%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID----PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GN LR+GL+SMQGWR+EMEDAH A+  L  +L  WSFFAV+DGHAG++V+  C   LL++I    +F+       P + PSV  ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+HI+F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R    DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F +APK+      ++ ELDK L+  V++ L +  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+   N
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKLNPYRN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 436.032 bits (1120), Expect = 2.845e-150
Identity = 211/378 (55.82%), Postives = 275/378 (72.75%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID----PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GN LR+GL+SMQGWR+EMEDAH A+  L  +L  WSFFAV+DGHAG++V+  C   LL++I    +F+       P + PSV  ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+HI+F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R    DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F +APK+      ++ ELDK L+  V++ L +  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+   N
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKLNPYRN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 435.647 bits (1119), Expect = 2.905e-150
Identity = 211/378 (55.82%), Postives = 275/378 (72.75%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID----PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GN LR+GL+SMQGWR+EMEDAH A+  L  +L  WSFFAV+DGHAG++V+  C   LL++I    +F+       P + PSV  ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+HI+F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R    DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F +APK+      ++ ELDK L+  V++ L +  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+   N
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKLNPYRN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 435.261 bits (1118), Expect = 5.858e-150
Identity = 211/378 (55.82%), Postives = 275/378 (72.75%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID----PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GN LR+GL+SMQGWR+EMEDAH A+  L  +L  WSFFAV+DGHAG++V+  C   LL++I    +F+       P + PSV  ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+HI+F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R    DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F +APK+      ++ ELDK L+  V++ L +  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+   N
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNSLRYGLSSMQGWRVEMEDAHTAVIGLPNSLDLWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFQGGGGGGGPAVEPSVDSVKSGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHIYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVCAIERSEAEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFVSAPKVSPEAVKREAELDKYLESRVEEILKRQGDEGVPDLVHVMRTLASESIPNLPPGGELASKRSVIEAVYNKLNPYRN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Match: ppm1bb (protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-185])

HSP 1 Score: 432.565 bits (1111), Expect = 4.855e-149
Identity = 213/369 (57.72%), Postives = 275/369 (74.53%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGL FGL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG+RV+  C+  LL++I+ + E     P+   SV+ ++ GIR GFL +DE +R   +     D+SGSTAV VLVSP+H++F NCGDSRA+L R G+V F+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R ++ DE +VLACDGIWDVM+N+++C F++ R+   DDL K+CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    K+ ELDK L+  V++ + K+ +    DL  +++++    + N PP  G+ SKR +IE +YN L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLNFGLSSMQGWRVEMEDAHTAVVGLPHGLDDWSFFAVYDGHAGSRVANYCSKHLLEHIITSSEDFRSGPD---SVEGVKIGIRSGFLKIDEYMRNFSDLRNGMDRSGSTAVGVLVSPEHLYFINCGDSRAVLSRAGQVRFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFEVPRVSDEDEFVVLACDGIWDVMSNEELCDFVRSRLEVWDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPNAPKVSEEAVKKEAELDKFLEARVEELMEKSGEEGIPDLSHIMHNLHPETIPNLPPGGGLPSKRSVIEAVYNRLN 366          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 439.499 bits (1129), Expect = 1.277e-151
Identity = 210/372 (56.45%), Postives = 279/372 (75.00%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID---PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C++ LL++I + E+F+  +     + P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP H++F NCGDSRA+L R G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R  + DE ++LACDGIWDVM+N+++C+F+++R+  +DDL K+CN  +DTCL+KGSRDNMSIVLV F NAPK+ E    KD +LDK L+  V++ +    +    DL  V+  +    + + PP  G+ +KR +IE++YN L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-ADEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKRSVIEEVYNRLN 371          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Match: ppm1a (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:548912])

HSP 1 Score: 434.491 bits (1116), Expect = 1.227e-149
Identity = 209/373 (56.03%), Postives = 272/373 (72.92%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK  D  +  SV  +++GIR GFL +DE +R + E +   D+SGSTAV V+ SP HI+F NCGDSR LL R  KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F+  R+  +DDL ++CNE +DTCLYKGSRDNMS++L+ F +APK+      ++ ELDK L+  V+D + K  +    DL+ V+  + +  + N PP G + SKR +IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAHGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPNGLDAWSFFAVYDGHAGSQVAKYCCEHLLDHITSNQDFKGTDGHL--SVWSVKNGIRTGFLQIDEHMRVISEKKHGADRSGSTAVGVMTSPNHIYFINCGDSRGLLCRSKKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYEIERSEEDDQFIILACDGIWDVMGNEELCDFVWSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVILICFPSAPKVLPEAVKREAELDKYLEGRVEDIIKKQGEEGVPDLVHVMRTLASENIPNLPPGGELASKRSVIEAVYNRLNPYRN 371          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 433.721 bits (1114), Expect = 4.136e-148
Identity = 209/381 (54.86%), Postives = 277/381 (72.70%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID---PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG----------IHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C++ LL++I + E+F+  +     + P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP H++F NCGDSRA+L R G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R  + DE ++LACDGIWDVM+N+++C+F+++R+  +DDL K+CN  +DTCL+KGSRDNMSIVLV F NAPK+ E    KD +LDK L+  V++ +    +    DL  V+  +    + + PP G             +R +IE++YN L+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-ADEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGGGLAAKINLFFFLFRRSVIEEVYNRLN 380          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 429.098 bits (1102), Expect = 9.478e-148
Identity = 203/355 (57.18%), Postives = 266/355 (74.93%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID---PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG 1086
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C++ LL++I + E+F+  +     + P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP H++F NCGDSRA+L R G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R  + DE ++LACDGIWDVM+N+++C+F+++R+  +DDL K+CN  +DTCL+KGSRDNMSIVLV F NAPK+ E    KD +LDK L+  V++ +    +    DL  V+  +    + + PP G
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-ADEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGG 354          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Match: ppm1b (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:493392])

HSP 1 Score: 427.557 bits (1098), Expect = 4.713e-147
Identity = 203/355 (57.18%), Postives = 266/355 (74.93%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID---PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG 1086
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C++ LL++I + E+F+  +     + P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP H++F NCGDSRA+L R G+VCF+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R  + DE ++LACDGIWDVM+N+++C+F+++R+  +DDL K+CN  +DTCL+KGSRDNMSIVLV F NAPK+ E    KD +LDK L+  V++ +    +    DL  V+  +    + + PP G
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPRGLDDWSFFAVYDGHAGSRVANYCSSHLLEHITDNEDFRATETPGSALEPTVENVKSGIRTGFLKIDEYMRNFADLRNGMDRSGSTAVAVLLSPSHVYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-ADEDEFIILACDGIWDVMSNEELCEFVKYRLELTDDLEKVCNSVVDTCLHKGSRDNMSIVLVCFPNAPKVSEEAIKKDADLDKHLESRVEEIMTNAGEEGMPDLAHVMRILAAENVPHLPPGG 354          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 446.817 bits (1148), Expect = 1.700e-154
Identity = 217/377 (57.56%), Postives = 280/377 (74.27%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS-KRDN 1146
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+  +DN
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDN 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 446.817 bits (1148), Expect = 1.700e-154
Identity = 217/377 (57.56%), Postives = 280/377 (74.27%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS-KRDN 1146
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+  +DN
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDN 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 446.817 bits (1148), Expect = 2.081e-154
Identity = 217/377 (57.56%), Postives = 280/377 (74.27%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS-KRDN 1146
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+  +DN
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDN 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 446.817 bits (1148), Expect = 2.081e-154
Identity = 217/377 (57.56%), Postives = 280/377 (74.27%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS-KRDN 1146
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+  +DN
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLNPHKDN 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Match: Ppm1b (protein phosphatase 1B, magnesium dependent, beta isoform [Source:MGI Symbol;Acc:MGI:101841])

HSP 1 Score: 446.432 bits (1147), Expect = 2.837e-154
Identity = 219/386 (56.74%), Postives = 282/386 (73.06%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKRDNCPRKVNADGS 1176
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+     P K N  G+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLN-----PHKDNDGGA 380          
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Match: sp|P36993|PPM1B_MOUSE (Protein phosphatase 1B OS=Mus musculus OX=10090 GN=Ppm1b PE=1 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.985e-153
Identity = 219/386 (56.74%), Postives = 282/386 (73.06%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE---MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKRDNCPRKVNADGS 1176
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I   E+F+  D     + PSV+ ++ GIR GFL +DE +R   +     D+SGSTAV V+VSP H++F NCGDSRA+L R+G+VCF+T DHKP NPVEKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C+F++ R+  SDDL  +CN  +DTCL+KGSRDNMS+VLV F NAPK+ E    +D ELDK L+  V++ + K+ +    DL  V+  +    + N PP  G+  KRH+IE +Y+ L+     P K N  G+
Sbjct:    1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVR-AEEDEFVVLACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPKVSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRHVIEAVYSRLN-----PHKDNDGGA 380          
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Match: sp|O62829|PPM1A_BOVIN (Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 6.682e-153
Identity = 212/372 (56.99%), Postives = 278/372 (74.73%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K++ELDK L+  V++ + K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVYFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEEELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 370          
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Match: sp|P20650|PPM1A_RAT (Protein phosphatase 1A OS=Rattus norvegicus OX=10116 GN=Ppm1a PE=1 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 1.432e-152
Identity = 212/372 (56.99%), Postives = 277/372 (74.46%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K+ ELDK L+  V++ + K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 370          
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Match: sp|P35814|PPM1A_RABIT (Protein phosphatase 1A OS=Oryctolagus cuniculus OX=9986 GN=PPM1A PE=2 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 3.499e-152
Identity = 213/372 (57.26%), Postives = 277/372 (74.46%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K+ ELDK L+  V++ L K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEILKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 370          
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Match: sp|P35813|PPM1A_HUMAN (Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=PPM1A PE=1 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 5.179e-152
Identity = 212/372 (56.99%), Postives = 277/372 (74.46%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA--DLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN  G GNGLR+GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL +I   ++FK      APSV+ +++GIR GFL +DE +R M E +   D+SGSTAV VL+SP+H +F NCGDSR LL R+ KV F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R   +D+ ++LACDGIWDVM N+++C F++ R+  +DDL K+CNE +DTCLYKGSRDNMS++L+ F NAPK+      K+ ELDK L+  V++ + K  +   DL+ V+  + +  + + PP G + SKR++IE +YN L+   N
Sbjct:    1 MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKG--SAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKN 370          
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Match: G7YFT0 (Protein phosphatase 1B OS=Clonorchis sinensis OX=79923 GN=CLF_106827 PE=3 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 3.333e-171
Identity = 228/364 (62.64%), Postives = 293/364 (80.49%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAV-VNHIENLKLLNFPPCGIHSKRHLIEKIYNE 1128
            MGA L  PKT+K+NE+G GNGLR+G++SMQGWRI MEDAHCAITQL GNL  WSFFAVFDGHAGA VS +CA++LLK IV+TEEFK ++P++APS+ EI  GIR+GFL+LDER+R++ +    +DKSGSTAVCVL++PKHIFFANCGDSRA+LIR+G V FATVDHKP NP EKERIQNAGGSV+I+RVNGSLAVSR++GD+ YK   G GPTEQL+SPEPE+TVLDRD   D+++VLACDGIWDV+++D +C  LQHR+RCSDDL  +CNE ID CLYKGS DNMSIVLVAF+ +P+ +  Y  +D+EL++L+ +  KD+L K++    + + +NH+++      PP  ++ K   I ++  E
Sbjct:    1 MGALLSTPKTEKYNETGSGNGLRYGISSMQGWRITMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCASELLKCIVDTEEFKKVNPDLAPSIPEIERGIRDGFLSLDERLRQLPQLASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIREGSVAFATVDHKPINPTEKERIQNAGGSVIIERVNGSLAVSRSLGDYAYKTAKGLGPTEQLISPEPEITVLDRDKVMDQIIVLACDGIWDVLSSDALCSLLQHRMRCSDDLSVVCNEIIDMCLYKGSSDNMSIVLVAFDPSPRAEPKYKKEDEELEQLILQRAKDFLEKSDRMPSMEIMLNHLQDFTEPELPPFLVYCKSGKIRRLLEE 364          
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Match: A0A074ZYE6 (PPM-type phosphatase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02692 PE=3 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 4.883e-171
Identity = 228/364 (62.64%), Postives = 292/364 (80.22%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAV-VNHIENLKLLNFPPCGIHSKRHLIEKIYNE 1128
            MGA L  PKT+K+NE+G GNGLR+G++SMQGWRI MEDAHCAITQL GNL  WSFFAVFDGHAGA VS +CA++LLK IV+TEEFK ++P++APS+ EI  GIR+GFL LDER+R++ +    +DKSGSTAVCVL++PKHIFFANCGDSRA+LIR+G V FATVDHKP NP EKERIQNAGGSV+I+RVNGSLAVSR++GD+ YK   G GPTEQL+SPEPE+TVLDRD   D+++VLACDGIWDV+++D +C  LQHR+RCSDDL  +CNE ID CLYKGS DNMSIVLVAF+ +P+ +  Y  +D+EL++L+ +  KD+L K++    + + +NH+++      PP  ++ K   I ++  E
Sbjct:    1 MGALLSTPKTEKYNETGSGNGLRYGISSMQGWRITMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCASELLKCIVDTEEFKKVNPDLAPSIPEIERGIRDGFLALDERLRQLPQLASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIREGSVAFATVDHKPINPTEKERIQNAGGSVIIERVNGSLAVSRSLGDYAYKTAKGLGPTEQLISPEPEITVLDRDKVMDQIIVLACDGIWDVLSSDALCSLLQHRMRCSDDLSVVCNEIIDMCLYKGSSDNMSIVLVAFDPSPRAEAKYKKEDEELEQLILQRAKDFLEKSDRMPSMEIMLNHLQDFTEPELPPFLVYCKSGKIRRLLEE 364          
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Match: A0A4S2LH95 (PPM-type phosphatase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007605 PE=3 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 6.924e-171
Identity = 228/364 (62.64%), Postives = 292/364 (80.22%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAV-VNHIENLKLLNFPPCGIHSKRHLIEKIYNE 1128
            MGA L  PKT+K+NE+G GNGLR+G++SMQGWRI MEDAHCAITQL GNL  WSFFAVFDGHAGA VS +CA++LLK IV+TEEFK ++P++APS+ EI  GIR+GFL LDER+R++ +    +DKSGSTAVCVL++PKHIFFANCGDSRA+LIR+G V FATVDHKP NP EKERIQNAGGSV+I+RVNGSLAVSR++GD+ YK   G GPTEQL+SPEPE+TVLDRD   D+++VLACDGIWDV+++D +C  LQHR+RCSDDL  +CNE ID CLYKGS DNMSIVLVA + +P+ D  Y  +D+EL++L+ +  KD+L K++    + + +NH+++    + PP  ++ K   I ++  E
Sbjct:    1 MGALLSTPKTEKYNETGSGNGLRYGISSMQGWRITMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCASELLKCIVDTEEFKKVNPDLAPSIPEIERGIRDGFLALDERLRQLPQLASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIREGSVAFATVDHKPINPTEKERIQNAGGSVIIERVNGSLAVSRSLGDYAYKTAKGLGPTEQLISPEPEITVLDRDKVMDQIIVLACDGIWDVLSSDALCSLLQHRMRCSDDLSVVCNEIIDMCLYKGSSDNMSIVLVALDPSPRADPKYKKEDEELEQLILQRAKDFLEKSDRMPSMEIMLNHLQDFTEPDLPPFLVYCKSGKIRRLLEE 364          
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Match: A0A504YFS7 (Protein phosphatase type 2C alpha 2 OS=Fasciola gigantica OX=46835 GN=FGIG_08088 PE=3 SV=1)

HSP 1 Score: 496.123 bits (1276), Expect = 9.250e-171
Identity = 232/366 (63.39%), Postives = 293/366 (80.05%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKT-EDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNELS 1134
            MGA L  PKT+K+NE+G GNGLR+G+ASMQGWR+ MEDAHCAITQL GNL  WSFFAVFDGHAGA VS +CA +LLK IV+TEEFK IDP++APS+ EI  GIR+GFL+LD+R+R++ +    +DKSGSTAVCVL++PKHIFFANCGDSRA+LIR G+V FATVDHKP NP EKERIQNAGGSV+++RVNGSLAVSR+IGD+ YK V G GPTEQL+SPEPE+TVL+R+   DE++VLACDGIWDV++N+ +C  LQHR+RC+DDL  +CNETID CLYKGS DNMSIVLVAF+ AP+ D    S+D++++++L E  K YL  T E   + +V+ H++       PP  +  K   I+K+ +E +
Sbjct:    1 MGALLGTPKTEKYNETGSGNGLRYGIASMQGWRVSMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCATELLKCIVDTEEFKKIDPDLAPSLPEIERGIRDGFLSLDDRLRQLPQVASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIRQGEVAFATVDHKPINPSEKERIQNAGGSVIVERVNGSLAVSRSIGDYAYKAVKGLGPTEQLISPEPEITVLNRNKELDEIIVLACDGIWDVLSNEALCSLLQHRMRCTDDLSLVCNETIDMCLYKGSSDNMSIVLVAFDPAPRTDPKCKSEDEKVEEVLFERAKKYLETTREQPSMESVLAHLQTFPEPQIPPFLVFCKGGKIQKLLDEFT 366          
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Match: A0A2H1CX61 (Protein phosphatase 2C OS=Fasciola hepatica OX=6192 GN=D915_000734 PE=3 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 1.126e-170
Identity = 232/366 (63.39%), Postives = 293/366 (80.05%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKT-EDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNELS 1134
            MGA L  PKT+K+NE+G GNGLR+G+ASMQGWR+ MEDAHCAITQL GNL  WSFFAVFDGHAGA VS +CA +LLK IV+TEEFK IDP++APS+ EI  GIR+GFL+LD+R+R++ +    +DKSGSTAVCVL++PKHIFFANCGDSRA+LIR G+V FATVDHKP NP EKERIQNAGGSV+++RVNGSLAVSR+IGD+ YK V G GPTEQL+SPEPE+TVL+R+   DE++VLACDGIWDV++N+ +C  LQHR+RC+DDL  +CNETID CLYKGS DNMSIVLVAF+ AP+ D    S+D++++++L E  K YL  T E   + +V+ H++       PP  +  K   I+K+ +E +
Sbjct:    1 MGALLGTPKTEKYNETGSGNGLRYGIASMQGWRVSMEDAHCAITQLPGNLKDWSFFAVFDGHAGALVSAMCATELLKCIVDTEEFKKIDPDLAPSLPEIERGIRDGFLSLDDRLRQLPQVASGEDKSGSTAVCVLITPKHIFFANCGDSRAVLIRQGEVAFATVDHKPINPSEKERIQNAGGSVIVERVNGSLAVSRSIGDYAYKAVKGLGPTEQLISPEPEITVLNRNKELDEIIVLACDGIWDVLSNEALCSLLQHRMRCTDDLSLVCNETIDMCLYKGSSDNMSIVLVAFDPAPRTDPKCKSEDEKIEEVLFERAKKYLETTREQPSMESVLAHLQTFPEPQIPPFLVFCKGGKIQKLLDEFT 366          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 443.351 bits (1139), Expect = 2.765e-153
Identity = 217/377 (57.56%), Postives = 277/377 (73.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIV---ETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA---DLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKR 1140
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A   L   L  WSFFAV+DGHAG+RV+  C+  LL++IV     EE +      PE  P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP+H++F NCGDSRALL R+  VCF+T+DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK+V+GKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C F++ R+  SDDL K+CNE +DTCL+KGSRDNMS+VLV   NAPK+ E    KD ELDK L+  V++ + K  +    DL+ V+ ++    + N PP  G+ SK  +IE +YN L+ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPE-TPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDKFLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNRLNPQ 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 442.58 bits (1137), Expect = 5.359e-153
Identity = 217/377 (57.56%), Postives = 277/377 (73.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIV---ETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA---DLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKR 1140
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A   L   L  WSFFAV+DGHAG+RV+  C+  LL++IV     EE +      PE  P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP+H++F NCGDSRALL R+  VCF+T+DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK+V+GKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C F++ R+  SDDL K+CNE +DTCL+KGSRDNMS+VLV   NAPK+ E    KD ELDK L+  V++ + K  +    DL+ V+ ++    + N PP  G+ SK  +IE +YN L+ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPE-TPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDKFLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNRLNPQ 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:103024377])

HSP 1 Score: 443.351 bits (1139), Expect = 9.179e-153
Identity = 217/377 (57.56%), Postives = 277/377 (73.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIV---ETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDA---DLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKR 1140
            MGAFLDKPKT+KHN  G GNGLR+GL+SMQGWR+EMEDAH A   L   L  WSFFAV+DGHAG+RV+  C+  LL++IV     EE +      PE  P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV VL+SP+H++F NCGDSRALL R+  VCF+T+DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK+V+GKGPTEQLVSPEPEV  + R    DE +VLACDGIWDVM+N+++C F++ R+  SDDL K+CNE +DTCL+KGSRDNMS+VLV   NAPK+ E    KD ELDK L+  V++ + K  +    DL+ V+ ++    + N PP  G+ SK  +IE +YN L+ +
Sbjct:    1 MGAFLDKPKTEKHNAHGEGNGLRYGLSSMQGWRVEMEDAHTAAVGLPHGLDDWSFFAVYDGHAGSRVANYCSNHLLEHIVAAGSVEELRKAGAPSPE-TPAVEAVKSGIRAGFLRIDEHMRSFTDLRNGMDRSGSTAVAVLLSPEHMYFINCGDSRALLCRNAHVCFSTLDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKSVEGKGPTEQLVSPEPEVFEIVRSEAEDEFVVLACDGIWDVMSNEELCAFVRARLEVSDDLEKVCNEVVDTCLHKGSRDNMSVVLVCLPNAPKVSEEAVKKDAELDKFLESRVEELIEKAGEGGIPDLVHVMRNLATENIPNLPPGGGLPSKHSVIEAVYNRLNPQ 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:103025067])

HSP 1 Score: 432.95 bits (1112), Expect = 3.614e-149
Identity = 211/378 (55.82%), Postives = 274/378 (72.49%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID--------PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELS 1134
            MGAFLDKPK +KHN  G GNGLRFGL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V+  C   LL++I    +F+            +  PSV+ ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+H++F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R +  DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F  APK+      ++ ELDK L+  V++ L K  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNGLRFGLSSMQGWRVEMEDAHTAVIGLPNGLDPWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFRGGGGGGGVDGGTDEEPSVESVKCGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHVYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYAIERSDTEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFSGAPKVSPDAVKREAELDKYLEGRVEEILKKHGDEGVPDLVHVMRMLASESIPNLPPGGELASKRSVIEAVYNKLN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:103025067])

HSP 1 Score: 433.335 bits (1113), Expect = 4.506e-149
Identity = 211/378 (55.82%), Postives = 274/378 (72.49%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNID--------PEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSD-DKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELS 1134
            MGAFLDKPK +KHN  G GNGLRFGL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V+  C   LL++I    +F+            +  PSV+ ++ GIR GFL +D+ +R++ E +    D+SGSTAV V++SP+H++F NCGDSR LL R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK V GKGPTEQLVSPEPEV  ++R +  DE +VLACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VLV F  APK+      ++ ELDK L+  V++ L K  D    DL+ V+  + +  + N PP G + SKR +IE +YN+L+
Sbjct:    1 MGAFLDKPKMEKHNAHGDGNGLRFGLSSMQGWRVEMEDAHTAVIGLPNGLDPWSFFAVYDGHAGSQVARYCCEHLLEHITSNPDFRGGGGGGGVDGGTDEEPSVESVKCGIRTGFLQIDDHMRQISEKKHGGADRSGSTAVGVMISPRHVYFINCGDSRGLLSRGGAVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVYAIERSDTEDEFIVLACDGIWDVMANEELCDFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLVCFSGAPKVSPDAVKREAELDKYLEGRVEEILKKHGDEGVPDLVHVMRMLASESIPNLPPGGELASKRSVIEAVYNKLN 378          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 431.024 bits (1107), Expect = 2.376e-148
Identity = 216/383 (56.40%), Postives = 278/383 (72.58%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELSKRDNCPRKVNADGS 1176
            MGAFLDKPKT+KH   G GNGLR+ L+SMQGWR+EMEDAH A+  +   L  WSFFAV+DGHAG+RV+  C+  LL++I+  E F+       PS + +  GI+ GFL +DE +R + + +   D+SGSTAV V++SPKH++F NCGDSRA+L R+G V F T DHKP NP EKERIQN GGSVMIQRVNGSLAVSRA+GDF+YK VDGKGPTEQLVSPEPEV  ++R ++ DE +VLACDGIWDVM+N+++ QF+  R+  +DDL KICN+ +DTCLYKGSRDNMSIVLV F NAPK+     ++++ELDK L+  V++ L K       DL +V+  +    + N PP  G+ SKR LIE +YN L+     P + + DGS
Sbjct:    1 MGAFLDKPKTEKHTTHGGGNGLRYALSSMQGWRVEMEDAHTAVVGIPRGLKTWSFFAVYDGHAGSRVATFCSEHLLEHIITNEHFE-CKAGTEPSSEAVEKGIQAGFLQIDEHMRTISDIKNGLDRSGSTAVAVMLSPKHLYFINCGDSRAVLYRNGSVHFCTEDHKPCNPAEKERIQN-GGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIER-SDGDEFVVLACDGIWDVMSNEELGQFVHSRLLLTDDLEKICNQVLDTCLYKGSRDNMSIVLVCFPNAPKVTVEAVAREEELDKFLETKVEEVLEKHTGEVAPDLASVIRAVSVENIPNLPPGGGLASKRVLIEAVYNRLN-----PHREDDDGS 375          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003550.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 1.036e-42
Identity = 103/319 (32.29%), Postives = 154/319 (48.28%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGS-----------------TAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETI-------DTCLYKG-SRDNMSIVLVAFE 921
            MG +L  P+ +K +E G    LR+G   MQGWR  MED+H A   L     G SFF V+DGH G  V++     L+  + +   F+  + E A         +++ ++ LDE +         ++ SGS                 TAV  +++P  I+  N GDSR +L         + DHKP N +EK+RI+ AGG V   RV G L +SR+IGD EYK        +Q+++  PEV   ++  N    L+LACDGIWD +++ +   F+   ++  D  +    E I       D     G   DNM+ V+V F+
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGH---GVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQA---------LKDIYIHLDEMLLTPYGKSKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAIITPTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVR-REKITNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 306          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003549.1 (pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene:ENSPMAG00000003243.1 transcript:ENSPMAT00000003549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 6.018e-42
Identity = 104/313 (33.23%), Postives = 156/313 (49.84%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKM-------IEGELSDDK----SGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETI-------DTCLYKG-SRDNMSIVLVAFE 921
            MG +L  P+ +K +E G    LR+G   MQGWR  MED+H A   L     G SFF V+DGH G  V++     L+  + +   F+  + E A  +++I   + E  LT   +  K        + G    ++    +G TAV  +++P  I+  N GDSR +L         + DHKP N +EK+RI+ AGG V   RV G L +SR+IGD EYK        +Q+++  PEV   ++  N    L+LACDGIWD +++ +   F+   ++  D  +    E I       D     G   DNM+ V+V F+
Sbjct:    1 MGPYLTVPRKEKESEDGENTKLRYGATGMQGWRNTMEDSHIACLDLGH---GVSFFGVYDGHGGNEVADFVRDHLVDELKKLPSFQGSNYEQA--LKDIYIHLDEMLLTPYGKSYKKNNDSGSSLFGRGGSEEIAMGTGCTAVSAIITPTDIYVGNSGDSRVVLAVKYHGIEMSEDHKPDNRLEKQRIERAGGFVEDNRVKGVLNLSRSIGDLEYKLNKSLSVDDQMITVVPEVR-REKITNETAFLILACDGIWDCLSSQECTNFVGELLKKKDRRLSSVVEDIFDKIIATDVASSGGIGCDNMTCVVVQFK 307          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 105.531 bits (262), Expect = 2.786e-26
Identity = 75/242 (30.99%), Postives = 116/242 (47.93%), Query Frame = 1
Query:  199 SFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVM---IQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSD-DLMKICNETIDTCLYKGSRDNMSIVLV 912
            ++FA+FDGH G   +   A  L  ++     F+  DP  A         +R  F   D+R       E  + + GST V  L+    +  A  GDS+ +L+R G        HKP    EK+RI+  GG V+     RVNG+L+VSRAIGD E+K           VS + +      D + D LL LACDG +D +  D+  + +   +R +D D   + +  + +    GS DN+++++V
Sbjct:    1 AYFAIFDGHGGVDAAIYAATHLHVSLAREGSFRR-DPLEA---------LRRAFCQTDQRFVLKARQEQKNWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKGSPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHK---------PYVSCDADCATFPLDGSEDYLL-LACDGFYDTVQPDEAARIVGEHLRENDGDPAMLAHRLVASARDAGSSDNITVLVV 222          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 107.842 bits (268), Expect = 3.880e-26
Identity = 81/287 (28.22%), Postives = 133/287 (46.34%), Query Frame = 1
Query:   97 NGLRFGLASMQGWRIEMEDAHCAITQLSGNLGG------WSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVM---IQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSD-DLMKICNETIDTCLYKGSRDNMSIVLVAFENA 927
               +  L +++  R +MED H     L+            ++FA+FDGH G   +   A  L  ++     F+  DP          + +R  F   D+R   +++    + + GST V  L+    +  A  GDS+ +L+R G        HKP    EK+RI+  GG V+     RVNG+L+VSRAIGD E+K           VS + +      D + D LL LACDG +D +  D+  + +   +R +D D   + +  + +    GS DN+++++V   +A
Sbjct:   77 RSFQISLHAIKNTRRKMEDRHVIFQDLNALFTSEEEEDDQAYFAIFDGHGGVDAAIYAATHLHVSLAREGSFRR-DP---------LEALRRAFCQTDQRF--VLKARQENWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKGSPVELMSPHKPDREDEKKRIEALGGCVIWFGAWRVNGTLSVSRAIGDMEHK---------PYVSCDADCATFPLDGSEDYLL-LACDGFYDTVQPDEAARIVGEHLRENDGDPAMLAHRLVASARDAGSSDNITVLVVFLRDA 341          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 182.956 bits (463), Expect = 1.611e-52
Identity = 110/303 (36.30%), Postives = 162/303 (53.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQL--SGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKH--IFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAF 918
            MG  L  P  DK + SG  +   FGL +MQGWR+ MED+H     +    +    +F+ +FDGH GA+V+E C  ++++ + E + F   +   A         + + F+  D  ++ + +  + +D SG TA  +LVS     +   N GDSR +L  DG     + DHKP    EK RI  A G V + RVNG+LA+SRAIGDFE+K+    GP EQ+V+  P++     D + DE ++LACDGIWD +T+ D    +   +R    L +I +  ID C    +       DNMSIV+VA 
Sbjct:    1 MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGIFDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRA---------LIDTFINTD--VKLLQDPVMKEDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVAL 292          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 179.874 bits (455), Expect = 3.114e-51
Identity = 113/304 (37.17%), Postives = 162/304 (53.29%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQL--SGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVS--PKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSD-DLMKICNETIDTCLYKGSR------DNMSIVLVAF 918
            MG  L  P  DK + SG      FGL +MQGWR+ MEDAH     L    +    +F+ +FDGH G+ V+E C ++++  + + E FK+   E           + + FL  D  + K  + +L DD SG TA  +LVS   K +  AN GDSR +L   G     + DHKP    EK RI  A G V + RVNG+LA+SRAIGDFE+K+    GP EQ+V+  P++   + + + DE ++LACDGIWD +T+ +    + + I   +  L  I +  +D C    +       DNMSI +VA 
Sbjct:    1 MGQILSNPIIDKEHHSGTDCLTAFGLCAMQGWRMSMEDAHIVEPNLLAESDEEHLAFYGIFDGHGGSSVAEFCGSKMISILKKQESFKSGMLEQC---------LIDTFLATDVELLK--DEKLKDDHSGCTATVILVSQLKKLLICANSGDSRTVLSTGGNSKAMSFDHKPTLLSEKSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDIICHNLNYDEDEFVILACDGIWDCLTSQECVDLVHYGISQGNMTLSDISSRIVDVCCSPTTEGSGIGCDNMSISIVAL 293          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 138.658 bits (348), Expect = 7.709e-38
Identity = 97/288 (33.68%), Postives = 153/288 (53.12%), Query Frame = 1
Query:  106 RFGLASMQG--WRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTA-VCVL-------VS---------PKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLV 912
            R G+A  +   +R  MED H  +   +  L  W +FAVFDGHAG + S+ C   L   I+E    +NI   +A   +++RD + + FL +DE I   + G      SG TA VCVL       VS          + ++ AN GDSR +L R+G     T DHK ++ +E +R++ AGG +M  RVNG LAV+R++GD  +         + LV   P  T ++   + D+ L+LACDG+WDV+ + D C+ ++  I   ++  K+    +   L  G+ DN+++++V
Sbjct:   20 RVGVAENKNSKFRRTMEDVHTYVKNFASRLD-WGYFAVFDGHAGIQASKWCGKHL-HTIIE----QNI---LADETRDVRDVLNDSFLAIDEEINTKLVG-----NSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFF---------DSLVVGSPFTTSVEI-TSEDKFLILACDGLWDVIDDQDACELIKD-ITEPNEAAKVL---VRYALENGTTDNVTVMVV 279          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Match: PTC4 (Cytoplasmic type 2C protein phosphatase (PP2C); identified as a high-copy number suppressor of cnb1 mpk1 synthetic lethality; overexpression decreases high-osmolarity induced Hog1p phosphorylation and kinase activity [Source:SGD;Acc:S000000329])

HSP 1 Score: 120.553 bits (301), Expect = 1.936e-30
Identity = 107/395 (27.09%), Postives = 170/395 (43.04%), Query Frame = 1
Query:   40 MGAFLDKPKTDK--------HNESGIGNGLRFG--LASMQGWRIEMEDAHCAITQ------------------LSGNLGGWSFFAVFDGHAGARVSEICA-------------------AQLLKNIV--------------ETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCV-LVSPKHIFFANCGDSRALLI-RDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKN------------------VDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAFENAPKLDESYASKDK 963
            MG  L  P T+K        +N++  G   RF   + SMQG+R+  EDAH    +                  LS N+     FAVFDGH G   S+  +                   A L+K I               ++ +FK     +   V +I    ++ F+  DE + +      ++   GSTAV   +++ + ++ ANCGDSR +L  +   +   + DHKP +  E  RI + GG+V + RV G LA+SRA  DF++K                     G  P E  V+ EP+V +   D + DE LVLACDGIWD+  N  +  F+++ +     L  I  + +D  + + +       DNM+ ++V      +  + + +K K
Sbjct:    1 MGQLLSHPLTEKTIEYNEYKNNQASTGIVPRFYNCVGSMQGYRLTQEDAHLIRNENSVVYVRFFNPFIDKYETLSLNV-----FAVFDGHGGDDCSKFLSGGRHHRDGNGSSNGNGEPNAGLIKWIAYSFENHHYTSTTNNDSSKFKRSFNTLEGLVSQI---FKDAFILQDEELYR----HFANSSCGSTAVVACIINEESLYVANCGDSRCILSSKSNGIKTMSFDHKPQHIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVTYPHRRTKLTNITQNLTYGTPPQEAQVTVEPDVLMHKIDYSKDEFLVLACDGIWDIYNNKQLIHFIKYHLVSGTKLDTIITKLLDHGIAQANSNTGVGFDNMTAIIVVLNRKGETLQDWFNKMK 383          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 73.1738 bits (178), Expect = 4.908e-14
Identity = 77/305 (25.25%), Postives = 130/305 (42.62%), Query Frame = 1
Query:   85 SGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFD--------GHAGARV-----SEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEG----------ELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRD-GKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVA-FEN 924
            + I NG+R+G+A   G R  +        +  GN        + D        GH  +R+      +I   QL +   ET++              I+  +R  FL L++ I  M+              +D  SG+ +  + +  K +F AN GD  A+L ++ G     T  H P    E ERI+ +GG V   +++G + VSRA+G F+              SP+  V  L +    DE+L++A   +W+ M  D +C   +     S D ++   E  D  +  G  +N++I+ +A +EN
Sbjct: 1350 ASIINGMRYGVADTLGQRDYVSSRDVTFERFRGN-DDECLLCLHDSKNQNADYGHNISRIVRDIYDKILIRQLERYGDETDD-------------NIKTALRFSFLQLNKEINGMLNSVDNGADVANLSYADLLSGACSTVIYIRGKKLFAANLGDCMAILSKNNGDYQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVGFFDLL-------PHIHASPDISVVTLTKA---DEMLIVATHKLWEYMDVDTVCDIAREN---STDPLRAAAELKDHAMAYGCTENITILCLALYEN 1627          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Match: EDO36040 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJS2])

HSP 1 Score: 360.533 bits (924), Expect = 1.123e-121
Identity = 170/354 (48.02%), Postives = 250/354 (70.62%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMA--PSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTE---DADLIAVVNHIENLKLLNFPPCG 1086
            MGAFLDKP+T+K  ++G GNGLR+GLA+MQGWR+EMEDAH A+  LS +L  WSFFAVFDGHAG  VS+ C++ L + +++ + F+    E +  P + ++R G+R+ FL LD  ++K+ +    +DKSGSTA+ +LV+PK+  FANCGDSR +L  +G+V + TVDHKP NP EK RI+NAGGSVMIQRVNG+LAVSRA+GDFEYK       T+QLVSPEP++    R ++ DE +VLACDG+WDVMTND++  F++ R++ +DDL ++  E +DTCL KGSRDNMS+++++   +PK+ +     +++++  L+  ++  L +     + D+   +  +   ++   PP G
Sbjct:    1 MGAFLDKPRTEKETKTGEGNGLRYGLAAMQGWRVEMEDAHTAVIGLSDHLKDWSFFAVFDGHAGENVSKYCSSNLHETLLKHQSFEAAIKESSDSPDLDQLRSGLRDAFLELDSTMQKLPKWSSGEDKSGSTAIALLVTPKYYIFANCGDSRGILSHNGEVIYNTVDHKPGNPDEKTRIENAGGSVMIQRVNGALAVSRALGDFEYKLDSSLHATKQLVSPEPDIFFQSR-SDQDEFIVLACDGVWDVMTNDEVGAFVRSRLQITDDLQRVSCELLDTCLTKGSRDNMSVIIISLPGSPKVTDEAIKNEQKVEAELEAKLEALLEEETNLAEVDVSYAMQSLSQEEIQGLPPGG 353          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 185.652 bits (470), Expect = 1.464e-54
Identity = 116/307 (37.79%), Postives = 171/307 (55.70%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSR------DNMSIVLVAFENAPKLDE 942
            MG  L +P T K   S      +   + MQGWRI MEDAH  I  L  +    +F  V+DGH GARV++     L K I          P  A     + + +++GFL+ D  + K  + ++ D+ +G+TAV V++    ++ AN GDSRA+  + G V   + DHKP+N  E  RI  AGG V   RVNG+LA+SRA+GDF +K  D K P EQ+V+  P+V V D   ++ E LVLACDGIWDV++N ++  F++ R+    +L +IC E +  CL    +      DNM+++++ F N    +E
Sbjct:    1 MGQTLSEPVTTKETSSCSNKSYKLASSCMQGWRINMEDAHTEILSLKEDKNT-AFLGVYDGHGGARVAQYVGQNLQKKIAS-------QPAWAKG--NVIEALKKGFLSCDTDMLK--DEQMKDEVAGTTAVVVVIKNNKLYCANVGDSRAIACKKGLVEQLSFDHKPSNEEETRRIIAAGGWVEFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDVIVKDLTPDH-EFLVLACDGIWDVLSNQEVVDFIRSRLAQRMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTFLNGGTYEE 294          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 151.369 bits (381), Expect = 1.585e-41
Identity = 106/350 (30.29%), Postives = 168/350 (48.00%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERI-------RKMIEGE-----------------------------------LSDDKSG----STAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQ-RVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEV--TVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIR-CSDDLMKICNETIDTCLYKGSR------DNMSIVLVAFE 921
            MGA+L KPKT+ ++ +   + + +G ++MQGWR+ MEDAH  +     +    S FAV+DGH G  V+E  +  L   +     +K  + + A         + + FL +DE I        K ++ E                                   +  D++G    +TA+  LV   ++  AN GDSR +L R+G     ++DHKP +  E  RI  AGG V  + RVNG L +SRA+GD  YK     G  EQ ++  P++  T L      DE +V+ACDGIW+V  + ++  F++  ++   ++L  IC +  D CL   +       DNM+ V+V+F+
Sbjct:    1 MGAYLSKPKTEMNSVTESNSKMSYGASAMQGWRVSMEDAHTCLLDFDEDT---SLFAVYDGHGGQEVAEYVSKHLPDVLRGDIGYKEGNTKQA---------LIDTFLKVDESIVSEEGVDEKGVDEEGASEEPQDGEEEEEEEEESEEEEEEEEDEDGEGVLVKSDEAGYDSGTTAIVALVKDNNLTVANVGDSRCVLCRNGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGRVNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQTTL---TEADEFMVIACDGIWNVKNSQEVVDFVKQEMKNGEENLSSICEKLFDACLAPDTSGDGAGCDNMTCVIVSFK 335          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 124.79 bits (312), Expect = 3.282e-32
Identity = 87/270 (32.22%), Postives = 133/270 (49.26%), Query Frame = 1
Query:  136 RIEMEDAHCAITQLSGNLG------GWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERI--RKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVM---IQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLV 912
            R +MED H  +   +   G       +++FAVFDGH G   +   A  L   + + E     DP +A         + E F   D     R + EG     +SG TAV +L++ + ++ A  GDS+A+L +DG+       HKP    EK+RI+  GG V+     RVNGSL+VSRAIGD E+K           +S EP+V     D    E ++LACDG+WD +  +   + ++  I   +D   +    +D    +GS DN+S+++V
Sbjct:   50 RRKMEDKHVIMPHFNSLFGLPKDSPNYAYFAVFDGHGGIDAATFAATHLHCFLAQNEHLIK-DPGLA---------LHETFQNTDCSFGARAISEGL----RSGCTAVSILITNEALYLAWLGDSQAILCKDGEFIELMQPHKPERQDEKDRIEGLGGCVVWFGAWRVNGSLSVSRAIGDAEHK---------PFISGEPDVAEYALDGEQ-EFVILACDGLWDTVKPEQAIKLVKEHIASGNDRCDVAKVLVDEAKQEGSSDNISVLVV 295          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Match: EDO39603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M4])

HSP 1 Score: 105.916 bits (263), Expect = 1.121e-25
Identity = 83/249 (33.33%), Postives = 120/249 (48.19%), Query Frame = 1
Query:  103 LRFGLASMQGWRIEMEDAHCAITQLSGNLGG------WSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPE--MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIR---DGKVCFATV--DHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQ 810
            L+   A  +G R EM+DAH    +     G        +++AVFDGHAG R S   A  L +NI      K+  P+  +    +EI+  + + +   DE+            K GSTAV VLV    ++ AN GDS+AL+ R    GK+    +  DH P    E+ RIQ AGG V   RV G L VSR+IGD  +K          + +P+     L    +ND  L+LACDG+W   + D+  +++ 
Sbjct:    4 LKGFFAERKGEREEMQDAHVIRDEYYPEPGRGDDVQRMAYYAVFDGHAGPRASLFAAEHLHENI------KSRMPKGSITGKDKEIKKCLVDAYTLTDEQFLHEASKGTPVWKDGSTAVSVLVINNTLYVANLGDSKALVCRCDSAGKISVVRLSKDHSPTGYDERMRIQKAGGYVKDGRVLGVLEVSRSIGDGRFKRCG------VISTPDIMRCTL---TDNDRFLLLACDGLWKGFSVDEAVKYIS 237          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039194.1 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 446.047 bits (1146), Expect = 2.274e-154
Identity = 218/369 (59.08%), Postives = 276/369 (74.80%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYL---AKTEDADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KH+  G GNGL +GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG+RV+  C+A LL++I+         P    SV+ ++DGIR GFL +DE +R   +     D+SGSTAVCVL+SP H++F NCGDSRA+L RDGKV F+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV VL+R    DE +VLACDGIWDVM+N+++C+F++ R+   DDL K+CN  +DTCL+KGSRDNMS+VLV F  APK+ E    K++ELDK L+  V++ L    +T   DL++V+  I +  + N PP  G+ SKR +IE +YN L+
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPS---SVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETRVEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNRLN 366          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 445.662 bits (1145), Expect = 3.679e-154
Identity = 213/374 (56.95%), Postives = 278/374 (74.33%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPS-VQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN SG GN LRFGL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL++I  ++ F++   E + S V +++DGIR GFL  DE IR + E + S+D+SGSTAV V++SP H++F NCGDSR +L R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK VDGKGPTEQLVSPEPEV  ++R   +DE ++LACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VL+ F  APK+ +    ++ ELDK L+  V++ L    D    DL+ V+  + +  + N PP G + SKR LIE ++N L+   N
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDKVKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARVEEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNRLNPSKN 374          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:NCBI gene;Acc:101155070])

HSP 1 Score: 445.277 bits (1144), Expect = 3.997e-154
Identity = 213/374 (56.95%), Postives = 278/374 (74.33%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPS-VQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTED---ADLIAVVNHIENLKLLNFPPCG-IHSKRHLIEKIYNELSKRDN 1146
            MGAFLDKPK +KHN SG GN LRFGL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG++V++ C   LL++I  ++ F++   E + S V +++DGIR GFL  DE IR + E + S+D+SGSTAV V++SP H++F NCGDSR +L R G V F T DHKP+NP+EKERIQNAGGSVMIQRVNGSLAVSRA+GDF+YK VDGKGPTEQLVSPEPEV  ++R   +DE ++LACDGIWDVM N+++C F++ R+  +DDL ++CNE +DTCLYKGSRDNMS+VL+ F  APK+ +    ++ ELDK L+  V++ L    D    DL+ V+  + +  + N PP G + SKR LIE ++N L+   N
Sbjct:    1 MGAFLDKPKMEKHNNSGEGNELRFGLSSMQGWRVEMEDAHTAVVSLPSPLQCWSFFAVYDGHAGSQVAKYCCEHLLEHITSSQGFQSALKEKSESTVDKVKDGIRSGFLMFDEHIRNLSEKKHSNDRSGSTAVGVMISPSHLYFINCGDSRGILSRSGLVKFFTEDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVYAIERSEKDDEFIILACDGIWDVMGNEEVCSFVRSRLEVTDDLERVCNEIVDTCLYKGSRDNMSVVLICFPGAPKVSQEAVMREMELDKFLEARVEEILKTEWDKGTPDLVNVMRMLTSETIPNLPPGGELASKRSLIEAVFNRLNPSKN 374          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000012921.2 (protein phosphatase 1B [Source:NCBI gene;Acc:101156612])

HSP 1 Score: 446.817 bits (1148), Expect = 2.139e-153
Identity = 218/369 (59.08%), Postives = 276/369 (74.80%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYL---AKTEDADLIAVVNHIENLKLLNFPP-CGIHSKRHLIEKIYNELS 1134
            MGAFLDKPKT+KH+  G GNGL +GL+SMQGWR+EMEDAH A+  L   L  WSFFAV+DGHAG+RV+  C+A LL++I+         P    SV+ ++DGIR GFL +DE +R   +     D+SGSTAVCVL+SP H++F NCGDSRA+L RDGKV F+T DHKP NP EKERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV VL+R    DE +VLACDGIWDVM+N+++C+F++ R+   DDL K+CN  +DTCL+KGSRDNMS+VLV F  APK+ E    K++ELDK L+  V++ L    +T   DL++V+  I +  + N PP  G+ SKR +IE +YN L+
Sbjct:    1 MGAFLDKPKTEKHSAHGEGNGLHYGLSSMQGWRVEMEDAHTAVVGLPHGLTDWSFFAVYDGHAGSRVANYCSAHLLEHILSGGAEFGQGPS---SVEGVKDGIRSGFLNIDEYMRNFSDLRQGLDRSGSTAVCVLLSPTHLYFINCGDSRAVLSRDGKVGFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVCVLERAAEGDEFVVLACDGIWDVMSNEELCEFVRSRLLVCDDLEKVCNSVVDTCLHKGSRDNMSVVLVCFPGAPKISEEAVKKEEELDKYLETRVEELLGTCGETGAPDLVSVLRSIASENIPNLPPGGGLASKRSVIEAVYNRLN 366          
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Match: ppm1ba (protein phosphatase, Mg2+/Mn2+ dependent 1B [Source:NCBI gene;Acc:101157967])

HSP 1 Score: 418.698 bits (1075), Expect = 2.006e-143
Identity = 208/385 (54.03%), Postives = 270/385 (70.13%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQL-SGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETE---------------EFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENLKL-----LNFPPCGIHSKRHLIEKIYNEL 1131
            MGAFLDKPKT+KHN  G GNG+R+GL+SMQGWR+EMEDAH A+  L +  +  WSFFAV+DGHAG++V+  C+  LL++I+ +                    I     P+V+ ++ GIR GFL +DE +R   +     D+SGSTAV +L+SP H FF NCGDSRA+L R+ +VCF+T+DHKP NP E+ERIQNAGGSVMIQRVNGSLAVSRA+GD++YK VDGKGPTEQLVSPEPEV V+ R    D+ ++LACDGIWDVM+N+D+C+F++ R+   DDL K+CNE +DTCL+KGSRDNMSIVLV   N PK+ E    KD EL+K L+  V++ L++  D  L  +V  + NL          P  G+ SKR +IE +YN L
Sbjct:    1 MGAFLDKPKTEKHNSHGEGNGVRYGLSSMQGWRVEMEDAHTAVLGLQTPGMTDWSFFAVYDGHAGSKVANYCSKHLLEHIITSSLGDGGTQGSEAGSESSGGEIPAPCPPAVEAVKAGIRTGFLRIDEHMRSFTDLRNGMDRSGSTAVGILLSPDHFFFINCGDSRAVLYRNSQVCFSTLDHKPCNPRERERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVFVMVRAPEQDQFVILACDGIWDVMSNEDLCEFVKSRLEVCDDLEKVCNEVVDTCLHKGSRDNMSIVLVCLPNGPKVSEEAVKKDAELNKYLETRVEEMLSRPGDEGLPDIVTVMRNLSTDSGMPPLPPGGGLASKRSVIEAVYNRL 385          
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 773.467 bits (1996), Expect = 0.000e+0
Identity = 374/380 (98.42%), Postives = 378/380 (99.47%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNELSKRDNCPRKVNADGSC 1179
            MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEG+KDYLAKTEDADL AVVNHI+NLKLLNFPP GIHSKRHLI+KIYNELSKRD+CPRKVNADGSC
Sbjct:    1 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKDYLAKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNELSKRDDCPRKVNADGSC 380          
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Match: SMESG000032910.1 (SMESG000032910.1)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 283/289 (97.92%), Postives = 287/289 (99.31%), Query Frame = 1
Query:  313 MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNELSKRDNCPRKVNADGSC 1179
            MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEG+KDYLAKTEDADL AVVNHI+NLKLLNFPP GIHSKRHLI+KIYNELSKRD+CPRKVNADGSC
Sbjct:    1 MAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGIKDYLAKTEDADLNAVVNHIQNLKLLNFPPGGIHSKRHLIDKIYNELSKRDDCPRKVNADGSC 289          
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Match: SMESG000072821.1 (SMESG000072821.1)

HSP 1 Score: 402.519 bits (1033), Expect = 8.265e-137
Identity = 189/376 (50.27%), Postives = 272/376 (72.34%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYL-AKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNELSKRDNCPR 1155
            MGAFL+KPKT+K + S  G  L +GL++MQGWRI+MEDAH +I  L      W++F V+DGHAG+ VSEIC+ +LL +I+ T EFK +   D      V+  + GIR GFL LD+ I +  E E  +DKSGST + V V+PK++ FANCGDSR +LIR   V F+T DHKP NP+E++RI  AGG+VMIQR+NGSLAVSR++GDF+YK VD KGPTEQLVSP+PE+TV+++ N+ D+L+VLACDG+WDVM+N+++ +F+ HR +   DL KI  E ID CLYKGSRDNMS+V+++ +NAP  D   ASKD +L++L++  V++Y+     + D+ +++  +++  L + PP G+ +KR +I+ ++ +L +    P+
Sbjct:    1 MGAFLEKPKTEKSSHSESGQNLSYGLSAMQGWRIDMEDAHTSILSLPAPFKSWAYFGVYDGHAGSSVSEICSQKLLPSILNTSEFKKMELDDFGNPVDVELAKRGIRNGFLELDKTIGQSHEVETGEDKSGSTVISVFVTPKYVIFANCGDSRGVLIRSNTVHFSTEDHKPMNPIERDRIIKAGGTVMIQRINGSLAVSRSLGDFDYKKVDSKGPTEQLVSPDPEITVIEKVNDEDQLIVLACDGVWDVMSNEELGEFVIHRCQRVKDLSKIAEEVIDNCLYKGSRDNMSVVIISTKNAPNFDRELASKDVKLNELIERKVQEYVNGDGNEMDINSLLMWLQSANLQDLPPGGLTAKRFIIDPLFEDLCRDKQKPQ 376          
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Match: SMESG000027796.1 (SMESG000027796.1)

HSP 1 Score: 332.028 bits (850), Expect = 6.306e-110
Identity = 159/377 (42.18%), Postives = 250/377 (66.31%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTNDDICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLDESYASKDKELDKLLQEGVKDYL-AKTEDADLIAVVNHIENLKLLNFPPCGIHSKRHLIEKIYNE-LSKRDNCPRKVN 1164
            MG++  KP T+K+NESG    + +  +SMQG R  MED  C    L      W++FA+FDGH G RVSE+C+ +LL  I+ETEEFKNI+  +     +I +GI++ F++LD++I    EG        +T   V ++P ++ F NCGDSR++LIR+  + F+++DHKP NP+EKERI  AGG + + R+NG+++VSRA+GD  YK        EQL+S EP+V ++ R++ ND+++VLACDG+WDV +N ++ Q L  R +C+DDL+KI +E ID  LYKGS+DN+S ++VAF NAPK++      D+ LD+ +     +YL +++ D+ L+ ++ +++N+ L N PP GI SK+ +I  ++ + +S + +C  + N
Sbjct:    1 MGSYNGKPNTEKYNESGKFGDIYYSSSSMQGMRSHMEDFQCISLNLPYPFEDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINL-LNLDKSQIINGIKKAFISLDDKISHFSEG--------TTVSAVFITPNYLIFMNCGDSRSVLIRESDIFFSSIDHKPTNPLEKERILKAGGQITMDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDVFSNTELKQLLLQRFKCTDDLVKISDELIDAALYKGSKDNISAIIVAFVNAPKVESECQRLDRLLDENIINKTMEYLYSESSDSSLVDLIEYMKNIALENLPPGGIVSKQSIIVNLFEKYVSVKSHCSDEFN 368          
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Match: SMESG000007683.1 (SMESG000007683.1)

HSP 1 Score: 213.386 bits (542), Expect = 6.807e-66
Identity = 107/224 (47.77%), Postives = 142/224 (63.39%), Query Frame = 1
Query:   40 MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNLGGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNI---DPEMAPSVQEIRDGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSRALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIGDFEYKNVDGKGPTEQLVSPEP 702
            MGA L KPK DK         L  GL+SMQGWR+EMED+H AI  +      WS+F V+DGH G   +  C+  LL+ I++T EF+ +   D     ++  +R+GIR GFL  DE +R +       D+SGSTA CV ++P++  F NCGDSR +LIR+  V F+T DHKP N  EK RI+ AGG V+ +R+NG LAVSR++GDF YK V  K P EQ+VS +P
Sbjct:    1 MGALLAKPKVDKFTIGYKNENLIIGLSSMQGWRVEMEDSHSAIINMEYPFSRWSYFGVYDGHNGGSTALNCSKFLLQMILQTPEFQTMKFDDIGNPKNIGILRNGIRRGFLQFDEFLRSLPNVFSGIDRSGSTATCVFITPRYYVFINCGDSRGILIRNKGVYFSTEDHKPKNVDEKNRIEKAGGLVIGERINGCLAVSRSLGDFAYKKVVNKPPIEQMVSSDP 224          
The following BLAST results are available for this feature:
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1A1.079e-15256.99protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1A1.783e-15156.99protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
PPM1B5.141e-15056.72protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
AC013717.17.536e-15056.72novel protein, PPM1B-SLC3A1 readthrough[more]
PPM1B8.246e-15056.72protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm-1.A4.102e-10043.40Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A4.102e-10043.40Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A1.651e-9943.40Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-1.A1.504e-8641.24Protein phosphatase ppm-1 [Source:UniProtKB/Swiss... [more]
ppm-22.455e-6239.80Probable protein phosphatase 2C T23F11.1 [Source:... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alph1.838e-12351.37gene:FBgn0086361 transcript:FBtr0085442[more]
alph1.838e-12351.37gene:FBgn0086361 transcript:FBtr0085445[more]
alph1.838e-12351.37gene:FBgn0086361 transcript:FBtr0085446[more]
alph3.069e-12351.37gene:FBgn0086361 transcript:FBtr0085443[more]
alph3.582e-12351.37gene:FBgn0086361 transcript:FBtr0085444[more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa2.484e-15055.82protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa2.845e-15055.82protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa2.905e-15055.82protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1aa5.858e-15055.82protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ppm1bb4.855e-14957.72protein phosphatase, Mg2+/Mn2+ dependent, 1Bb [Sou... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1b1.277e-15156.45protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1a1.227e-14956.03protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1b4.136e-14854.86protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b9.478e-14857.18protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1b4.713e-14757.18protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppm1b1.700e-15457.56protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b1.700e-15457.56protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b2.081e-15457.56protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b2.081e-15457.56protein phosphatase 1B, magnesium dependent, beta ... [more]
Ppm1b2.837e-15456.74protein phosphatase 1B, magnesium dependent, beta ... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36993|PPM1B_MOUSE1.985e-15356.74Protein phosphatase 1B OS=Mus musculus OX=10090 GN... [more]
sp|O62829|PPM1A_BOVIN6.682e-15356.99Protein phosphatase 1A OS=Bos taurus OX=9913 GN=PP... [more]
sp|P20650|PPM1A_RAT1.432e-15256.99Protein phosphatase 1A OS=Rattus norvegicus OX=101... [more]
sp|P35814|PPM1A_RABIT3.499e-15257.26Protein phosphatase 1A OS=Oryctolagus cuniculus OX... [more]
sp|P35813|PPM1A_HUMAN5.179e-15256.99Protein phosphatase 1A OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YFT03.333e-17162.64Protein phosphatase 1B OS=Clonorchis sinensis OX=7... [more]
A0A074ZYE64.883e-17162.64PPM-type phosphatase domain-containing protein OS=... [more]
A0A4S2LH956.924e-17162.64PPM-type phosphatase domain-containing protein OS=... [more]
A0A504YFS79.250e-17163.39Protein phosphatase type 2C alpha 2 OS=Fasciola gi... [more]
A0A2H1CX611.126e-17063.39Protein phosphatase 2C OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1ba2.765e-15357.56protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1ba5.359e-15357.56protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1ba9.179e-15357.56protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
ppm1aa3.614e-14955.82protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1aa4.506e-14955.82protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1aa2.376e-14856.40protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ENSPMAT00000003550.11.036e-4232.29pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ENSPMAT00000003549.16.018e-4233.23pep scaffold:Pmarinus_7.0:GL496710:143:1226:1 gene... [more]
ppm1e2.786e-2630.99protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1e3.880e-2628.22protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTC21.611e-5236.30Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC33.114e-5137.17Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC17.709e-3833.68Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC41.936e-3027.09Cytoplasmic type 2C protein phosphatase (PP2C); id... [more]
CYR14.908e-1425.25Adenylate cyclase; required for cAMP production an... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360401.123e-12148.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404491.464e-5437.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314901.585e-4130.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441373.282e-3232.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396031.121e-2533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039194.12.274e-15459.08protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1aa3.679e-15456.95protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ppm1aa3.997e-15456.95protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
ENSORLT00000012921.22.139e-15359.08protein phosphatase 1B [Source:NCBI gene;Acc:10115... [more]
ppm1ba2.006e-14354.03protein phosphatase, Mg2+/Mn2+ dependent 1B [Sourc... [more]
back to top
BLAST of PPM-type phosphatase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032910.10.000e+098.42SMESG000032910.1[more]
SMESG000032910.10.000e+097.92SMESG000032910.1[more]
SMESG000072821.18.265e-13750.27SMESG000072821.1[more]
SMESG000027796.16.306e-11042.18SMESG000027796.1[more]
SMESG000007683.16.807e-6647.77SMESG000007683.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034219 ID=SMED30034219|Name=PPM-type phosphatase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1537bp
GACGGTCTTATCTAAATCTATATAAATCTTATATGATAAATGGGAGCATT
TTTAGACAAACCAAAAACAGACAAACATAATGAAAGTGGAATTGGTAATG
GGTTAAGATTTGGTCTTGCAAGTATGCAAGGTTGGAGAATTGAGATGGAA
GATGCTCATTGTGCCATTACTCAATTATCTGGGAATCTTGGGGGTTGGTC
ATTTTTTGCAGTATTTGATGGACATGCTGGAGCAAGAGTATCGGAAATTT
GTGCTGCACAATTGCTAAAAAATATTGTGGAAACAGAAGAATTTAAGAAT
ATTGATCCAGAAATGGCTCCAAGCGTTCAAGAAATTAGAGATGGTATCCG
CGAAGGATTTTTAACATTAGATGAAAGGATCCGGAAAATGATTGAAGGAG
AACTAAGTGATGACAAATCAGGATCAACAGCTGTTTGCGTATTAGTATCG
CCTAAACATATATTTTTTGCAAACTGTGGTGATTCTCGTGCTTTATTGAT
TAGGGATGGCAAGGTCTGCTTTGCAACCGTTGATCACAAACCAGCAAATC
CAGTGGAAAAAGAACGCATACAAAACGCTGGGGGAAGTGTTATGATTCAG
AGGGTAAATGGATCATTAGCTGTTTCAAGAGCCATAGGTGATTTTGAATA
TAAGAATGTTGACGGTAAGGGACCAACTGAGCAGTTAGTATCGCCAGAAC
CGGAAGTTACAGTTTTGGATAGAGACAACAACAATGATGAGTTGCTCGTA
TTAGCATGTGATGGTATATGGGATGTTATGACAAATGATGACATCTGTCA
ATTTTTACAACATAGAATACGTTGTTCAGATGATTTGATGAAAATTTGTA
ATGAAACAATTGATACATGCCTGTATAAAGGAAGCCGTGATAATATGAGT
ATTGTATTAGTGGCTTTTGAAAACGCTCCAAAACTTGATGAATCATATGC
ATCGAAAGACAAAGAACTCGATAAATTGCTACAAGAAGGAGTAAAGGACT
ATCTTGCAAAAACTGAAGATGCGGATTTGATTGCTGTTGTCAATCATATT
GAAAATCTAAAATTGTTAAACTTTCCGCCATGTGGTATACATTCGAAGAG
ACATCTAATTGAAAAAATATACAATGAATTATCAAAAAGAGATAATTGTC
CTAGAAAAGTAAATGCTGATGGATCCTGTTAAAATTTAGCAGTCTATTGA
TCGATTAACAGTGACAGTTTAAATTCATTGCGTTTGTAGACATTAATTCA
TAATCAAATACCAGTGAAATTTCTATCGCTGGACAATTAAAGTTATAAAA
ATTTTCATGTATTTATATCAAAATATGATGTTTCATGTGATTATGACTAC
TGTATCATTTGTCGAAGGCAATTTGGAATAACACATTAATTTAATTGGCG
ATGCATTGTTGTGAATACCTAATTGACAGAAGTGTTCCAATTTCTAGACC
TTTGGCAGGCTTCTTTCCATTTTACGAACTTTTTGTCTAATTTTTCTGAT
ATGTGATACTCTGGGAAAAATACAGAATCTATTTTAC
back to top

protein sequence of SMED30034219-orf-1

>SMED30034219-orf-1 ID=SMED30034219-orf-1|Name=SMED30034219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MGAFLDKPKTDKHNESGIGNGLRFGLASMQGWRIEMEDAHCAITQLSGNL
GGWSFFAVFDGHAGARVSEICAAQLLKNIVETEEFKNIDPEMAPSVQEIR
DGIREGFLTLDERIRKMIEGELSDDKSGSTAVCVLVSPKHIFFANCGDSR
ALLIRDGKVCFATVDHKPANPVEKERIQNAGGSVMIQRVNGSLAVSRAIG
DFEYKNVDGKGPTEQLVSPEPEVTVLDRDNNNDELLVLACDGIWDVMTND
DICQFLQHRIRCSDDLMKICNETIDTCLYKGSRDNMSIVLVAFENAPKLD
ESYASKDKELDKLLQEGVKDYLAKTEDADLIAVVNHIENLKLLNFPPCGI
HSKRHLIEKIYNELSKRDNCPRKVNADGSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000140anterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR036580PP2C_C_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
IPR012911PP2C_C
IPR000222PP2C_BS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0030145manganese ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0000287magnesium ion binding
GO:0043169cation binding
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 13..291
e-value: 7.6E-95
score: 331.1
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 23..286
e-value: 4.6E-82
score: 275.5
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 23..293
score: 50.838
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 23..293
e-value: 1.13629E-95
score: 283.834
IPR012911Protein serine/threonine phosphatase 2C, C-terminalPFAMPF07830PP2C_Ccoord: 287..362
e-value: 1.4E-18
score: 67.1
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 1..300
e-value: 5.3E-118
score: 395.6
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 3..296
IPR036580Phosphatase 2C, C-terminal domain superfamilyGENE3DG3DSA:1.10.10.430coord: 301..366
e-value: 5.7E-10
score: 40.6
IPR036580Phosphatase 2C, C-terminal domain superfamilySUPERFAMILYSSF81601Protein serine/threonine phosphatase 2C, C-terminal domaincoord: 303..364
NoneNo IPR availablePANTHERPTHR13832:SF244PROTEIN PHOSPHATASE 1Bcoord: 1..325
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 1..325
IPR000222PPM-type phosphatase, divalent cation bindingPROSITEPS01032PPM_1coord: 55..63