SMED30034212

Overview
NameSMED30034212
Smed IDSMED30034212
Length (bp)3824
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034212 (SMED30034212) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034212 (SMED30034212) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034212 (SMED30034212) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034212 (SMED30034212) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034212

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034212SMESG000023080.1 dd_Smed_v4_8763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034212SMESG000023080.1 dd_Smed_v4_8763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034212SMESG000023080.1 dd_Smed_v4_8763_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30034212SMESG000023080.1 dd_Smed_v6_8763_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034212SMESG000023080.1 dd_Smed_v6_15142_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034212SMESG000023080.1 dd_Smed_v6_8763_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30034212SMESG000023080.1 dd_Smed_v6_8763_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034212SMESG000023080.1 dd_Smed_v4_15142_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034212SMESG000023080.1 dd_Smed_v4_15142_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034212SMESG000023080.1 dd_Smed_v4_8763_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034212SMESG000023080.1 dd_Smed_v4_8763_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30034212 vs. TrEMBL
Match: gnl|BL_ORD_ID|23534118 (tr|A0A210QW55|A0A210QW55_MIZYE Testis-expressed sequence 26 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12909 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.349e-22
Identity = 117/381 (30.71%), Postives = 175/381 (45.93%), Query Frame = 3
Query: 2532 IVAKSFIKPGLKDSLENFILSSNKQKDREKALEILASIDDYNKRFCNNNNLVKEYKLKSTLQRPKSACTKLKDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQF---SPFYLQPELKTGQKLKI-STQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQK-KVDLSRLH------NMKDLERAMIETANITDQDTL 3641
            +V ++ I  GL   LE+F   +    DREKAL++L S+  + +   N+++          ++RP +A          N + T Y++DYP+K    T A RP S++   A             +   GP              TTY NDY     TG    P  P R+ +ASG R N PHP ++F+VW+FPR +  +    P +            ++TD+  N+V +  C+STYQSDF G  IP   F   S + L P+ K      + S  R  +  PS    EL +P +RY SNK K     G IP  +++ YM+   RTTYD   ND +  +  QI D  +K   +  R H        KDL + M+E+ +I   + +
Sbjct:   10 VVGENVITQGLTKDLEDFYDKTESSADREKALQLLTSLK-FGQEIRNSSHY--------PVERPHTAMPTFGP---RNPYQTTYTKDYPQKDSGVT-AVRPMSSQGFAA------------SHDLSGPIGA-----------TTYHNDY-----TGGSQPPSAPIRSGSASGSRSNKPHPLQSFMVWKFPRRARPEQKESPWS-----------EELTDDMINQVHKRLCQSTYQSDFLG--IPQG-FQVKSAYNLPPDWKENIPYTLDSVARYSFQTPSQQ-DELRLPASRYGSNKKKQLVASGTIPTASSR-YMHIKQRTTYDRHYNDNSSAVVTQIKDTGKKLGAEALRKHLEKMEGEEKDLVQKMLESYDIGGSEPM 333          
BLAST of SMED30034212 vs. TrEMBL
Match: gnl|BL_ORD_ID|23907853 (tr|K1R2Q7|K1R2Q7_CRAGI Uncharacterized protein C13orf26-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10022566 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.304e-20
Identity = 99/292 (33.90%), Postives = 139/292 (47.60%), Query Frame = 3
Query: 2760 INSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFS---PFYLQPELKTGQKLKI-STQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHN-MKDLERAMIETAN 3620
            ++ + T+Y+ DYP K  KET A+RP S++   A        +H  E    GP         + D  T Y  ++  E P      P  P R+ TASG R N PHP ++FLVWRFP ++  +    P +            Q+TDE  N+V +  C+STYQSD+ G  IP   F     F L P+ K      + S  R  Y +P+    EL VP  RY SN+ K     G IP  +++ Y +   RTTYD   ND A+ +  Q V ++  K++   L   M+  E    ETAN
Sbjct:    1 MDPYQTSYTRDYPVKEPKETTAHRPSSSQGFTA--------SHPLE----GP---------IGD--THYTEEF-FEKPN----RPATPIRSGTASGSRSNKPHPLESFLVWRFPSKAKPEQESSPWS-----------EQVTDEMINQVHKRLCQSTYQSDYLG--IPQG-FQVKRAFTLPPDWKANVPYTLDSVARYSYQKPNPQ-EELQVPITRYGSNRKKPVAATGTIPTASSRFY-HIKGRTTYDRHYNDNAENV-VQQVREVGHKLEQEALQKYMEKAEGQEKETAN 247          
BLAST of SMED30034212 vs. TrEMBL
Match: gnl|BL_ORD_ID|20342469 (tr|A0A1S3KEW0|A0A1S3KEW0_LINUN testis-expressed protein 26 OS=Lingula unguis OX=7574 GN=LOC106181254 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.919e-17
Identity = 108/422 (25.59%), Postives = 176/422 (41.71%), Query Frame = 3
Query: 2535 VAKSFIKPGLKDSLENFILSSNKQ-KDREKALEILASIDDYNKRFCNNNNLVKEYKLKSTLQRPKSACTKL---KDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTGQKLKI-STQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRL------HNMKDLERAMIETANITDQDTLQRVFQKLNEPESYKRISFVRKPF----YHSDKMRWLSSYPGP 3755
            + +  + P   + L+++I  SN   +D+ KAL++L S+            L +E K      RP++A   L   K    +N + T Y  +Y  K   +T A RP             + R   + Y   GP        + YD+      +   E           P R+ TASG R NNPHP ++F+VW+FP+ S+ +      AT L           +D    +VMR   RSTYQ DF G        + F +  + K+     + S+ R  Y +P+  P EL    +RY  N+ K     G +P  + +  M+  TRTTYD + N++A+    + + D+ K +  + +      H +   ER ++ +  + D        Q L  P S       R P      ++    W+S++ GP
Sbjct:   37 LGEDVLAPKFSEHLQSYITHSNTGPQDQRKALDLLTSL-----------QLAEEAKEAENPLRPRTAMPALGRPKLEKILNPYFTTYEREYYMKMAPDTDAERP------------MTSRAFASTYELGGPI-----GATTYDEEFYKKPNKRTE-----------PVRSGTASGARRNNPHPPESFMVWKFPKRSITEGDYSEWATPL-----------SDTIMEQVMRNKFRSTYQEDFLGIPQGFQMKNAFDVSKDWKSQVPFTLDSSTRYSYQQPNQQP-ELQGNTSRYGCNRNKLVPASGAVPTCSERM-MHLKTRTTYDREYNEKAQP---RPLRDLNKSLGANAIQGYMATHRLGSKEREIL-SGMVAD-------LQNLPRPPSNASSRKSRVPMDTMDMYATGPTWVSTWVGP 395          
BLAST of SMED30034212 vs. TrEMBL
Match: gnl|BL_ORD_ID|22565643 (tr|A0A2C9L3Y7|A0A2C9L3Y7_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075461 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.299e-17
Identity = 94/305 (30.82%), Postives = 138/305 (45.25%), Query Frame = 3
Query: 2754 SFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTGQKLKI-STQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLERAMIETANITDQDTLQRVFQKLN 3665
            S I  + T+Y  DYP K  +   A RP +++      +TT  ++        GP              TTY  ++C +        P  P R  TASG R NNPHPS+AF+VWRFPR S          TA K + E     +T+E+ N++ +  C+S YQSD+ G        S F   P+ +      + S QR  Y +P     EL VP  RY SN  K+     +IP   NK  +    RTTYD   ND A  +  QI  D+ KK+    L       +   +T++  D++ + ++ ++ N
Sbjct:   12 SAIKPYQTSYDRDYPPKLEQSVWALRPMTSQGY----ATTVPKSQP-----PGP--------------TTYDVEFCRK-----YQKPATPERIGTASGNRRNNPHPSQAFMVWRFPRNSQYN-----PETAEKISEE-----LTNERLNQITKRLCQSVYQSDYLGIPQGFQVKSAFNTAPDWRDSVPYGMESNQRESYQQPFQQ-RELQVPVTRYGSNAQKNIPAVTVIP-TANKHLIGVNGRTTYDRHYNDNAGPVVEQI-RDVGKKLGHEAL-------KKYYQTSSGEDKELIGKLMEEFN 268          
BLAST of SMED30034212 vs. TrEMBL
Match: gnl|BL_ORD_ID|20618976 (tr|A0A0B7A6F2|A0A0B7A6F2_9EUPU Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF99137 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.185e-17
Identity = 92/342 (26.90%), Postives = 152/342 (44.44%), Query Frame = 3
Query: 2685 VKEYKLKSTLQRPKSACTKLKDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTG-QKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLERAMIETANITDQDTLQRVFQKLNEP-----ESYKRIS 3692
            +K++  K    +P  AC      + +N + T+Y +DYP K  +   A RP     M +    TS  + KT+    GP+E   + +  + +                   P  P RAAT+SG+R N PHP ++FLVW+FP ++ N          ++       A +T+E+ N++ +  C S YQ+D+ G        S F L    K     +  S+QR  Y +P  L  EL+VP  RY SN +K      +IP   NK   +   +TTYD   N  A    G ++++I   ++  +    + L   M   +N  D   + ++  +  EP      S++R++
Sbjct:   11 LKKHLKKIHHSKPAGACGYT---TVLNPYQTSYDKDYPPKTGRHIWAIRP-----MTSVGYVTSVPDSKTQ----GPTEYDAEYFEKFQR-------------------PVSPERAATSSGQRNNKPHPPQSFLVWKFPSKNRN----------IQDGGVKLSADLTNEKLNQITKRLCHSVYQNDYLGIPQGFQVASAFNLPSNWKENVPHVMDSSQRRAYQQPHQL-RELTVPITRYGSNTLKQIPAVTVIP-TANKRLTDVDVKTTYDRHFNSNA----GPVIEEI---INAGKKREAETLRARM--KSNGHDNGQIDKLLMEFEEPNGVMIHSHERVA 300          
BLAST of SMED30034212 vs. Ensembl Cavefish
Match: ENSAMXT00000036119.1 (testis expressed 26 [Source:NCBI gene;Acc:111192166])

HSP 1 Score: 67.0106 bits (162), Expect = 2.071e-11
Identity = 60/201 (29.85%), Postives = 87/201 (43.28%), Query Frame = 3
Query: 2961 TYANDYCVEDPTG---------IKISPRPPN-RAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQF---SPFYLQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTR---TTYDEDINDRA 3515
             Y N Y + DP G          K   +P   R+ +ASG   NNPHP++AFLVWR  R   +K    P                ++E+  +V+    RSTY++DF G     D     SP   +P       ++ +  R +Y +P  L  EL     RY  N + +   KGI+P V +K  +N  +R   TTYD     + 
Sbjct:   37 AYRNSYDLADPVGGTAYRQDYYWKPQTKPACIRSGSASGNSRNNPHPNQAFLVWRLARG--HKLCENPP---------------SEEEVRKVLSAQYRSTYRTDFLGTPQAGDVMNRRSPAPYKPGRDAPHCIQ-TEMRFNYRKP-VLNTELQGNMTRYGCNALHAVPPKGIVPSVVHKHIINQESRKLLTTYDRHFGGKC 218          
BLAST of SMED30034212 vs. Ensembl Cavefish
Match: ENSAMXT00000045460.1 (testis expressed 26 [Source:NCBI gene;Acc:111192166])

HSP 1 Score: 67.0106 bits (162), Expect = 2.193e-11
Identity = 60/201 (29.85%), Postives = 87/201 (43.28%), Query Frame = 3
Query: 2961 TYANDYCVEDPTG---------IKISPRPPN-RAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQF---SPFYLQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTR---TTYDEDINDRA 3515
             Y N Y + DP G          K   +P   R+ +ASG   NNPHP++AFLVWR  R   +K    P                ++E+  +V+    RSTY++DF G     D     SP   +P       ++ +  R +Y +P  L  EL     RY  N + +   KGI+P V +K  +N  +R   TTYD     + 
Sbjct:   38 AYRNSYDLADPVGGTAYRQDYYWKPQTKPACIRSGSASGNSRNNPHPNQAFLVWRLARG--HKLCENPP---------------SEEEVRKVLSAQYRSTYRTDFLGTPQAGDVMNRRSPAPYKPGRDAPHCIQ-TEMRFNYRKP-VLNTELQGNMTRYGCNALHAVPPKGIVPSVVHKHIINQESRKLLTTYDRHFGGKC 219          
BLAST of SMED30034212 vs. Ensembl Nematostella
Match: EDO41768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G5])

HSP 1 Score: 71.633 bits (174), Expect = 2.016e-12
Identity = 61/186 (32.80%), Postives = 88/186 (47.31%), Query Frame = 3
Query: 2958 TTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPND-QFSPFY---LQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKT-YMNTFTRTTYDED 3500
            TTY  +YC +      + P    R  T+SG R NNPHPS+AF+VW+FP          P+    + N EN            V   + +STYQSD+ G  IP   Q    +   ++  LK   +   ST R  Y +P  +  EL    +RY +NK K + T G +P V+ K+  M+ + RT Y  +
Sbjct: 1296 TTYQTEYCEK-----SVKPNEMTRVGTSSGNRRNNPHPSEAFMVWKFPGRGP------PALDPCEYNTEN---------MEEVCFDHLKSTYQSDYTG--IPQGVQVQTVFEGDVKYSLKKPPRTLDSTARHSYQKP-LIRDELKCNFSRYGANKNKYKPTVGAVPTVSAKSPQMHLYGRTHYSHE 1458          
BLAST of SMED30034212 vs. Planmine SMEST
Match: SMESG000023080.1 (SMESG000023080.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 434/453 (95.81%), Postives = 434/453 (95.81%), Query Frame = 3
Query: 2400 MTSATIIPIDFLSGRDLQIMHPQQIV*DFGFFYSNY*RVFFVLQIVAKSFIKPGLKDSLENFILSSNKQKDREKALEILASIDDYNKRFCNNNNLVKEYKLKSTLQRPKSACTKLKDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLERAMIETANITDQDTLQRVFQKLNEPESYKRISFVRKPFYHSDKMRWLSSYPGPL 3758
            MTSATIIPIDFLSGRDLQIMHPQQI                   IVAKSFIKPGLKDSLENFILSSNKQKDREKALEILASIDDYNKRFCNNNNLVKEYKLKSTLQRPKSACTKLKDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLERAMIETANITDQDTLQRVFQKLNEPESYKRISFVRKPFYHSDKMRWLSSYPGPL
Sbjct:    1 MTSATIIPIDFLSGRDLQIMHPQQI-------------------IVAKSFIKPGLKDSLENFILSSNKQKDREKALEILASIDDYNKRFCNNNNLVKEYKLKSTLQRPKSACTKLKDGSFINSFSTAYSEDYPKKPIKETIANRPPSTEHMIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTGIKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATALKANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPELKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQVTNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLERAMIETANITDQDTLQRVFQKLNEPESYKRISFVRKPFYHSDKMRWLSSYPGPL 434          
BLAST of SMED30034212 vs. Planmine SMEST
Match: SMESG000053534.1 (SMESG000053534.1)

HSP 1 Score: 113.235 bits (282), Expect = 3.017e-27
Identity = 59/136 (43.38%), Postives = 84/136 (61.76%), Query Frame = 1
Query:  115 DGVGNISMWMINFKIVAKHRKIDDFASVLPLLLDGPTFLVYDYLVEKDQGSFIAIENTLVKAFLMDGYQTYEKFRSSIWNNEPIDVYLADLQ*FATLTGTQDEALLKRGFIVGLPLSYYNNSKLLSKSRKWFSQRQ 522
            +G G+I   +   K+VAK +K++D  SVLPLLL+G  F+VYD L+EK++ S  +IE  L+  F MD +Q +E FR   WNN+ +DVYL DLQ  ATL    ++ L+K+ F+VGL  +    S+     R W S  Q
Sbjct:  140 NGEGDIGPRIKKLKLVAKIKKMEDLPSVLPLLLEGKAFIVYDQLLEKEKESADSIEKALMNTFSMDLFQAFEAFRQRSWNNDAVDVYLYDLQRLATLANVFEDKLIKKAFVVGLLPTVSRQSR-----RNWISGSQ 270          
BLAST of SMED30034212 vs. Planmine SMEST
Match: SMESG000046229.1 (SMESG000046229.1)

HSP 1 Score: 92.4337 bits (228), Expect = 4.056e-21
Identity = 44/97 (45.36%), Postives = 65/97 (67.01%), Query Frame = 1
Query:  178 IDDFASVLPLLLDGPTFLVYDYLVEKDQGSFIAIENTLVKAFLMDGYQTYEKFRSSIWNNEPIDVYLADLQ*FATLTGTQDEALLKRGFIVGLPLSY 468
            ++D  SVLPLLL+G  F+VYD L EK +GS  +IE  L+ AF MD ++++E FR   WNN+ +D+YLAD+Q   TLT   +E   ++ FI G+ + +
Sbjct:    1 MEDLPSVLPLLLEGQAFIVYDQLPEKKKGSADSIERALINAFSMDSFKSFEAFRQRSWNNQAVDMYLADIQQLVTLTDVSEEK--EKNFISGIDVVF 95          

HSP 2 Score: 47.7506 bits (112), Expect = 1.475e-6
Identity = 14/48 (29.17%), Postives = 35/48 (72.92%), Query Frame = 2
Query: 1049 NNVIIDANDFRAIFDGDKWKVSWKWKNDSLILKNTVTMYALNPDL*RD 1192
            + ++++ +D+ A+F+G  W ++W+WK+ +++LKN++  Y + P++  D
Sbjct:  127 DQILLEEDDYHAVFNGKHWTIAWRWKDKTIVLKNSMAEYNIKPEIRED 174          

HSP 3 Score: 25.0238 bits (53), Expect = 1.475e-6
Identity = 10/18 (55.56%), Postives = 13/18 (72.22%), Query Frame = 3
Query:  978 NLVDGINVVFGLDAVGHF 1031
            N + GI+VVFG DA+  F
Sbjct:   86 NFISGIDVVFGRDAISLF 103          
BLAST of SMED30034212 vs. Planmine SMEST
Match: SMESG000069076.1 (SMESG000069076.1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.019e-14
Identity = 69/201 (34.33%), Postives = 100/201 (49.75%), Query Frame = 2
Query: 1040 FQ*NNVIIDANDFRAIFDGDKWKVSWKWKNDSLILKNTVTMYALNPDL*RDCETEVS------WLTPMKSDGLVVLPLLTTFYENKWEVHLVLNFRE-NTSVKPHTXXXXXXXXXXXXGXXXXXXXXXXXXXXXFEAAHK*RIMEISIGSLLR-SV*RDKV*FK--LCS*IIFSIPRKVLRLNATIHQVTNN*IDDIGVNT 1612
            FQ  +V ID +DF A FD +KW  SWKW++   +LKN V  YA+  ++ ++ E EV        L P   +   +LPLL T  E K +V  VL+FRE N  VK HT+DS+V                        E A + + +EI  GS+ + +V  +K+  +   CS       +KVL L   I   +++ IDDI V+T
Sbjct:    5 FQ-EHVAIDDDDFTASFDREKWTASWKWRDKPALLKNHVAEYAVKQEIRQEYEQEVERWIKEYLLIPANDNDHGILPLLATGQEIKGKVQPVLDFREVNNYVKSHTADSNVCG----------------------EIARQRKPLEIPKGSIQKQAVLLNKIEIRPQRCS-------KKVLSLKLRIKDASDHYIDDIAVDT 175          
BLAST of SMED30034212 vs. Planmine SMEST
Match: SMESG000041830.1 (SMESG000041830.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.229e-6
Identity = 27/81 (33.33%), Postives = 42/81 (51.85%), Query Frame = 2
Query: 1055 VIIDANDFRAIFDGDKWKVSWKWKNDSLILKNTVTMYALNPDL*RDCETEVS------WLTPMKSDGLVVLPLLTTFYENK 1279
            V ID  + +A F  +KW +SWKW+    +LKN V  YA+ P++ ++ E +V       WL     D   +L LL T  + +
Sbjct:   30 VTIDDENLKASFGREKWSLSWKWRYKPTLLKNHVAEYAVEPEIRQEFEQKVERWIKEDWLITANDDDRGILYLLATVQQKR 110          
The following BLAST results are available for this feature:
BLAST of SMED30034212 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235341181.349e-2230.71tr|A0A210QW55|A0A210QW55_MIZYE Testis-expressed se... [more]
gnl|BL_ORD_ID|239078531.304e-2033.90tr|K1R2Q7|K1R2Q7_CRAGI Uncharacterized protein C13... [more]
gnl|BL_ORD_ID|203424691.919e-1725.59tr|A0A1S3KEW0|A0A1S3KEW0_LINUN testis-expressed pr... [more]
gnl|BL_ORD_ID|225656432.299e-1730.82tr|A0A2C9L3Y7|A0A2C9L3Y7_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|206189763.185e-1726.90tr|A0A0B7A6F2|A0A0B7A6F2_9EUPU Uncharacterized pro... [more]
back to top
BLAST of SMED30034212 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000036119.12.071e-1129.85testis expressed 26 [Source:NCBI gene;Acc:11119216... [more]
ENSAMXT00000045460.12.193e-1129.85testis expressed 26 [Source:NCBI gene;Acc:11119216... [more]
back to top
BLAST of SMED30034212 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO417682.016e-1232.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30034212 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034212 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023080.10.000e+095.81SMESG000023080.1[more]
SMESG000053534.13.017e-2743.38SMESG000053534.1[more]
SMESG000046229.14.056e-2145.36SMESG000046229.1[more]
SMESG000069076.17.019e-1434.33SMESG000069076.1[more]
SMESG000041830.11.229e-633.33SMESG000041830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034212 ID=SMED30034212|Name=SMED30034212|organism=Schmidtea mediterranea sexual|type=transcript|length=3824bp
GTATTTAGGCTTATTGTAAATACAGATTTTTAAATTCTATTTGTACTTCA
TATTTTTATATTAACACAACCTATTGCAGCAAAGATGGAGCTAGAAAAGT
TCATAAAGCTCAATGATGGAGTAGGTAATATTTCAATGTGGATGATTAAT
TTCAAAATAGTGGCCAAACACCGAAAAATTGATGATTTTGCAAGTGTACT
TCCGCTCCTACTGGATGGTCCCACTTTTCTGGTGTATGATTATCTAGTAG
AGAAAGATCAAGGATCCTTTATTGCTATCGAGAATACCCTAGTGAAAGCA
TTTTTAATGGACGGTTACCAGACGTACGAAAAATTTCGTTCAAGTATATG
GAACAACGAGCCAATTGATGTGTACTTAGCTGACCTACAGTGATTCGCAA
CTTTAACTGGAACACAAGATGAAGCACTGTTGAAAAGAGGTTTTATTGTA
GGCCTACCTCTGTCGTATTACAACAATTCAAAGCTTCTATCAAAATCAAG
AAAATGGTTCTCTCAGAGACAGGCTCGAGCACTTATTTAGAAGCAACAAG
AATCAGTAGGGCTAGTGCTTCAAAGTTACGGTACGTCAGTGAGAAAGTGC
AATTTAAACGTACCATTAGTGTAGGAAATTTGGTCACTACAAAAAGAATT
TCCTCTCAAAGAATGTTGATAATGTGGAGCCAAAGGTCACAAGTAAAAAC
GTTGTTCTCCTTTTGCAACGGGAAATGGGCTGCGAGAGCCTGATGCGATA
GGAGTTTCTCGCTAAAAGACAGGTTGAGTTGAAAGTGTAGGGTAAGTGCT
GTATAGGTTCAGTATATGCTCTCGCACGATAGTTTCCAATAAATTGGCAA
AAAATGCTACTGAATTCAAGAATGTGCTTGCAGTAGATGGACAGAGAGTG
CGTTGTGATTGGGAGATGTTCAATATAAACTGTTCGGTCAAGAAATGTCA
TTTAGATTAAAATACCTGATGATGCTAAATCTTGTAGATGGTATAAATGT
CGTATTCGGTCTCGATGCTGTTGGGCATTTCGAAAGGGGTTTCAATAAAA
TAATGTAATTATAGATGCTAATGATTTCAGAGCTATATTCGATGGAGATA
AATGGAAAGTGTCATGGAAATGGAAAAACGATTCTCTTATTTTGAAAAAC
ACAGTCACCATGTACGCACTAAACCCAGATCTATGACGTGATTGTGAAAC
TGAAGTAAGTTGGCTAACTCCAATGAAAAGTGATGGACTCGTCGTTCTGC
CCTTACTGACTACTTTTTATGAGAATAAATGGGAGGTTCACCTGGTCCTC
AACTTTAGAGAAAACACTAGCGTAAAACCTCACACGAGCGACAGTGACGT
TTTCGAGGAAAGTGAATAAGATGGCATCATATGAGTGACGATATTGTAGT
TGTTGATTTAAAAAACACTTTTTGAAGCTGCACATAAGTAAAGAATTATG
GAGATATCAATAGGTTCGCTATTAAGGTCGGTTTAAAGAGATAAAGTTTG
ATTTAAACTGTGCTCCTAGATAATATTTTCGATTCCTAGGAAGGTGTTGA
GACTCAATGCAACAATTCATCAAGTCACCAATAATTAAATTGACGACATC
GGTGTCAATACAAAGCGGGACATTGCTGTAAATTGCCTACTGAAAATTCA
AATGTTCTCGGACTTAAAATAAAACGAAATCAAGATGATCGCCTAGGCAC
GATAATGAAGGACAGTCAAGGAGACAGAAGAGGGAGACAAAACCCATAAG
AACCCAAAAGAAGTCTGCTTATCTTGATCAATAGACTCACGAGGGAATAT
TTTCAAATTCTACTCGTGCTTCATATTATAGCAATATTAAAACAAGAACG
GATAAACGAAAATCTTCTCAAATTCTCATTGGATAAATTAACAAAAAAAA
TAGAATTTTTTAAAGAATTTTATTCCAATTTTCCATATTAAATTTAATCT
TTGACAGAAATAATTTACAGCAGAAAAGTTGACATCCAACTCACAATTGA
AAGAATTTACGCTGAAATATTTATTATTTTCTCGGGAAAAAAAGTAATTG
AATAATTAGACAAGAAAGCACACAAAACAAAGATTTATTAATAATATATA
AAGAGGTGAGAATTTTTTGTTTATTTGAACTGGTGAGCTTGAAGCAAAAA
AGAAAATGATGTTTCTGAGATAAAAAATATATAACAAAAAATAATGATAT
AAAATTATATAACAAGTAATTGAGAGAATATCATCACCGGTTGTCATAGT
AACAGGTATTGCTAGTATTTAGTATTTATAATTAATTTTACCGACAAATT
TTTCATATTTGTTCAATCAACATCATTGTCTGTGTGCTATTGTTTGTTGA
CAAACATCTAATTGGTGTCATTTCAGAATTCATTCATTAAAACACTGAGA
TGACTTCTGCAACGATCATTCCAATAGATTTCCTGTCTGGGAGAGATTTA
CAAATTATGCATCCGCAACAAATCGTATAAGATTTTGGTTTTTTTTATTC
CAATTATTGAAGGGTTTTTTTTGTCCTACAGATCGTAGCCAAATCATTCA
TCAAGCCAGGATTGAAAGATTCGCTGGAGAATTTCATTTTGTCGTCGAAT
AAACAAAAGGATCGCGAGAAAGCTTTGGAAATTTTGGCATCAATTGATGA
TTACAATAAACGTTTCTGTAATAATAATAATCTAGTCAAAGAATATAAGT
TAAAATCGACTCTCCAGAGACCTAAATCAGCTTGTACTAAACTAAAAGAC
GGTTCCTTCATCAATTCTTTTTCTACCGCGTATTCCGAAGATTACCCAAA
GAAGCCAATAAAGGAAACGATAGCCAACAGACCTCCATCAACTGAACACA
TGATTGCACGTCCAAGCACTACATCGGAAAGGAATCATAAAACAGAATAT
TCTGAAGACGGTCCTTCCGAAAAGATATTAAAATCATATTCCGTTTATGA
TCAGCGCACAACTTACGCAAATGATTATTGCGTCGAAGATCCAACAGGGA
TCAAAATATCTCCACGGCCTCCAAATCGTGCTGCAACTGCTAGTGGTGAA
AGGTGTAACAATCCCCACCCCAGCAAGGCATTTTTAGTATGGCGATTTCC
TCGCGAATCAGTAAATAAAACGACGAGAATTCCCAGCGCAACTGCTCTTA
AGGCAAATATGGAAAACAACTTCGCCCAAATCACTGATGAACAGTTCAAT
CGAGTCATGCGTGGAAATTGTCGGAGCACATATCAGTCAGATTTTCGGGG
TGGCGCTATCCCAAATGATCAATTTTCTCCATTTTATCTTCAACCAGAAC
TAAAAACCGGCCAAAAGCTCAAAATTTCTACTCAACGAATAGATTACGGT
AGGCCATCGTCACTTCCTATAGAATTGAGTGTTCCGAAAAACCGATACAG
CTCCAATAAAGTTAAAAGCCAACAGACAAAAGGAATAATTCCTCAAGTAA
CAAATAAGACCTACATGAATACGTTTACGAGAACTACATATGATGAAGAT
ATTAATGATCGTGCAAAGGTTATGCATGGACAAATAGTGGATGACATTCA
GAAAAAAGTAGATTTGAGTCGACTTCACAACATGAAAGATTTAGAAAGAG
CAATGATAGAAACTGCCAATATCACAGACCAAGATACCTTACAGCGTGTA
TTTCAAAAACTAAACGAACCAGAAAGTTATAAAAGAATAAGTTTTGTCCG
TAAACCTTTTTATCATTCAGATAAAATGAGATGGTTATCCAGTTATCCAG
GTCCATTATAAATATGTACCAATTGAACGTTTTATTTATGCATTTTATCC
TCATGCTATATTAGATGATTTCCT
back to top

protein sequence of SMED30034212-orf-1

>SMED30034212-orf-1 ID=SMED30034212-orf-1|Name=SMED30034212-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MIARPSTTSERNHKTEYSEDGPSEKILKSYSVYDQRTTYANDYCVEDPTG
IKISPRPPNRAATASGERCNNPHPSKAFLVWRFPRESVNKTTRIPSATAL
KANMENNFAQITDEQFNRVMRGNCRSTYQSDFRGGAIPNDQFSPFYLQPE
LKTGQKLKISTQRIDYGRPSSLPIELSVPKNRYSSNKVKSQQTKGIIPQV
TNKTYMNTFTRTTYDEDINDRAKVMHGQIVDDIQKKVDLSRLHNMKDLER
AMIETANITDQDTLQRVFQKLNEPESYKRISFVRKPFYHSDKMRWLSSYP
GPL*
back to top

protein sequence of SMED30034212-orf-2

>SMED30034212-orf-2 ID=SMED30034212-orf-2|Name=SMED30034212-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MELEKFIKLNDGVGNISMWMINFKIVAKHRKIDDFASVLPLLLDGPTFLV
YDYLVEKDQGSFIAIENTLVKAFLMDGYQTYEKFRSSIWNNEPIDVYLAD
LQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 9..23
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 50..69
NoneNo IPR availablePANTHERPTHR33769FAMILY NOT NAMEDcoord: 30..245
NoneNo IPR availablePANTHERPTHR33769:SF2coord: 30..245