corticotropin-releasing factor receptor

Overview
Namecorticotropin-releasing factor receptor (AFD34361.1)
Smed IDSMED30034211
Length (bp)1584
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of corticotropin-releasing factor receptor (SMED30034211) t-SNE clustered cells

Violin plots show distribution of expression levels for corticotropin-releasing factor receptor (SMED30034211) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of corticotropin-releasing factor receptor (SMED30034211) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for corticotropin-releasing factor receptor (SMED30034211) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034211

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034211SMESG000049048.1 SmedASXL_080137SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034211SMESG000049048.1 dd_Smed_v4_26221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034211SMESG000049048.1 dd_Smed_v4_26221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034211SMESG000049048.1 dd_Smed_v4_26221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034211SMESG000049048.1 dd_Smed_v4_26221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034211SMESG000049048.1 dd_Smed_v6_26221_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 172.94 bits (437), Expect = 6.391e-48
Identity = 124/375 (33.07%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRI--LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        V V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 172.94 bits (437), Expect = 6.391e-48
Identity = 124/375 (33.07%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRI--LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        V V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:1394])

HSP 1 Score: 172.94 bits (437), Expect = 6.391e-48
Identity = 124/375 (33.07%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRI--LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        V V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Match: CRHR2 (corticotropin releasing hormone receptor 2 [Source:HGNC Symbol;Acc:HGNC:2358])

HSP 1 Score: 161.384 bits (407), Expect = 8.302e-44
Identity = 114/374 (30.48%), Postives = 184/374 (49.20%), Query Frame = 3
Query:  192 EYCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---VNGRHEEINL---VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
             YC    D +  CWP + AG     PCP  F+G +Y++  NA R+C  +G+W A+K NY+ C   ++ +  + +L   + + ++  G+ +S+  L +A  LF   ++++C RN IH +L + FILR+  + +L ++    H    +    + +   +  +  F WM +EG YL   I  TY   RLR   F  IGW  P  +  A  +  ++      W  +     +DY    PII +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++
Sbjct:   24 SYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTW-ASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHRWQD 365          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Match: CRHR2 (corticotropin releasing hormone receptor 2 [Source:HGNC Symbol;Acc:HGNC:2358])

HSP 1 Score: 160.999 bits (406), Expect = 1.742e-43
Identity = 114/374 (30.48%), Postives = 184/374 (49.20%), Query Frame = 3
Query:  192 EYCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---VNGRHEEINL---VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
             YC    D +  CWP + AG     PCP  F+G +Y++  NA R+C  +G+W A+K NY+ C   ++ +  + +L   + + ++  G+ +S+  L +A  LF   ++++C RN IH +L + FILR+  + +L ++    H    +    + +   +  +  F WM +EG YL   I  TY   RLR   F  IGW  P  +  A  +  ++      W  +     +DY    PII +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++
Sbjct:   38 SYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTW-ASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWHRWQD 379          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 89.3521 bits (220), Expect = 1.032e-18
Identity = 100/417 (23.98%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  141 CRKEHFNRSLFYQDNNIE---YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEI--------NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII------------TPSGHPLRILQIV----LMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------WMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARR---PLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK-----VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C+K   + +LF + +  +   +C A +D V+CWPPT A     L CPH   G   D N    ++C   G W   K          +N+  C    +E+         N   +   G  LS++ L  A+ +F +F+ L+  RN +H HL  A ++     LVL+I             +  G  +  + IV               F WM +EG+YL   I + +     +   + I G+G P+  T    L  +      +       ++    +  D P +  L++N   +  +I  L  K+R        G++KSVK                                  A ++L+PLLG   I+    + P      V  ++TY  +     QG MVA IYCF N EV  +++
Sbjct:   52 CKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGL--DPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVK----------------------------------AAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLK 431          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 89.3521 bits (220), Expect = 1.032e-18
Identity = 100/417 (23.98%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  141 CRKEHFNRSLFYQDNNIE---YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEI--------NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII------------TPSGHPLRILQIV----LMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------WMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARR---PLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK-----VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C+K   + +LF + +  +   +C A +D V+CWPPT A     L CPH   G   D N    ++C   G W   K          +N+  C    +E+         N   +   G  LS++ L  A+ +F +F+ L+  RN +H HL  A ++     LVL+I             +  G  +  + IV               F WM +EG+YL   I + +     +   + I G+G P+  T    L  +      +       ++    +  D P +  L++N   +  +I  L  K+R        G++KSVK                                  A ++L+PLLG   I+    + P      V  ++TY  +     QG MVA IYCF N EV  +++
Sbjct:   52 CKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGL--DPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVK----------------------------------AAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLK 431          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 89.3521 bits (220), Expect = 1.200e-18
Identity = 100/417 (23.98%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  141 CRKEHFNRSLFYQDNNIE---YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEI--------NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII------------TPSGHPLRILQIV----LMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------WMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARR---PLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK-----VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C+K   + +LF + +  +   +C A +D V+CWPPT A     L CPH   G   D N    ++C   G W   K          +N+  C    +E+         N   +   G  LS++ L  A+ +F +F+ L+  RN +H HL  A ++     LVL+I             +  G  +  + IV               F WM +EG+YL   I + +     +   + I G+G P+  T    L  +      +       ++    +  D P +  L++N   +  +I  L  K+R        G++KSVK                                  A ++L+PLLG   I+    + P      V  ++TY  +     QG MVA IYCF N EV  +++
Sbjct:   52 CKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGL--DPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVK----------------------------------AAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLK 431          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 89.3521 bits (220), Expect = 1.200e-18
Identity = 100/417 (23.98%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  141 CRKEHFNRSLFYQDNNIE---YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEI--------NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII------------TPSGHPLRILQIV----LMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------WMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARR---PLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK-----VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C+K   + +LF + +  +   +C A +D V+CWPPT A     L CPH   G   D N    ++C   G W   K          +N+  C    +E+         N   +   G  LS++ L  A+ +F +F+ L+  RN +H HL  A ++     LVL+I             +  G  +  + IV               F WM +EG+YL   I + +     +   + I G+G P+  T    L  +      +       ++    +  D P +  L++N   +  +I  L  K+R        G++KSVK                                  A ++L+PLLG   I+    + P      V  ++TY  +     QG MVA IYCF N EV  +++
Sbjct:   52 CKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGL--DPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVK----------------------------------AAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLK 431          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 88.9669 bits (219), Expect = 1.565e-18
Identity = 100/417 (23.98%), Postives = 162/417 (38.85%), Query Frame = 3
Query:  141 CRKEHFNRSLFYQDNNIE---YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEI--------NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII------------TPSGHPLRILQIV----LMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------WMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARR---PLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK-----VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C+K   + +LF + +  +   +C A +D V+CWPPT A     L CPH   G   D N    ++C   G W   K          +N+  C    +E+         N   +   G  LS++ L  A+ +F +F+ L+  RN +H HL  A ++     LVL+I             +  G  +  + IV               F WM +EG+YL   I + +     +   + I G+G P+  T    L  +      +       ++    +  D P +  L++N   +  +I  L  K+R        G++KSVK                                  A ++L+PLLG   I+    + P      V  ++TY  +     QG MVA IYCF N EV  +++
Sbjct:   52 CKKMLDHNNLFPERDPNDTRIWCNATYDTVLCWPPTPANSSVTLQCPH-MKGL--DPNKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAGLKKSVK----------------------------------AAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLK 431          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 169.474 bits (428), Expect = 1.731e-46
Identity = 125/385 (32.47%), Postives = 181/385 (47.01%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---------VNGRHEEINLVG-VFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASF---LVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHD------------LWMRQ--LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C + FD V+CWP T AG  A+LPC   F G  YD+ DNATR C  +G+W  + S+Y+ C         V      + L   ++  GY LS   L  AL +F  FK L+C RN IH +LF  +I  +  +   L L +IT        + +V+M     +L  F WM +EGLYL+ L+  T+    +    +A+IGWG P       ++   F +PH              WMR+  +D+   +P    L++N + ++ I+  L+ KLR+   L  +                               +Y KA KA LVL+PL G  Y++ +T     + + LF  + A   STQGF VAL YCF N EVR+ +R     WRE  N
Sbjct:   84 CPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWD-HYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYF-YLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAF-APHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETR-------------------------------QYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRN 434          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0113075)

HSP 1 Score: 169.474 bits (428), Expect = 1.799e-46
Identity = 125/385 (32.47%), Postives = 181/385 (47.01%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---------VNGRHEEINLVG-VFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASF---LVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHD------------LWMRQ--LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C + FD V+CWP T AG  A+LPC   F G  YD+ DNATR C  +G+W  + S+Y+ C         V      + L   ++  GY LS   L  AL +F  FK L+C RN IH +LF  +I  +  +   L L +IT        + +V+M     +L  F WM +EGLYL+ L+  T+    +    +A+IGWG P       ++   F +PH              WMR+  +D+   +P    L++N + ++ I+  L+ KLR+   L  +                               +Y KA KA LVL+PL G  Y++ +T     + + LF  + A   STQGF VAL YCF N EVR+ +R     WRE  N
Sbjct:   84 CPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWD-HYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYF-YLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAF-APHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLETR-------------------------------QYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRN 434          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Match: Dh44-R1 (gene:FBgn0033932 transcript:FBtr0087485)

HSP 1 Score: 160.999 bits (406), Expect = 4.444e-43
Identity = 130/416 (31.25%), Postives = 199/416 (47.84%), Query Frame = 3
Query:   87 MLNTSNFNFLGTINRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN-GRHEEINLVGVFIS--------GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAH---LAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFP----MALTSANTLYNIFTSPHDL-----WMRQ--LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            +L+  N + +G     Q   +EH   S +  D+   +C   FD ++CWP T  G  A+L C     G  YDS+ NATR C  +G+W    +NY++C +    E +    V +         GY LS++ L  AL +F +FK L+C RN IH +LF  +I+ SA F +L +         +   + +I+ L H   L  F WML+EGLYL+ L+  T+    LR   +A IGWG P    +    A +L   +++P        WM++  +D+    P+  +LI+N   +L I+  L+ KLR+   +  +                               +YRKA KA LVL+PL G  Y++ +        +  +F  L A+  STQGF V+L YCF N EVR  +R  +  WR+
Sbjct:   18 LLDLHNLDGIGESVELQCLVQEHIEASTYGNDSG--HCLTQFDSILCWPRTARGTLAVLQCMDELQGIHYDSSKNATRFCHANGTW-EKYTNYDACAHLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIM-SALFWILLLSVQISIRSGVGSCIALIT-LFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTVETR-------------------------------QYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNSEVRNALRHHISTWRD 397          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0070436)

HSP 1 Score: 108.612 bits (270), Expect = 1.220e-24
Identity = 104/399 (26.07%), Postives = 171/399 (42.86%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEINLV-------------------GVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII--------TPSGHPLRIL-------QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSA----NTLYNIFTSPHDLWMRQLD---YFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIF-ITHYHPKVKF-LFTYLNAMFTSTQGFMVALIYCFQNIEVRKLV 1232
            YC   +D ++CWPPT AG  A + CP  F G   D+   A R+C  DG W +            ++Y  C   + E I L+                    + I G  LS+  L  +L +FC F++L+  R  IH +LF A +L+    L L++           +   L ++       +   ++   A  A+F WM IEGLYL  ++           + F+ +GW  P+ +T+       +Y   +    LW   L    +  + P + ++++N   ++ II  LV+KLR  +   I+++                               RKA++A +VL+PLLG   ++  +        F +++Y     TS QGF +ALIYCF N EVR ++
Sbjct:  146 YCNWTWDTLLCWPPTPAGVLARMNCPGGFHGV--DTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCY--KPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQT-------------------------------RKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVL 509          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0308565)

HSP 1 Score: 108.612 bits (270), Expect = 1.377e-24
Identity = 104/399 (26.07%), Postives = 171/399 (42.86%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANK----------SNYNSCVNGRHEEINLV-------------------GVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFII--------TPSGHPLRIL-------QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSA----NTLYNIFTSPHDLWMRQLD---YFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIF-ITHYHPKVKF-LFTYLNAMFTSTQGFMVALIYCFQNIEVRKLV 1232
            YC   +D ++CWPPT AG  A + CP  F G   D+   A R+C  DG W +            ++Y  C   + E I L+                    + I G  LS+  L  +L +FC F++L+  R  IH +LF A +L+    L L++           +   L ++       +   ++   A  A+F WM IEGLYL  ++           + F+ +GW  P+ +T+       +Y   +    LW   L    +  + P + ++++N   ++ II  LV+KLR  +   I+++                               RKA++A +VL+PLLG   ++  +        F +++Y     TS QGF +ALIYCF N EVR ++
Sbjct:  215 YCNWTWDTLLCWPPTPAGVLARMNCPGGFHGV--DTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCY--KPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQT-------------------------------RKAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVL 578          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Match: crhr1 (corticotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-081231-1])

HSP 1 Score: 171.4 bits (433), Expect = 1.899e-47
Identity = 122/376 (32.45%), Postives = 185/376 (49.20%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            +C    DG+  CWP + AGE    PCP +F G  Y++ +N  R+C  +G+W A K NY+ C    +EE        + V I+  G+ +S+  L  A  LF   ++++C RN IH +L +AFILR+A+ F+V   + P  H   ++  ++V       H+  F WM  EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:   58 FCNTSIDGIGTCWPRSSAGEVVSRPCPESFLGVRYNTTNNVYRECLANGTW-AKKGNYSQCQEILNEEKKSKLHYHIAVIINYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVVQLTMNPEVHESNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKRAGIYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 401          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Match: pth3r (parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-12])

HSP 1 Score: 138.658 bits (348), Expect = 8.234e-35
Identity = 114/405 (28.15%), Postives = 183/405 (45.19%), Query Frame = 3
Query:  123 INRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTA------NKSNYNSCVNGRH------EEI--NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFL----VLFIITPSGH-PLRILQIVLMISRLAHLAIF--------HWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLW---MRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF----TYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            I  R  C +    +S   ++NN   C   +DG++CWP  +  +   + CP     ++++    A R C   G+W          +NY  C    H      EE+   L  ++  GY++S+  L  A+ + C+FK L CTRN+IH HLF++FI R+ S      VL+ +T  G      ++   M+   A + +F        +W+L+EGLYL  LI+  +   +       IIGWG P    S      +  +    W      L +   +PI+  +++N  + L II  L  KL        + +  + + P Q                    +YRK +K+T+VLMPL G +Y++F+   +  V  L      +   +F S+QGF VA IYCF N EV+  V+
Sbjct:   39 IGARSRCERTIRAQSDVVRENN---CAPEWDGIICWPTGKPNQMVAVLCPEYI--YDFNHRGYAYRHCDASGNWEQVSIINRTWANYTECTTYLHTNHSDQEEVFERLYLMYTIGYSISLAALLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAISIFVKDAVLYAVTNDGELEDGAVEQRPMVGCKAAVTLFLYLLATNHYWILVEGLYLHSLIFMAFLSDKNCLWALTIIGWGIPAVFVSIWVSARVSLADTQCWDISAGNLKWIYQVPILAAIVVNFFLFLNIIRVLASKLW-------ETNTGKLD-PRQ--------------------QYRKLLKSTMVLMPLFGVHYMLFMALPYTDVTGLLWQIQMHYEMLFNSSQGFFVAFIYCFCNGEVQAEVK 410          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 136.732 bits (343), Expect = 2.588e-34
Identity = 115/397 (28.97%), Postives = 183/397 (46.10%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWT----ANKS--NYNSCV--------NGRHEEIN-LVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQ---------------------------IVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSA-----NTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF----TYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C   +DG++CWP    G+     CP     ++++   +A R+C  +G+W      NK+  NY+ C         N   E  + L  ++  GY++S+  L  A  +  +F+ L CTRN+IH HLF +F+LR+ S  V  ++  SG  L+ ++                           + L +  LA    ++W+L+EGLYL  LI+ T+   R     F +IGWG P    +       TL +  T   DL    L +   IPI+T +++N ++ L II  L  KLR                   ++  C+              +YRK +K+TLVLMPL G +YI+F+   + +V  +      +   +F S QGF VA+IYCF N EV+  ++
Sbjct:   38 CLPEWDGILCWPEGVPGKMVSTSCPEYI--YDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLA--TNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLAD--TECWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLR-----------------ETNAGRCDTRQ-----------QYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 400          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 136.732 bits (343), Expect = 3.123e-34
Identity = 115/397 (28.97%), Postives = 183/397 (46.10%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTA----NKS--NYNSCV--------NGRHEEIN-LVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQ---------------------------IVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSA-----NTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF----TYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C   +DG++CWP    G+     CP     ++++   +A R+C  +G+W      NK+  NY+ C         N   E  + L  ++  GY++S+  L  A  +  +F+ L CTRN+IH HLF +F+LR+ S  V  ++  SG  L+ ++                           + L +  LA    ++W+L+EGLYL  LI+ T+   R     F +IGWG P    +       TL +  T   DL    L +   IPI+T +++N ++ L II  L  KLR                   ++  C+              +YRK +K+TLVLMPL G +YI+F+   + +V  +      +   +F S QGF VA+IYCF N EV+  ++
Sbjct:   63 CLPEWDGILCWPEGVPGKMVSTSCPEYI--YDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLA--TNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLAD--TECWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLR-----------------ETNAGRCDTRQ-----------QYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 425          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Match: ghrhr2 (growth hormone releasing hormone receptor 2 [Source:ZFIN;Acc:ZDB-GENE-121214-194])

HSP 1 Score: 134.035 bits (336), Expect = 4.464e-34
Identity = 105/372 (28.23%), Postives = 173/372 (46.51%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVG-----------VFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFL----VLFIITPSGH---PLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLD--YFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFI---THYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRL 1244
            C   +DGV CWP    GE+  + CP         S++  +R C++ G    +   Y +C      E   +G           ++  GY +S+  LC A+F+FC F+ L CTR +IH +LFS FILR+ +      VLF      H      + +  +   +   L+ F+W+L+EGLYL  L+ +T+  +R     + ++GWG P    +  T        +  W   LD  ++  I I  ++ +    ++FI  + ++ ++ + P               DS+G +K         RF   YR+  K+TL+L+PL G +YI+F     H   + +  F  +   F   QGF+VAL+YCF N EV+  +R  +
Sbjct:   52 CLVEWDGVNCWPAVSVGERVSVSCPPLLK-----SHELISRTCTSKGWSNMSVPYYTACFQDNSTEEEEIGHISEYFARVKLIYTVGYGMSLSSLCIAVFIFCIFRKLLCTRIYIHLNLFSTFILRALAVFVKDAVLFADETVNHCTVSTVLCKASVTFFQYCVLSNFYWLLVEGLYLQTLLTFTFAHKRTFFWCYTLVGWGTPSVTVTIWTFLKYSYDDYGCW-DDLDSGFWWIIKIPILISVLVNFLMFINISRIIIVKTKTP---------------DSNGGDK---------RF---YRRLAKSTLLLIPLFGVHYIVFALFPEHVGLEARLFFELVLGSF---QGFIVALLYCFLNSEVQNEIRKEI 387          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 165.236 bits (417), Expect = 2.099e-45
Identity = 120/385 (31.17%), Postives = 188/385 (48.83%), Query Frame = 3
Query:  165 SLFYQDNNIEYCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFIS------GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVL-FIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYII-FITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            SL    NN   C A  D +  CWP T AG+    PCP  F G +Y++  N  R+C  +GSW A + +Y  C     +E   V   I+      G+++S+  L  A  LF   ++++C RN IH +L +AFILR+ ++ V+   ++   H   ++  ++V +     ++  F WM  EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W  +      D+    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++ F+T    ++ + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:    6 SLHLLSNNCLACNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSW-AGRGDYTQCQEILKQEKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWFVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 358          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 161.77 bits (408), Expect = 8.583e-44
Identity = 116/374 (31.02%), Postives = 184/374 (49.20%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFIS------GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVL-FIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYII-FITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP T AG+    PCP  F G +Y++  N  R+C  +GSW A + +Y  C     +E   V   I+      G+++S+  L  A  LF   ++++C RN IH +L +AFILR+ ++ V+   ++   H   ++  ++V +     ++  F WM  EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W  +      D+    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++ F+T    ++ + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:   56 CNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSW-AGRGDYTQCQEILKQEKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWFVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 397          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 160.999 bits (406), Expect = 1.680e-43
Identity = 117/376 (31.12%), Postives = 186/376 (49.47%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEE--------INLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVL-FIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYII-FITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP T AG+    PCP  F G +Y++  N  R+C  +GSW A + +Y  C     +E        I +V  F+ G+++S+  L  A  LF   ++++C RN IH +L +AFILR+ ++ V+   ++   H   ++  ++V +     ++  F WM  EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W  +      D+    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++ F+T    ++ + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:   44 CNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSW-AGRGDYTQCQEILKQEKKTKVHYHIAIVINFL-GHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWFVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 158.303 bits (399), Expect = 1.598e-42
Identity = 116/373 (31.10%), Postives = 183/373 (49.06%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCV----NGR----HEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC A  D +  CWP + AG     PCP +F+G  Y++  + TR+C  +G+W A+  NY+ CV    N R    H +I L+  ++ G+ +S++ L  A  LF   ++++C RN IH +L + FILR+  + +L +I    H    +    + +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +     +  +F      W+     + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR   R R   W++
Sbjct:   42 YCSATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTW-ASWMNYSQCVPILDNKRKYALHYKIALIINYL-GHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQD 381          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 157.918 bits (398), Expect = 1.732e-42
Identity = 116/373 (31.10%), Postives = 183/373 (49.06%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCV----NGR----HEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC A  D +  CWP + AG     PCP +F+G  Y++  + TR+C  +G+W A+  NY+ CV    N R    H +I L+  ++ G+ +S++ L  A  LF   ++++C RN IH +L + FILR+  + +L +I    H    +    + +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +     +  +F      W+     + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR   R R   W++
Sbjct:   45 YCSATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTW-ASWMNYSQCVPILDNKRKYALHYKIALIINYL-GHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQD 384          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Match: Crhr1 (corticotropin releasing hormone receptor 1 [Source:MGI Symbol;Acc:MGI:88498])

HSP 1 Score: 174.481 bits (441), Expect = 1.143e-48
Identity = 123/375 (32.80%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        + V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 155.992 bits (393), Expect = 8.205e-42
Identity = 109/373 (29.22%), Postives = 184/373 (49.33%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---VNGRHEEINL---VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC    D +  CWP +  G     PCP  F+G +Y++  NA R+C  +G+W A++ NY+ C   ++ +  + +L   + + ++  G+ +S++ L +A  LF   ++++C RN IH +L + FILR+ ++ +L +I    H    +    + +   +  +  F WM +EG YL   I  TY    LR   F  IGW  P  +  A  +  ++      W  +     +DY    P++ +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++
Sbjct:   39 YCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTW-ASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQD 379          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 155.992 bits (393), Expect = 8.940e-42
Identity = 109/373 (29.22%), Postives = 184/373 (49.33%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC---VNGRHEEINL---VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC    D +  CWP +  G     PCP  F+G +Y++  NA R+C  +G+W A++ NY+ C   ++ +  + +L   + + ++  G+ +S++ L +A  LF   ++++C RN IH +L + FILR+ ++ +L +I    H    +    + +   +  +  F WM +EG YL   I  TY    LR   F  IGW  P  +  A  +  ++      W  +     +DY    P++ +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++
Sbjct:   59 YCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTW-ASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQD 399          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 155.221 bits (391), Expect = 1.446e-41
Identity = 111/373 (29.76%), Postives = 180/373 (48.26%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC    D +  CWP +  G     PCP  F+G +Y++  NA R+C  +G+W A++ NY+ C            H  I L+  ++ G+ +S++ L +A  LF   ++++C RN IH +L + FILR+ ++ +L +I    H    +    + +   +  +  F WM +EG YL   I  TY    LR   F  IGW  P  +  A  +  ++      W  +     +DY    P++ +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++
Sbjct:   39 YCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTW-ASRVNYSHCEPILDDKRKYDLHYRIALIVNYL-GHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQD 378          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 155.606 bits (392), Expect = 1.482e-41
Identity = 111/373 (29.76%), Postives = 180/373 (48.26%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            YC    D +  CWP +  G     PCP  F+G +Y++  NA R+C  +G+W A++ NY+ C            H  I L+  ++ G+ +S++ L +A  LF   ++++C RN IH +L + FILR+ ++ +L +I    H    +    + +   +  +  F WM +EG YL   I  TY    LR   F  IGW  P  +  A  +  ++      W  +     +DY    P++ +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++
Sbjct:   59 YCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTW-ASRVNYSHCEPILDDKRKYDLHYRIALIVNYL-GHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQD 398          
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Match: sp|P35347|CRFR1_MOUSE (Corticotropin-releasing factor receptor 1 OS=Mus musculus OX=10090 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.992e-48
Identity = 123/375 (32.80%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        + V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Match: sp|P35353|CRFR1_RAT (Corticotropin-releasing factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.974e-47
Identity = 124/375 (33.07%), Postives = 185/375 (49.33%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        V V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  +       W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Match: sp|Q76LL8|CRFR1_MACMU (Corticotropin-releasing factor receptor 1 OS=Macaca mulatta OX=9544 GN=CRHR1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.424e-47
Identity = 124/375 (33.07%), Postives = 186/375 (49.60%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRI--LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C A  D +  CWP + AG+  + PCP  F G  Y++ +N  R+C  +GSW A + NY+ C    +EE        V V I+  G+ +S++ L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V       H+  F WM  EG YL   I  TY   RLR   F  IGWG P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  +R R   W++ ++
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAA-RVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHS 386          
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Match: sp|P35464|DIHR_MANSE (Diuretic hormone receptor OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.352e-46
Identity = 126/402 (31.34%), Postives = 187/402 (46.52%), Query Frame = 3
Query:  135 QNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC----VNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLA----HLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIF------TSPHDL----------WM--RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKF--LFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWR 1256
            + C    FN S    DN   YC A FDG++CW PT     A+  C     G +YD   NA+R C  DG W  N +NY +C     NG   ++  + ++++GY+LS+  L  A+F+F +FK L+C RN IH +L S +IL + S+++  ++       +  Q   MI  +     +L  F WML+EGLYL+ L+  T+    ++ + +  IGWG P    +   +   F      T P  L          WM   Q+D+    P +  L +N   ++ I+  L+ KLR+   L  +                               +YRKA KA LVL+PLLG   ++ +        F   F Y  A+  STQGF VAL YCF N EVR  +R  +  W+
Sbjct:    3 EECLARKFNLS----DN---YCPAYFDGLLCWDPTPWNTLAVQKCFKELYGIQYDDTQNASRLC-LDGVW-HNYTNYTNCTERIANGSPTDVASL-IYLAGYSLSLAVLSLAVFVFLYFKDLRCLRNTIHTNLMSTYILSACSWILNLVLQNWSDESQQDQTSCMILVICMNYFYLTNFFWMLVEGLYLYMLVVETFTAENIKLKVYTTIGWGAPAVFITIWVISRCFVNVLPSTGPDGLAMFPEAKMCIWMHEHQVDWIHKAPALVGLALNLFFLIRIMWVLITKLRSANTLETE-------------------------------QYRKATKALLVLIPLLGITNLLVLCGPSDDSWFAYAFDYTRALMLSTQGFTVALFYCFMNTEVRHAIRYHVERWK 363          
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Match: sp|Q16983|DIHR_ACHDO (Diuretic hormone receptor OS=Acheta domesticus OX=6997 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.292e-45
Identity = 120/404 (29.70%), Postives = 190/404 (47.03%), Query Frame = 3
Query:  120 TINRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN----GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFP--MALTSANTLYNIFTSP--------------HDLWMRQLDYFTDXXXXXXXXXXXXXMLF---IIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVK-FLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWRE 1259
            T+ R++ C       +     +    C   +DGV CWP T AG  A+ PC    +G  YD   NATR C ++G+W  N S+Y  C         E+  +  VF  G+ LS++ +  A+++F +FK L+C RN IH +L + +I   A++++  ++        +  ++ ++    +L  F WM +EGLYLF L+  T+   +++ + + IIGWG P  + +T A   +   T+P              H  WM + DYF  I    ++ + ++ ++F   I+  L+ KL++      Q                               +YRKA KA LVL PLLG  YI+ +      V   +F    A+  S QGF VAL YCF N EV+  +R R+  WRE
Sbjct:   36 TLQRQRACEALMEGDAPDAAPDAPLRCAIAWDGVNCWPETPAGALAVQPCFDELNGIRYDIRQNATRMCYSNGTWR-NYSDYVHCRELVEAESDEDAAMAFVFFVGFCLSLVAIAVAIWIFLYFKDLRCLRNTIHTNLMATYICNDATWIISAVVQEYVENGGLCSVLAVLMHYFYLTNFFWMFVEGLYLFLLVVATFTGEKVKLQIYIIIGWGIPGVIVVTWAIIKHLGKTAPDNAGESHPMVLLIKHCPWMAE-DYFDWIHQAPVITVLAVNLVFLFSIMWVLITKLQSANTAETQ-------------------------------QYRKATKALLVLFPLLGITYILMMQGPMDGVAGHVFRNAQALLLSLQGFTVALFYCFLNTEVQNTLRHRMSRWRE 406          
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Match: H9N4T0 (Corticotropin-releasing factor receptor (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 6.180e-119
Identity = 187/187 (100.00%), Postives = 187/187 (100.00%), Query Frame = 3
Query:  582 GHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF 1142
            GHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF
Sbjct:    1 GHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF 187          
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Match: X2BBW7 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.248e-51
Identity = 124/383 (32.38%), Postives = 191/383 (49.87%), Query Frame = 3
Query:  174 YQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC-----VNGRHEEINLVG--VFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLR-------ILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREG 1262
            + D    YC + +D V CWP T AG+ A+L CP  F+    D N NATR C  +G+W   +S+Y+ C     VN   +  N +   ++  G+  SI+ L  AL +F +F++L+C RN IHCHL   FI +   +L++  + P             + +I++ +     +A F WML+EGLYL  +I W + + R+R  ++A++GW  P  +  A  +          W+       DY    PI+ +L++N I +  I+  L+ KLRA   L  +                               +YRKA++ATL+L PLLG  Y++FI+  +     K  F Y NA+  S QG  +A+ YCF N EVR  +RGR+  W+EG
Sbjct:    2 FTDAGQLYCNSTWDTVSCWPTTPAGQLAVLTCPPRFEEVLLDPNGNATRMCYPNGTWQF-RSDYDHCKPITMVNKEEDIHNFITRVIYYVGFTTSIVALIVALCIFLYFRSLRCLRNTIHCHLIVTFIFKYILWLIMNNVLPKLTDDDHNEIHQWVCKIIVALYNYIQVANFFWMLVEGLYLHTMIVWAFSIERIRFWYYAVLGWCGPALVVLAWAIVKAKFENRRCWLPMENSSYDYIYITPILGVLLVNVIFLGSIVWVLITKLRASNTLQAR-------------------------------QYRKAVRATLILFPLLGVTYVVFISPPNDGALAKRAFVYFNAILQSLQGLAIAVFYCFLNGEVRSTIRGRVSRWQEG 352          
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Match: A0A411JKC8 (DH44 receptor OS=Aedes aegypti OX=7159 GN=AAEL008287 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.172e-51
Identity = 127/379 (33.51%), Postives = 192/379 (50.66%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGV----FISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL-------------WMRQ--LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKV-KFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            C   FD ++CWP T +   A+LPC   F G  YD+  NATR C +DG W  N S+Y +C +      ++V V    + SGY +S++ L  A+ +F +FK L+C RN IH +LF  +IL +  ++++  +  SG    I   V++++ L +  +  F WML+EGLYL+ L+  T+    LR   ++IIGWG P+    A  +   F  P+DL             WMR+  +D+    P   +L++N I +L I+  L+ KLR+   +  +                               +YRKA KA LVL+PLLG  Y++ I   H  V   +F    A+  STQG +V+L+YCF N EVR  +R     WR+  N
Sbjct:   69 CPVNFDSILCWPKTPSNTWAVLPCFKEFKGVAYDARQNATRYCHSDGKWD-NYSHYTACHHMTEPPPDIVEVTSIIYYSGYIVSLVALSLAVIVFVYFKDLRCLRNTIHANLFITYILSALMWIIILTLQLSGSQSGIASCVILVTLLHYFTLTNFFWMLVEGLYLYMLVVQTFSGDYLRFWKYSIIGWGGPLIFVGAWAIAKSFY-PYDLMPEHPNKLEIECSWMRESHIDWIIQGPSCAVLVINLIFLLRIMWVLITKLRSANTVETR-------------------------------QYRKASKALLVLIPLLGITYLVVIYGPHEGVGSRIFAVTRAVLLSTQGLVVSLLYCFLNYEVRGTLRLHYYRWRDERN 414          
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Match: A0A2U9PG90 (Neuropeptide receptor OS=Diaphorina citri OX=121845 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.786e-50
Identity = 125/407 (30.71%), Postives = 199/407 (48.89%), Query Frame = 3
Query:  126 NRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRH--EEINLVGVFIS------GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL--------------WMRQ--LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            ++   C     N S+    + + YC   +D V+CWPPT+ G  AILPC    +G +YD++ NA++ C+ +GSW +  +NY+ C + +   ++++  G+ I+      GY LS+I L  A+++F +FK L+C RN IH +L   +IL    +++   +  S        I+ +     HL  F WM +EGLYL+ L+  T+    ++ R + +IGWG P+ + +   +   F    D+              WM     D+    P I +L +N + ++ I+  L+ KLR+   +  Q                               +YRKA KA +VL+PLLG  YI+ I      P V  L+ +L A+  STQGF VAL YCF N EV+  +R  L  W+E  N
Sbjct:   16 DKEYECLMNAANDSIVADPSKLHYCPRQWDQVLCWPPTKNGSLAILPCFGELNGIQYDTSQNASKWCNANGSWNS-FANYSLCTDIKKTTQDLSEPGIEITTMIYSVGYTLSLIALIIAVWIFVYFKDLRCLRNKIHTNLMCTYILADFMWILTMTVQMSVQSNFACVILYIFLHYCHLTNFFWMFVEGLYLYMLVVETFTRENIKLRVYFLIGWGAPLVIVTVWAIAKTFAPSSDIQSQGMGDIGLRHCPWMTPHVYDWIYQAPAILVLFINCLFLIMIMWVLITKLRSANTVETQ-------------------------------QYRKATKALVVLIPLLGITYILVIAGPTEGPYVS-LYAHLRAILLSTQGFTVALFYCFLNTEVQNTLRHHLERWKEARN 389          
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Match: A0A0X3NV09 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR88651 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.860e-50
Identity = 103/263 (39.16%), Postives = 156/263 (59.32%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCV------NGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPS--GHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMR--QLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSV 953
            +C +I+DGVMCWPP +       PCP +F+G  Y+S  NATR+C  +G W  N++ Y++C+        R E I L  ++  GY++S+I L  +LF+F  F+ L C RNFIH HL    +LR  +++ L+  T S     + +      I  LA LA+  WM +EGL+L K++YWTYGL R+R  H+A+ GWG P  L  A  ++N    P D+W++  Q  YF  +P + IL  N I+++FI++AL+ +++ R P   Q SV
Sbjct:   42 FCPSIYDGVMCWPPAKPNTIVNFPCPDSFEGATYNSQSNATRRCLANGVW-VNRTEYDNCIWTNTTTPDRDETIYLQTIYCVGYSISLISLLVSLFIFFRFRTLHCLRNFIHTHLMGTLVLRVIAWMTLYGNTSSVGNSTVYLYNATTAIQSLASLAMICWMFLEGLHLLKIVYWTYGLHRIRIWHYAVFGWGLPAVLIVAWAIFNAVQFPDDMWIQHSQEFYFISLPSLIILCCNVIVLVFILYALICRIK-RTPHEPQTSV 302          

HSP 2 Score: 80.1073 bits (196), Expect = 4.309e-12
Identity = 40/77 (51.95%), Postives = 55/77 (71.43%), Query Frame = 3
Query: 1005 RMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            R++ + SR   E  K++KA L+L+PLLG   ++FI  YHP V+ +F Y+NA+  STQGF VALIYCF N EVR ++R
Sbjct:  450 RLANKFSR--SEPMKSLKACLMLIPLLGIPQVVFIVPYHPSVREVFNYINAILISTQGFWVALIYCFLNEEVRLVLR 524          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Match: ENSAMXT00000037591.1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:103036295])

HSP 1 Score: 169.088 bits (427), Expect = 1.281e-46
Identity = 125/396 (31.57%), Postives = 193/396 (48.74%), Query Frame = 3
Query:  159 NRSLFYQDNNIE--------YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC-----VNGRHEEINLVGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRI--LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            NR+++  D + +        +C    DG+  CWP + AGE    PCP    G  Y++ +   R+C  +G+W A+K NY+ C     V  + +    + V I+  G+ LS+  L  A  LF   ++++C RN IH +L SAFILR+A+ F+V   ++P  H   +   ++V  +    H+A F WM  EG YL   I  TY   RL+   F  IGW  P+ +  A     ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:   35 NRTMYSVDPSTQADSNSSGVFCRTSIDGIGTCWPRSMAGEMVSRPCPELLYGVRYNTTNKIFRKCLANGTW-ASKGNYSQCKAILNVQRKSKLHYRIAVIINYMGHCLSLFTLLIAFTLFLRLRSIRCLRNIIHWNLISAFILRNATWFIVQLTMSPDVHESNVPWCRLVTTLYNYFHMANFFWMFGEGCYLHTAIVLTYSTDRLKKWMFICIGWCIPLPIIVAWAFGKLYYDNEKCWFGKRAGVYTDYIYQGPMILVLMINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSQIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 398          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Match: crhr1 (corticotropin-releasing factor receptor 1-like [Source:NCBI gene;Acc:103028117])

HSP 1 Score: 168.703 bits (426), Expect = 1.509e-46
Identity = 121/376 (32.18%), Postives = 185/376 (49.20%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINL-----VGVFIS--GYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSAS-FLVLFIITPSGHPLRIL--QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQ-----LDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            +C    D +  CWP +  GE    PCP TF G  Y+S +N  R+C  +G+W A K++Y+ C+   +EE        + V I+  G+ +S+  L  A  LF   ++++C RN IH +L +AFILR+A+ F+V   + P  H   ++  ++V       H+  F WM  EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W  +      DY    P+I +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ ++
Sbjct:   56 FCNIYTDAIGTCWPKSSVGEVISRPCPDTFHGVRYNSTNNVYRECLDNGTW-ARKADYSQCLEILNEEKKSKLHYHIAVIINYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVVQLTMNPEVHESNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKRAGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHS 399          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Match: ENSAMXT00000045916.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 157.918 bits (398), Expect = 1.117e-42
Identity = 124/420 (29.52%), Postives = 200/420 (47.62%), Query Frame = 3
Query:   87 MLNTSNFN-FLGTINRRQNCRKEHFNRSLFYQDNNIE-------YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            M++T+ F  FLG      NC      +  FYQ++++        YC A  D +  CWP + +G     PCP   +G +Y++  +A R+C  +G+W A K NY+SC            H +I L+  ++ G+ +S+  L  A  LF   ++++C RN IH +L + FILR+  + +L +I  + H        L+ +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W      + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N E+R   R R   W++ + 
Sbjct:    1 MMDTTLFQLFLGEFGE-PNCSLMDAFQDTFYQNSSLTLMSLDGLYCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTW-AFKINYSSCEPILEEKRKYPMHYKIALIINYL-GHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHT 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Match: ENSAMXT00000058121.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 152.14 bits (383), Expect = 1.559e-40
Identity = 113/376 (30.05%), Postives = 181/376 (48.14%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            YC A  D +  CWP + +G     PCP   +G +Y++  +A R+C  +G+W A K NY+SC            H +I L+  ++ G+ +S+  L  A  LF   ++++C RN IH +L + FILR+  + +L +I  + H        L+ +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W      + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N E+R   R R   W++ + 
Sbjct:   44 YCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTW-AFKINYSSCEPILEEKRKYPMHYKIALIINYL-GHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHT 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Match: ENSAMXT00000034852.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 152.14 bits (383), Expect = 1.559e-40
Identity = 113/376 (30.05%), Postives = 181/376 (48.14%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYN 1268
            YC A  D +  CWP + +G     PCP   +G +Y++  +A R+C  +G+W A K NY+SC            H +I L+  ++ G+ +S+  L  A  LF   ++++C RN IH +L + FILR+  + +L +I  + H        L+ +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +  A  +  ++      W      + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N E+R   R R   W++ + 
Sbjct:   44 YCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTW-AFKINYSSCEPILEEKRKYPMHYKIALIINYL-GHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHT 386          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 4.528e-49
Identity = 122/374 (32.62%), Postives = 185/374 (49.47%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCV--------NGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLR--ILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITH--YHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGY 1265
            C A  D +  CWP + AG     PCP  F+G  YDS+ +  R+C  +G+W A +SNY+ C         N +H +I L+  ++ G+ +S+  L +A   F   ++++C RN IH HL + FILR+A++L+L II  S         ++V+ +     +  F WM +EG YL   I  TY   +LR   F  IGW  P  +     +  +F      W      + +DY    PII +L++N I +  I+  L+ KLRA                    S  ++T + S          RKA+KATLVL+PLLG  Y++F  +    P  + +F Y+N+   S QGF V++ YCF N EVR  +R R   W + +
Sbjct:   42 CNATRDEIGTCWPESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTW-AQRSNYSLCKPIIDAKKPNSQHYKIALIVNYL-GHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDLSTQERNEPWCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKSIFVCIGWCIPAPIIIVWAMVKLFYEDEKCWFGKTEGKYIDYIYQGPIILVLLVNFIFLFNIVRILMTKLRA--------------------STTSETIQYS----------RKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWNRWMDNH 383          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.451 bits (389), Expect = 2.128e-42
Identity = 116/374 (31.02%), Postives = 186/374 (49.73%), Query Frame = 3
Query:  195 YCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCV-------NGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGY 1265
            +C A  D +  CWP + A    I PCP  F+G +YD++ +  R+C  D +W A +SNY+ C        N +H ++ LV  ++ G+ +S++ L +A  +F   ++++C RN IH +L + FILR+A++ +L +I  S          ++I+   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +     +  +       W      + +DY    PII +L++N I +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y+N+   S QGF V++ YCF N EVR  +R R   W + +
Sbjct:   12 FCNATRDEIGTCWPSSEASRVVIRPCPDRFNGVQYDTSKSVYRECMADATW-ARRSNYSLCEAIILSKRNSQHYKVALVVNYL-GHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATWFLLQLIDLSTQERNEPWCCIIITIFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWIFICIGWVIPAPIIIIWAMVKLHFEDEKCWFGKTPGKYIDYIYQGPIILVLLINFIFLFNIVTILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAIRKRWHRWLDNH 352          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 144.436 bits (363), Expect = 2.255e-38
Identity = 122/394 (30.96%), Postives = 189/394 (47.97%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW---TANK--SNYNSC-------VNGRHEEI--NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRIL-----------------QIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLR-RLRTRHFAIIGWGFPMAL-----TSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF----TYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAW 1253
            +C A +DG++CWP    G      CP     ++++++ +A R+C ++G+W   TAN+  +NY+ C       V  + +E    L  ++  GY++S+  L  AL +   F+ L CTRN+IH HLF +F+LR+AS  V   +  S + LR+                  ++V+ +        + W+L+EGLYL+ LI+ T+    RL T  FA+IGWGFP+        +  TL N  +   DL    L +    PI+  + +N ++ + I+  L  KLR                        N   + S Q      +YRK +K+TLVLMPL G +Y++F    +  V  L      Y    F S QGF VA+IYCF N EVR  ++     W
Sbjct:   47 HCTAEWDGLICWPWGLPGSMVREKCPSYI--YDFNAHGHAYRKCESNGTWKMSTANRLWANYSECTEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAASIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFLTFSASGRLWT--FALIGWGFPVVFVFVWAAARATLAN--SQCWDLSAGWLKWIYQAPILAAVAVNFVLFVNIVRVLATKLRET----------------------NAARQESRQ------QYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVIGLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMKKLWSRW 406          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.999e-30
Identity = 97/365 (26.58%), Postives = 166/365 (45.48%), Query Frame = 3
Query:  192 EYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW----TANK--SNYNSC----VNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVL-MISRLAHLAI----FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTS--TQGFMVALIYCFQNIEVRKLVR 1235
            ++C   +DG +CW  T AG+ A+  CP  F  F  D  +  T+ C+TDG W     +N+  SNY  C     +     +NL  + ++G+ +SI+ L  +L +F +FK+L C R  +H +LF ++IL S   ++      +   L   + V   + +  H  +    + WML EG+YL  LI       +     + ++GWGFP+     + +        + W+    +                +L+IIH  VV         +   V+         +    THR    +      Y KA++ATL+L+PLLG  +++        V  ++ Y+  +F +   QGF+VA I+CF N EV+  ++
Sbjct:   39 KHCNRTWDGWLCWGDTMAGDVAVQHCPDYFPDF--DLQEKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTIYYDDNCWISSATH----------------LLYIIHGPVVAALLVNLFFLLNIVRVL------VTKLKVTHRAETSM------YMKAVRATLILVPLLGIQFVLVPWKPERFVGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAALK 373          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003797.1 (pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 gene:ENSPMAG00000003461.1 transcript:ENSPMAT00000003797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.883e-23
Identity = 64/198 (32.32%), Postives = 95/198 (47.98%), Query Frame = 3
Query:  198 CEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSC----------VNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASF----LVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGW 746
            C +  D +  CWP T  G+    PCP  F+G  Y+ +    R+C  +G+W A  SNY+ C              H E+ L+  ++ G+ +S+  L  A  LF   ++++C RN IH +L S FILR++ F    L+ F    +  P    ++V  I    H+  F WM  EG YL   I  TY   +LR   F  +GW
Sbjct:   44 CNSTLDEIETCWPSTPVGQVVSRPCPEFFNGVRYEIHRTVYRECLENGTW-ALISNYSECKPIVENKEVQTESFHYEVALIINYL-GHCISLAALVIAFLLFMGLRSIRCLRNIIHWNLISTFILRNSMFYTLQLIDFRTQEANEPW--CRVVSTIYNYFHVTNFFWMFGEGCYLHTAIVMTYSTDKLRKWVFLCLGW 237          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 68.5514 bits (166), Expect = 7.059e-13
Identity = 71/280 (25.36%), Postives = 120/280 (42.86%), Query Frame = 3
Query:  390 EEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALT--SANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVR 1223
            E+++L  +   G  +S + L   L +F   ++L   R+ IH +L  A  L  A  L L  I  +G+ +   Q+V       +   F WML EG++L+  +   + +  +R  H+ I GWGFP  +   SA    N + +    W+   D F          +  +  +  I+ L++ +  +  +    +VK  +  H                       R  +K  LVLMPLLG  +I  +   +    F F Y+ A+  S QGF++ L++   N EVR
Sbjct:   41 EKLSLQIITYIGCGISSVALLITLVIFLSIESLSTERHRIHLNLVLALFL--AQILFLSGINATGNKIG-CQVVAAFLHYFYTVAFTWMLNEGVHLYLKVVKVFRIENVRLLHYYIFGWGFPAVIVGISAAIKPNSYGTESICWLSLSDDFV------WAFIGPVTFIIAINCLILIVVVKTIVNSASTVKNSDHAH----------------------IRAGVKGALVLMPLLGVSWISGLLAVNKDTVF-FQYVFAITNSFQGFLIFLLHVVFNTEVR 288          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Match: EDO39196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS3])

HSP 1 Score: 62.3882 bits (150), Expect = 1.028e-10
Identity = 69/278 (24.82%), Postives = 124/278 (44.60%), Query Frame = 3
Query:  405 VGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPS-GHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWG-----FPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEV 1220
            +G+ I+G  L+I+   + LFL     +L+  R FIH +L +A +       +LFI+  +   P  +   V ++    ++++F WML+EG++++ L+   +   R R + + +IGWG     FP  + +     N  T+    W+               + +  I  F+  ALVV       L +   V    L  +  +  N                R  +KA + L+P+LG  ++     ++ K   +F YL A+F S QGF++ + YC  + EV
Sbjct:   62 LGLSIAGCVLTIL---THLFL----PSLRSERVFIHINLVTAILFAQ----ILFIVGATHREPQSLCLSVAVLLYFFYMSVFTWMLVEGIHIYCLVIRVFNSGRGRKKIYTVIGWGEFLSIFPSGMPA---FRNSSTTSSRCWLS--------------LESGAIWAFVAPALVVIAFNLVILFMVLRVTAVMLKDESQTSSNVCLS------------RALVKAFVTLLPILGLTWLFGFLAFNNK-TVMFEYLFAIFNSMQGFLIFVFYCLLSSEV 298          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 63.929 bits (154), Expect = 1.370e-10
Identity = 73/278 (26.26%), Postives = 122/278 (43.88%), Query Frame = 3
Query:  405 VGVFISGYALSIICLCSALFLFCHFKALKCTR-NFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALT--SANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKR---FELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEV 1220
            +G +I G A+S+  L  A   F   + LK +  N IH +L +A ++    FL     T      R++ I+L         +F WML+EG+++++ +     +   R   +  +GWG P  +   SA      + + H  WM      TD          ++I  F I  ++V   +        S++R   F LP  ++  C       Y L R    YR  M+A+ V++PLLG   +  I   +  ++ +F YL A  T+ QG  + L YC  + +V
Sbjct: 2238 IGTYI-GIAVSVAILLIAFVSFVCLRGLKKSNANDIHKNLVAAIVIAEIIFLAGINRTNDTTACRLVAILL---HYFFSTVFTWMLVEGVHMYRRLSEKRNIDTGRMNFYYFLGWGCPAIVVGISAGLSTEGYGNNHFCWMA-----TD---------GTLIWTFTIPVMIVVAVS--------SMERFFFFTLPSHETFTC-----YFYLLMR--SLYRAGMRASAVVLPLLGVSLVFAILMVNKDME-MFHYLFAALTAFQGLFIFLFYCLFDKKV 2481          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Match: EDO44368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW06])

HSP 1 Score: 58.5362 bits (140), Expect = 9.346e-10
Identity = 42/144 (29.17%), Postives = 71/144 (49.31%), Query Frame = 3
Query:  354 KSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRH---FAIIGWGFPMALTSAN 776
            K + ++ + G H  + L  +   G  LS++ LC AL  F  F+ LK +R F+H +L  + IL  A  L LF +  +   L + QI+  +     LA F WM +EG+ L+ ++   +G + +  +    F   GWG P  +   +
Sbjct:   48 KGDMDAILKGDHR-LALSLITYIGIVLSVVTLCIALLTFITFRFLKSSRTFLHKNLSISLIL--AQLLFLFGVNKTEIKL-VCQIIAALLHYLWLASFAWMALEGVMLYLMLVKVFGTKTITNKKRAVFLTFGWGLPAVVVGVS 187          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Match: EDO50018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF24])

HSP 1 Score: 56.6102 bits (135), Expect = 7.768e-9
Identity = 51/205 (24.88%), Postives = 94/205 (45.85%), Query Frame = 3
Query:  630 AHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALT--SANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRG 1238
            A +++F WML+EG++L+++I   + + R   + +  IGWG PM +   ++   +  + +P+  W+   D+               I  F   A+VV L     LG   +V R     ++++    +HR    +    +  R   + +++L+PLLG  + IF      +   +  Y+ A   S QG M+   +C  N EV  L+ G
Sbjct:  120 AFMSVFSWMLVEGIHLYQMIIIAF-ITRAMMKFYYFIGWGLPMCIVVIASCISHKGYGTPNFCWLSLTDH--------------TIWAFTGPAIVVILVNAVVLG---AVLRLRTKLENNA--EVSHRACLSI----LFLRTGARVSIMLLPLLGLSW-IFGLFTAMEGTLVIQYIFAATNSLQGLMIFAFHCVGNSEVGCLLIG 299          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:101157488])

HSP 1 Score: 150.214 bits (378), Expect = 2.376e-39
Identity = 116/387 (29.97%), Postives = 184/387 (47.55%), Query Frame = 3
Query:  159 NRSLFYQDNNIEYCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVN--------GRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAI--FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM-----RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPK--VKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGY 1265
            N SL     +  YC A  D +  CWP +  G     PCP   +G +Y++  +A R+C  +G+W A K NY++C            H +I L+  ++ G+ +S+  L  A  LF   ++++C RN IH +L + FILR+  + +L +I  + H        L+ +   +  +  F WM +EG YL   I  TY   +LR   F  IGW  P  +     +  ++      W      + +DY    P+I +L++N + +  I+  L+ KLRA                    S  ++T           ++YRKA+KATLVL+PLLG  Y++F  +       + +F Y N+   S QGF V++ YCF N EVR  VR R   W++ +
Sbjct:   92 NASLSLLSADGLYCNATVDEIGTCWPRSSTGRIVERPCPAYINGVKYNATRSAYRECMDNGTW-ALKINYSNCEPILEEKRKYPMHYKIALIINYL-GHCISVGALVVAFVLFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLIDHNIHESNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVTWAIGKLYFENEKCWFGKEPGKYMDYIYQGPVILVLLINFVFLFNIVRILMTKLRA--------------------STTSET-----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAVRKRWHRWQDNH 445          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Match: pth1r (parathyroid hormone 1 receptor [Source:NCBI gene;Acc:101155466])

HSP 1 Score: 147.517 bits (371), Expect = 4.387e-38
Identity = 117/393 (29.77%), Postives = 187/393 (47.58%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW---TANKS--NYNSCV------NGRHEEI---NLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLM-----------ISRLAHLAI--------------FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSA-NTLYNIFTSPH--DLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVK----FLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            +C A +DG++CWP    G+     CP     ++++    A R+C  +G+W   +ANK+  NYN C       N  HE+     L  ++  GY++S+  L  A+ +  +F+ L CTRN+IH HLF +++LR+ S  V  ++  S  PL  ++ V +           +++   +A               ++W+L+EGLYL  LI+ T+   R     F +IGWG P    S   T+   F      DL    L +   +PI+  +++N I+ L II  L  KLR                   ++  C+              +YRK +K+TLVLMPL G +YIIF    + +V      +  +   +F S QGF+VA+IYCF N EV+  ++
Sbjct:   60 FCSAEWDGIVCWPEGPPGKLVSTACPEYI--YDFNHKGLAYRRCDNNGTWEQASANKTWANYNECAKFLYHYNHSHEKEVFHRLYLIYTVGYSVSLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSYMLRAISIFVKDVVLYSESPLENMERVTLDDLKSITIAPPVNKTQFIACKVVVTLFMYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAVFVSIWATVRATFADTECWDLSAGNLKWIYQVPILMAVVVNFILFLNIIRVLATKLR-----------------ETNAGRCDTRQ-----------QYRKLLKSTLVLMPLFGVHYIIFNAMPYTEVSGIPWLIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIK 422          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Match: ENSORLT00000007395.2 (vasoactive intestinal polypeptide receptor 2-like [Source:NCBI gene;Acc:101155464])

HSP 1 Score: 138.272 bits (347), Expect = 1.557e-35
Identity = 108/378 (28.57%), Postives = 171/378 (45.24%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLV------GVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLV----LFIIT---PSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAI---IGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLS 1283
            C+  +D + CW  T  GE   +PCP       +  N N +R C+  G W+    N +S       +  LV       ++  G++LS+I L +   + C F+ L CTRN+IH +LF +FILR+ + LV    LF  T    +   L   +  L+  +   +A F W+L+EGLYL  L+   +       RHF I   IGWG P    SA  +  I+     L   ++++               + + II  LV KLR                   D  G +++            +YR+  K+TL+L+PL G +Y++F++      +    + +    S QGF+VA++YCF N EV+  +R +   WR    N +LS
Sbjct:   46 CKGTWDSIACWEHTGLGETVTIPCPRALKTI-FGRNGNISRNCTASG-WSEVFPNISSVCESDTSQNKLVFYVVVQALYTLGHSLSLIALITGSAILCLFRKLHCTRNYIHLNLFVSFILRAVAVLVKDDILFNKTLQCSNQSSLLGCKASLVFFQYFIMANFFWLLVEGLYLHTLLVVIFS----ENRHFIIYMFIGWGIPTVFVSAWVITRIYLEDTGLRYFKVNFI--------------LFISIIRILVQKLRC-----------------PDVGGNDQS------------QYRRLAKSTLLLIPLFGIHYVVFVSFSESITEDYKIFFDLALGSFQGFVVAILYCFLNSEVQGELRRK---WRSMCLNCRLS 371          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Match: pth3r (parathyroid hormone/parathyroid hormone-related peptide receptor [Source:NCBI gene;Acc:101173747])

HSP 1 Score: 133.65 bits (335), Expect = 4.230e-33
Identity = 111/380 (29.21%), Postives = 169/380 (44.47%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW---TANK---SNYNSC---VNGRHEEIN------LVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFL----VLFIITPSGHPLRILQIVLMISRLAHLAIF--------HWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLW---MRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLF----TYLNAMFTSTQGFMVALIYCFQNIEVRKLVR 1235
            C   +DG++CWP +RAG+   +PCP     ++++    A RQC   G+W   T+N    +NY  C   +   H  +       L  ++  GY++S+  L  A+ + C+FK L CTRN+IH HLF++FI R+ S      VL+ IT         +        A +  F        +W+L EGLYL  LI+      +       I+GWG P    S         +    W      L +   +PI+  + +N ++ + II  L  KL       +         P Q                    +YRK +++TLVLMPL G +YI+F+   + +V  L      +    F S+QGF VA IYCF N EV+  V+
Sbjct:   61 CVPEWDGIICWPQSRAGQLVSVPCPEYI--YDFNHRGRAYRQCDVTGNWELVTSNNHTWANYTECTRYLTSNHRSLQEKVFKRLHLMYTVGYSISLSSLLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAVSIFVKDSVLYSITDDSKAEFPAERQYTAGCKAAVTFFLYFLATNHYWILAEGLYLHSLIFMALLSDKNYLWVLTIMGWGIPAVFVSVWVSARASLADTQCWDISAGNLKWIYQVPILAGIFVNFLLFINIIRVLASKLWETNTGKLN--------PRQ--------------------QYRKLLRSTLVLMPLFGVHYIVFMAIPYTEVNGLLWQVQMHYEMFFNSSQGFFVAFIYCFCNGEVQAEVK 410          
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 128.642 bits (322), Expect = 6.284e-32
Identity = 110/388 (28.35%), Postives = 181/388 (46.65%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW----TANK--SNYNSCVNGRHEEIN----LVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQ--IVLMISRLAHLAI----FHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMR---QLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKF---LFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHVS 1292
            +C   +DG +CW  T AG  A   CP+ FD F  D  + AT+ C  DG W      N+  SNY  C      ++     L  + I G+ALSI  L  +L +F +F++L C R  +H +LF +++L SA   +++++T   +P  + +  +   +    H+ +    + WML EG+YL  LI             + ++GWGFP+   S + +        + WM     L Y    PI+  L++N   +L II  LV KLR                          THR    +      Y KA++ATL+L+PLLG  ++IF   + P+ +    ++ Y+  +    QG +VA I+CF N EV+  ++ + + ++  +   +  H S
Sbjct:   44 FCSRNWDGWLCWEDTPAGTFAAQNCPNYFDDF--DPTEKATKYCGEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSA-LTIIYLVTVVNNPEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFPLVPVSIHAVARKKYFDDNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLR-------------------------DTHRAESNM------YMKAVRATLILVPLLGIQFVIFP--WRPENRLAGEVYEYVMHILMHYQGLLVATIFCFFNGEVQGALKRQWMQYKTQWGQRRKDHCS 395          
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Match: SMESG000049048.1 (SMESG000049048.1)

HSP 1 Score: 857.44 bits (2214), Expect = 0.000e+0
Identity = 425/426 (99.77%), Postives = 426/426 (100.00%), Query Frame = 3
Query:  195 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHVSRILLLILCCIYKPNPSIIQNGQRIRSIYHCQGNNQTYRKSTVAEKPNTTDVEGKPGFVLA 1472
            YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHVSRILLLILCCIYKPNPSIIQNGQRIRSIYHCQGNNQTYRKSTVAEKPNTTDVEGKPGF+LA
Sbjct:   25 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHVSRILLLILCCIYKPNPSIIQNGQRIRSIYHCQGNNQTYRKSTVAEKPNTTDVEGKPGFILA 450          
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Match: SMESG000051050.1 (SMESG000051050.1)

HSP 1 Score: 175.252 bits (443), Expect = 5.741e-49
Identity = 120/360 (33.33%), Postives = 190/360 (52.78%), Query Frame = 3
Query:  198 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHE-EINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFI--ITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHP-KVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGY 1265
            C   +DG   W  T +   A   CP       Y+  +N TR C  +G W A KSNY+ C+   ++ E +++  +  GY +S I L  AL LF +F++L+C RN IHC+L  ++I+R  ++ ++ +  IT +  P+ I+ I  +I   +  + + WM +EG YL  +I WTYG+ +L+  H+++IGWGFP  L+S   +    T   +       +F       + +    I + I     V + A     + K +K+ ++P           R S +LS F  EYRKA+KA  VL+PLLG  + +F+      K +  +  L A+ TSTQGF VALIYCF N EVR +++ +  ++R GY
Sbjct:   30 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVW-AKKSNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPITIVNITTIIILFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTLLSSILAISIALTENFN-----ESWFNSSKAKPLKLYIIHIPILISIIANVFVLAVIIYTVFKKLKQTKIP---------VTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR-GY 373          
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Match: SMESG000023013.1 (SMESG000023013.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.162e-37
Identity = 110/368 (29.89%), Postives = 179/368 (48.64%), Query Frame = 3
Query:  183 NNIEYCEAIFDGV-MCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSW----TANK--SNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSGHPLRI----LQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYN-IFTSPHDLWMR--QLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYII-FITHYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGR 1241
            N   YC A  D +  CW  T+AGE A  PCP    GF +  N  A+++C  +G+W      N   SNY+ C+  +   ++LV VF +GY+LS++CL  +LF+F  FK L+C R  +H +LF   ++ +  ++  +++  +G  ++      QI+ +I+    +  + WM  EG+YL  ++  T+    +      + GWG P+ LTS   +   +   P   W    ++     IP +  L  N +I+LFI+  LV KL                               S+  +R   ++ K  KA  +L+PLLG   II FI   + +V+ +  Y  A+ +S QG +V+ I CF N EVR ++R R
Sbjct:   18 NGTSYCNATKDKLGTCWNYTKAGEIAFAPCPK-LPGFNW--NAEASKKCEINGTWYFSIEENNYWSNYSKCLQNK-PNVSLVYVFFAGYSLSVLCLSISLFIFFVFKQLRCDRVTLHKNLFMCHLINAIIWINFYVVISNGDVMQRNPIHCQILFVIATYFSVGTYFWMFSEGIYLAVILILTFHKGPILLTICIVTGWGLPLILTSIYVISRYLMEKPEKCWTEPSKMYLILAIPNVVALGANLLILLFILKTLVTKL-------------------------------SHPTNREETQWSKTAKAVFILIPLLGLQNIIFFIYPDNQEVRLIQDYSTAVLSSFQGVLVSFILCFFNHEVRTIIRRR 350          
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Match: SMESG000064388.1 (SMESG000064388.1)

HSP 1 Score: 141.354 bits (355), Expect = 1.051e-36
Identity = 96/274 (35.04%), Postives = 151/274 (55.11%), Query Frame = 3
Query:  480 KALKCTRNFIHCHLFSAFILRSASFLVLFIITPSG-HPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWM---RQLDYFTDXXXXXXXXXXXXXMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFI-THYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSH 1286
            K+L+C RN IHC+L  +FI+R   ++ ++  + S  +P  +  ++  ++  + LA F WM +EGLYL  +I WTY + +++  HF IIGW  P  LT+A  +  +  +  D W+    ++     +PII IL++N+I +LFI+  L+ KL+A                   +    +  R +        EY+KA+K+T+VLMPLLGF +IIFI +    K+  +F   NA+ +S+QGF V+LIYCF N EVR  +R  L       NN +  H
Sbjct:  104 KSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIED-WVGYRGKMKLIVHLPIILILVVNAIALLFIVITLIEKLKA-------------------TKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRH 357          
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Match: SMESG000064393.1 (SMESG000064393.1)

HSP 1 Score: 114.775 bits (286), Expect = 7.125e-30
Identity = 51/125 (40.80%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  108 NFLGTINRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFK 482
            N+   +++   CRK HFN + F+++ NI +C A++D V+CW PT  G  AI PCP+ F GF Y++ +NA + C  + +W A ++NY SC         L  ++I GY LS+I LCSA  +F +FK
Sbjct:    3 NYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATW-AQRANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFK 126          
The following BLAST results are available for this feature:
BLAST of corticotropin-releasing factor receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR16.391e-4833.07corticotropin releasing hormone receptor 1 [Source... [more]
CRHR16.391e-4833.07corticotropin releasing hormone receptor 1 [Source... [more]
CRHR16.391e-4833.07corticotropin releasing hormone receptor 1 [Source... [more]
CRHR28.302e-4430.48corticotropin releasing hormone receptor 2 [Source... [more]
CRHR21.742e-4330.48corticotropin releasing hormone receptor 2 [Source... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-11.032e-1823.98Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.032e-1823.98Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.200e-1823.98Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.200e-1823.98Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.565e-1823.98Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dh44-R21.731e-4632.47gene:FBgn0033744 transcript:FBtr0087936[more]
Dh44-R21.799e-4632.47gene:FBgn0033744 transcript:FBtr0113075[more]
Dh44-R14.444e-4331.25gene:FBgn0033932 transcript:FBtr0087485[more]
Pdfr1.220e-2426.07gene:FBgn0260753 transcript:FBtr0070436[more]
Pdfr1.377e-2426.07gene:FBgn0260753 transcript:FBtr0308565[more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crhr11.899e-4732.45corticotropin releasing hormone receptor 1 [Source... [more]
pth3r8.234e-3528.15parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r2.588e-3428.97parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r3.123e-3428.97parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ghrhr24.464e-3428.23growth hormone releasing hormone receptor 2 [Sourc... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yif1b2.099e-4531.17Yip1 interacting factor homolog B, membrane traffi... [more]
yif1b8.583e-4431.02Yip1 interacting factor homolog B, membrane traffi... [more]
yif1b1.680e-4331.12Yip1 interacting factor homolog B, membrane traffi... [more]
slc17a91.598e-4231.10solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a91.732e-4231.10solute carrier family 17 member 9 [Source:Xenbase;... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crhr11.143e-4832.80corticotropin releasing hormone receptor 1 [Source... [more]
Crhr28.205e-4229.22corticotropin releasing hormone receptor 2 [Source... [more]
Crhr28.940e-4229.22corticotropin releasing hormone receptor 2 [Source... [more]
Crhr21.446e-4129.76corticotropin releasing hormone receptor 2 [Source... [more]
Crhr21.482e-4129.76corticotropin releasing hormone receptor 2 [Source... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35347|CRFR1_MOUSE7.992e-4832.80Corticotropin-releasing factor receptor 1 OS=Mus m... [more]
sp|P35353|CRFR1_RAT1.974e-4733.07Corticotropin-releasing factor receptor 1 OS=Rattu... [more]
sp|Q76LL8|CRFR1_MACMU2.424e-4733.07Corticotropin-releasing factor receptor 1 OS=Macac... [more]
sp|P35464|DIHR_MANSE8.352e-4631.34Diuretic hormone receptor OS=Manduca sexta OX=7130... [more]
sp|Q16983|DIHR_ACHDO1.292e-4529.70Diuretic hormone receptor OS=Acheta domesticus OX=... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9N4T06.180e-119100.00Corticotropin-releasing factor receptor (Fragment)... [more]
X2BBW71.248e-5132.38Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A411JKC86.172e-5133.51DH44 receptor OS=Aedes aegypti OX=7159 GN=AAEL0082... [more]
A0A2U9PG901.786e-5030.71Neuropeptide receptor OS=Diaphorina citri OX=12184... [more]
A0A0X3NV092.860e-5039.16Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037591.11.281e-4631.57corticotropin releasing hormone receptor 1 [Source... [more]
crhr11.509e-4632.18corticotropin-releasing factor receptor 1-like [So... [more]
ENSAMXT00000045916.11.117e-4229.52corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000058121.11.559e-4030.05corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000034852.11.559e-4030.05corticotropin-releasing factor receptor 2-like [So... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004899.14.528e-4932.62pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000009958.12.128e-4231.02pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
pth1r2.255e-3830.96parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000542.11.999e-3026.58pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000003797.11.883e-2332.32pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 g... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345377.059e-1325.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391961.028e-1024.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.370e-1026.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443689.346e-1029.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500187.768e-924.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR22.376e-3929.97corticotropin-releasing factor receptor 2 [Source:... [more]
pth1r4.387e-3829.77parathyroid hormone 1 receptor [Source:NCBI gene;A... [more]
ENSORLT00000007395.21.557e-3528.57vasoactive intestinal polypeptide receptor 2-like ... [more]
pth3r4.230e-3329.21parathyroid hormone/parathyroid hormone-related pe... [more]
calcr6.284e-3228.35calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
back to top
BLAST of corticotropin-releasing factor receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049048.10.000e+099.77SMESG000049048.1[more]
SMESG000051050.15.741e-4933.33SMESG000051050.1[more]
SMESG000023013.11.162e-3729.89SMESG000023013.1[more]
SMESG000064388.11.051e-3635.04SMESG000064388.1[more]
SMESG000064393.17.125e-3040.80SMESG000064393.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034211
GenBankAFD34361.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034211 ID=SMED30034211|Name=corticotropin-releasing factor receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1584bp
TAAAATTACCGAATGAAATCGCGAAAAAATGTTATTGAAAATTACTTGAT
AAAATTTAAAAACATTATTTAAATTTCTTGTGTAAAATGTTAAACACTTC
TAATTTCAATTTCCTTGGAACTATAAATCGCCGCCAGAACTGCAGAAAGG
AACATTTCAATAGATCTTTGTTTTATCAAGATAACAACATTGAATATTGT
GAGGCAATTTTTGATGGAGTCATGTGCTGGCCCCCCACTCGGGCGGGAGA
ACAGGCAATTCTACCATGTCCCCATACATTTGATGGTTTCGAATACGATT
CAAATGACAACGCCACCCGACAATGCAGCACCGACGGAAGCTGGACAGCA
AATAAGAGCAACTATAACTCATGTGTCAATGGTCGTCATGAGGAGATCAA
CTTGGTTGGCGTCTTCATCAGTGGCTATGCGTTATCAATCATTTGTTTAT
GCAGCGCTCTCTTTCTTTTCTGCCATTTCAAGGCTCTCAAGTGCACGAGG
AACTTCATTCACTGCCATTTGTTTAGTGCTTTTATTCTTCGGTCGGCCTC
ATTTTTAGTTTTATTTATTATCACTCCTTCCGGTCATCCTCTGCGAATTC
TTCAGATCGTCCTAATGATTTCCAGACTTGCTCATTTGGCAATCTTTCAT
TGGATGTTGATTGAAGGGTTATATTTGTTCAAATTAATATATTGGACCTA
TGGACTAAGGAGGCTACGAACTAGGCACTTTGCTATAATTGGATGGGGGT
TCCCAATGGCATTAACTTCAGCAAATACTCTCTACAATATCTTCACGAGT
CCTCATGACCTCTGGATGAGACAACTGGATTATTTTACTGACATTCCCAT
TATTACAATTCTCATTATGAATTCCATAATTATGCTGTTTATTATCCACG
CGCTTGTTGTCAAATTACGGGCTCGTCGACCACTTGGGATACAAAAGTCT
GTCAAAAGATTTGAACTGCCACATCAGGATTCAAGTGGGTGTAACAAAAC
TCATAGGATGTCGTATCAACTGTCGCGATTTCCAGTAGAGTACAGAAAGG
CGATGAAAGCAACTCTCGTCCTGATGCCTTTACTGGGCTTTTACTACATC
ATTTTCATCACTCATTATCATCCAAAAGTCAAATTTTTATTCACATATTT
AAATGCAATGTTTACATCAACACAAGGGTTCATGGTGGCTCTGATATACT
GCTTTCAGAATATCGAAGTAAGGAAGTTGGTGAGAGGCCGTCTCATTGCC
TGGCGTGAAGGCTATAATAATCCAAAGCTTTCCCATGTTTCTCGAATATT
ACTTTTAATTCTATGTTGTATTTATAAACCGAATCCGTCTATAATCCAAA
ATGGCCAGAGAATACGATCCATATACCATTGCCAAGGGAACAATCAAACA
TATAGGAAGTCAACTGTTGCTGAAAAACCCAATACAACGGATGTCGAAGG
AAAACCCGGATTTGTTCTTGCATAAATCTGACAGTATCCAAAATGATATT
GGTGAATGAGTCTAATTTGACGTTTATATCAGGCCCATAATTCATCATTC
ATTTTGCGGATGAATCCGGAAGTCACGATACTAC
back to top

protein sequence of SMED30034211-orf-1

>SMED30034211-orf-1 ID=SMED30034211-orf-1|Name=SMED30034211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=463bp
MLNTSNFNFLGTINRRQNCRKEHFNRSLFYQDNNIEYCEAIFDGVMCWPP
TRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGR
HEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFI
LRSASFLVLFIITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKL
IYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDLWMRQLDYF
TDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSS
GCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHPKVKF
LFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSH
VSRILLLILCCIYKPNPSIIQNGQRIRSIYHCQGNNQTYRKSTVAEKPNT
TDVEGKPGFVLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 108..132
score: 28.61
coord: 249..274
score: 27.25
coord: 174..197
score: 34.39
coord: 322..342
score: 48.83
coord: 353..374
score: 43.3
coord: 212..237
score: 23.47
coord: 140..164
score: 34.37
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 111..367
e-value: 6.4E-41
score: 140.3
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 34..105
e-value: 6.2E-14
score: 62.3
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 36..97
e-value: 2.3E-16
score: 59.8
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 18..96
score: 18.241
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 35..103
e-value: 8.2E-22
score: 79.1
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 14..98
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 104..406
e-value: 3.1E-50
score: 172.9
NoneNo IPR availablePANTHERPTHR45620:SF15DIURETIC HORMONE 44 RECEPTOR 2, ISOFORM Bcoord: 14..449
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 14..449
NoneNo IPR availableCDDcd152647tmB1_CRF-Rcoord: 113..385
e-value: 8.40604E-54
score: 179.15
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 322..341
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 181..203
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00649G_PROTEIN_RECEP_F2_1coord: 38..62
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00650G_PROTEIN_RECEP_F2_2coord: 363..378
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 106..375
score: 29.061