Delta-like protein

Overview
NameDelta-like protein
Smed IDSMED30034201
Length (bp)2243
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-like protein (SMED30034201) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-like protein (SMED30034201) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-like protein (SMED30034201) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-like protein (SMED30034201) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034201

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034201SMESG000036778.1 SmedASXL_018138SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30034201SMESG000036778.1 dd_Smed_v4_15985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034201SMESG000036778.1 dd_Smed_v4_15985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034201SMESG000036778.1 dd_Smed_v4_15985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034201SMESG000036778.1 dd_Smed_v4_15985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034201SMESG000036778.1 dd_Smed_v6_15985_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30034201SMESG000036778.1 SMED30034201smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30034201SMESG000036778.1 SMED30034201smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30034201SMESG000036778.1 Contig43012newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034201SMESG000036778.1 Contig43012uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 2 cellSMED30034201SMESG000036778.1 dd_Smed_v4_15985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL1 (delta like canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:2908])

HSP 1 Score: 142.124 bits (357), Expect = 1.809e-34
Identity = 99/342 (28.95%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + K+   F+    CDE+YYG  C  FC+ ++  + +F C E  +++C PGWKG +C+E +C    D Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G  CE+   +C  D    KN         + +C C PGF G  C+++         F       G C +S + G+ C C     G      I  C    C N   C++
Sbjct:  109 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGATCELGIDEC--DPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNG-----GRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVD 422          
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL1 (delta like canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:2908])

HSP 1 Score: 142.124 bits (357), Expect = 1.809e-34
Identity = 99/342 (28.95%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + K+   F+    CDE+YYG  C  FC+ ++  + +F C E  +++C PGWKG +C+E +C    D Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G  CE+   +C  D    KN         + +C C PGF G  C+++         F       G C +S + G+ C C     G      I  C    C N   C++
Sbjct:  109 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGATCELGIDEC--DPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNG-----GRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVD 422          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 125.561 bits (314), Expect = 8.837e-29
Identity = 96/329 (29.18%), Postives = 141/329 (42.86%), Query Frame = 2
Query:  440 LKWPSDQRTEISFSLEFDNKN--GDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQN---GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNN-LGGICK-----CRFLKCLNKEIC 1387
              WP    T I  + ++DN     ++ L + +    ++  ED  K +  +        +   + + CDENYY + C+ FC+ +N  + ++ C +   + C+ GW G  C EA+C    N   G C  PG C C  GW G  C+ C   PGC+HG C              + + C+C+  WGG  CD DL  C ++   C N G C N   DQ   Y C C  GYSGR+CE     C  +          +     C C  G+SG  C ++       +   N   + G CV+  +GF C C    +G  C+     C    CLN   C
Sbjct:  136 FAWPR-SFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFS---GHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSC-------------VEPWQCNCETNWGGLLCDKDLNYCGSH-HPCTNGGTCINAEPDQ---YRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDID-----ECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSC 438          

HSP 2 Score: 78.5666 bits (192), Expect = 3.395e-14
Identity = 71/258 (27.52%), Postives = 107/258 (41.47%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP--NCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C + Y G NC+   + C   N      +C E        C  GW G  C+  + D+C +  C   G C          C   W G+ C++    CE  P C++           S K     + C C PGW G NC I++  C      CQ+ G C     D +N Y C C  G+ GRHCE++  +C         L + L    +C C  GFSG  C+++  L        +  ++   C N +  ++C+C ++ GG
Sbjct:  335 CPDGYSGRNCEKAEHACT-SNPCANGGSCHEVPSGFECHCPSGWSGPTCALDI-DECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKP-CLNAF---------SCKNLIGGYYCDCIPGWKGINCHINVNDCRGQ---CQHGGTCK----DLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCE-----PSPCRNGARCYNLEGDYYCACPDDFGG 568          

HSP 3 Score: 66.6254 bits (161), Expect = 1.497e-10
Identity = 63/196 (32.14%), Postives = 87/196 (44.39%), Query Frame = 2
Query:  728 ICLPGWKGIFC--SEALCD--DCQNG-RCVGPGN---CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIF--PKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRG 1285
             C  GWKG  C   E  CD   C NG  C   G+   C+C  GW GS C +  K+  C+   C +  G    S     +F+C C+ GW G+ C  +   C  NP  C N GIC     D +N + C+C+ G++G  C +   +CQ          + +I    C C PG +G  CQ       ++  F  S  SRG
Sbjct:  699 ACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAV-AKNSSCLPNPC-VNGGTCVGSG---ASFSCICRDGWEGRTCTHNTNDC--NPLPCYNGGICV----DGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQ-------EVIGFGRSCWSRG 876          

HSP 4 Score: 60.8474 bits (146), Expect = 1.017e-8
Identity = 77/272 (28.31%), Postives = 103/272 (37.87%), Query Frame = 2
Query:  662 DYFCK------DKNKVYPNFNCTETVQRI-------CLPGWKGIFCSEALCDDCQNGRCVG-PG---NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEICIEN 1396
            DY+C        KN   P   C     R+         PG  G   S  +C    +GRCV  PG   +C C  G+TG+ C   E    C+   C+     +        AF C C  GW G+ CD +   C  +P  C +RG C+    D +N + C C  G+ G+ C  +   C  D     N         T  C C PG+ GS C +            N   + G CV S   F C C +   G  C      C  L C N  IC++ 
Sbjct:  557 DYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAAS-GVCG--PHGRCVSQPGGNFSCICDSGFTGTYCH--ENIDDCLGQPCRNGGTCID----EVDAFRCFCPSGWEGELCDTNPNDCLPDP--CHSRGRCY----DLVNDFYCACDDGWKGKTCHSREFQC--DAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAV----AKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDG 807          

HSP 5 Score: 58.9214 bits (141), Expect = 3.105e-8
Identity = 65/219 (29.68%), Postives = 88/219 (40.18%), Query Frame = 2
Query:  728 ICLPGWKGIFC----SEALCDDCQN-GRCVGPGN---CSCYRGWTGSNCEICE---KSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGY-CVNSKEGFHCSCSNNLGG 1342
             C  GW+G  C    ++ L D C + GRC    N   C+C  GW G  C   E    +  C +G    ++G           F C+C PGW G  C +  K  +  P  C N G C          + C C  G+ GR C   T DC     +   +    +    C C PGF+G  C+IN      I   Q+S  + G  CV+   G+ CSC     G
Sbjct:  661 FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSG---------DTFRCACPPGWKGSTCAV-AKNSSCLPNPCVNGGTCVG----SGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRIN------IDECQSSPCAYGATCVDEINGYRCSCPPGRAG 859          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 124.02 bits (310), Expect = 2.291e-28
Identity = 91/312 (29.17%), Postives = 136/312 (43.59%), Query Frame = 2
Query:  440 LKWPSDQRTEISFSLEFDNKN--GDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQN---GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNN-LGGICK 1351
              WP    T I  + ++DN     ++ L + +    ++  ED  K +  +        +   + + CDENYY + C+ FC+ +N  + ++ C +   + C+ GW G  C EA+C    N   G C  PG C C  GW G  C+ C   PGC+HG C              + + C+C+  WGG  CD DL  C ++   C N G C N   DQ   Y C C  GYSGR+CE     C  +          +     C C  G+SG  C ++       +   N   + G CV+  +GF C C    +G  C+
Sbjct:  136 FAWPR-SFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFS---GHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSC-------------VEPWQCNCETNWGGLLCDKDLNYCGSH-HPCTNGGTCINAEPDQ---YRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDID-----ECASNPCAAGGTCVDQVDGFECICPEQWVGATCQ 421          

HSP 2 Score: 66.6254 bits (161), Expect = 1.484e-10
Identity = 63/196 (32.14%), Postives = 87/196 (44.39%), Query Frame = 2
Query:  728 ICLPGWKGIFC--SEALCD--DCQNG-RCVGPGN---CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIF--PKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRG 1285
             C  GWKG  C   E  CD   C NG  C   G+   C+C  GW GS C +  K+  C+   C +  G    S     +F+C C+ GW G+ C  +   C  NP  C N GIC     D +N + C+C+ G++G  C +   +CQ          + +I    C C PG +G  CQ       ++  F  S  SRG
Sbjct:  661 ACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAV-AKNSSCLPNPC-VNGGTCVGSG---ASFSCICRDGWEGRTCTHNTNDC--NPLPCYNGGICV----DGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQ-------EVIGFGRSCWSRG 838          

HSP 3 Score: 60.8474 bits (146), Expect = 9.431e-9
Identity = 77/272 (28.31%), Postives = 103/272 (37.87%), Query Frame = 2
Query:  662 DYFCK------DKNKVYPNFNCTETVQRI-------CLPGWKGIFCSEALCDDCQNGRCVG-PG---NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-IC-----KCRFLKCLNKEICIEN 1396
            DY+C        KN   P   C     R+         PG  G   S  +C    +GRCV  PG   +C C  G+TG+ C   E    C+   C+     +        AF C C  GW G+ CD +   C  +P  C +RG C+    D +N + C C  G+ G+ C  +   C  D     N         T  C C PG+ GS C +            N   + G CV S   F C C +   G  C      C  L C N  IC++ 
Sbjct:  519 DYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAAS-GVCG--PHGRCVSQPGGNFSCICDSGFTGTYCH--ENIDDCLGQPCRNGGTCID----EVDAFRCFCPSGWEGELCDTNPNDCLPDP--CHSRGRCY----DLVNDFYCACDDGWKGKTCHSREFQC--DAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAV----AKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDG 769          

HSP 4 Score: 59.3066 bits (142), Expect = 2.855e-8
Identity = 65/219 (29.68%), Postives = 88/219 (40.18%), Query Frame = 2
Query:  728 ICLPGWKGIFC----SEALCDDCQN-GRCVGPGN---CSCYRGWTGSNCEICE---KSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGY-CVNSKEGFHCSCSNNLGG 1342
             C  GW+G  C    ++ L D C + GRC    N   C+C  GW G  C   E    +  C +G    ++G           F C+C PGW G  C +  K  +  P  C N G C          + C C  G+ GR C   T DC     +   +    +    C C PGF+G  C+IN      I   Q+S  + G  CV+   G+ CSC     G
Sbjct:  623 FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSG---------DTFRCACPPGWKGSTCAV-AKNSSCLPNPCVNGGTCVG----SGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRIN------IDECQSSPCAYGATCVDEINGYRCSCPPGRAG 821          
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL4 (delta like canonical Notch ligand 4 [Source:HGNC Symbol;Acc:HGNC:2910])

HSP 1 Score: 121.324 bits (303), Expect = 8.788e-28
Identity = 99/378 (26.19%), Postives = 149/378 (39.42%), Query Frame = 2
Query:  347 KCENATIIIHRLDCVNSIIKNLNAVLQRFPL-----LKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVA----LDNNAKFL--MTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIE---------TGVLHSSKLRF------------------KAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP----KNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
             C   T+    L   +  +++ ++   R PL       WP       S  +E  +  GD    + +    L+     +  + V     LD     L  + +   + C +NYYG NC   CK +N  + ++ C       CLPGW G +C + +C   C  QNG C  P  C C  GW G  C  C    GC HG C             G+     L +                  +++TC+C+PG+ G +C+++L  C +NP  C+N G C     DQ + Y C C  GY G HCE  T  C     F     +  ++     C C P F+GS+C+     +   +   N   + G C+N      C C     G 
Sbjct:   73 PCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPG----TFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNP--CRNGGSCK----DQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCE-----KKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFTGT 435          

HSP 2 Score: 60.4622 bits (145), Expect = 8.944e-9
Identity = 56/184 (30.43%), Postives = 77/184 (41.85%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNC-----------SCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTG--DCQHDKIFPKNLS----KILTPNCLCYPGFSGSHCQI 1228
            +C PG+ G+ C  +    C +  C   G+C            C   +TGSNCE  +K   C    C      L+    R     C C+PG+ G  C++ +  C  NP  C + G CH    D  N  +C C AG+SGR CE++T    C     F +          T  C C  GF GS C+ 
Sbjct:  349 LCPPGYYGLHCEHSTLS-CADSPCFNGGSCRERNQGANYACECPPNFTGSNCE--KKVDRCTSNPCANGGQCLNRGPSRM----CRCRPGFTGTYCELHVSDCARNP--CAHGGTCH----DLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEF 519          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: apx-1 (Anterior pharynx in excess protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41990])

HSP 1 Score: 99.7525 bits (247), Expect = 9.871e-22
Identity = 81/281 (28.83%), Postives = 122/281 (43.42%), Query Frame = 2
Query:  419 VLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGD--CQHDKIFPKNLSKILTPN-----CLCYPGFSGSHCQIND 1234
            V  RF   ++  + R  I   L+      ++ L    H  +     +   +  + ++ +  F +T  L   C  NY+G  C+ +C    K++  + C+    R C  GW G  CS  +C   C N GRCV P  CSC  G+ G+ CE C    GC++G C  ET             TC C+ G+ G  CDID+K+C+   K C N GIC +        Y C C   + G  C+       C  + +  KN    ++ +     C C  GFSG  C+I +
Sbjct:   63 VPLRFGTGQYHGEARERIDLHLKIIEPTSNEILALQHH--RPAADTEWNSDAPIVIETSRGFNVTVQLRNLCSSNYHGKRCNRYCIANAKLH--WECSTHGVRRCSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRCEQCLPRAGCVNGDCVNET-----------PNTCKCRDGFIGDRCDIDIKICSLE-KPCANGGIC-SIDSSSSTGYKCHCPFEFVGSQCKTPLSKVRCSAEHVC-KNGGACISMDDTNIQCKCRRGFSGKFCEIGN 325          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 91.6633 bits (226), Expect = 1.534e-18
Identity = 76/246 (30.89%), Postives = 110/246 (44.72%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRC---------VGPGNCSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQ----HDKIFPKNLSKILTPNCLCYPGFSGSHCQIN--DTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI-C-----KCRFLKCLNKEICIE 1393
            C+PGW+G  C + + DDC +  C         +    C C  G++G  C I    C  SP C+HG+C      L+S +       C C+PGW G+NCD ++  C  +P  CQN   C     D+IN Y+C+C+ GY G HC+     C     H+     N+    T +C C  GF G HC++N  +  +NQ             C ++   F C C     G  C     +C    CLN   C++
Sbjct: 2157 CVPGWEGPNCDKNI-DDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSP-CVHGLC---IDKLYSRQ-------CLCQPGWTGENCDQNIDECAASP--CQNDAKCI----DEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGA--TYHCDCTLGFDGVHCEMNIDECAENQCDKLGTE-----SCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVD 2377          

HSP 2 Score: 74.7146 bits (182), Expect = 2.083e-13
Identity = 52/183 (28.42%), Postives = 81/183 (44.26%), Query Frame = 2
Query:  812 NCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDK-IFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
             C C  G+ G  CE    IC  +  C +G   I          +   F C C PGW G NCD ++  C ++P  C     C     D IN Y C+C  G+SG+ C +K   C     +    + K+ +  CLC PG++G +C      QN  +   +  ++   C++   G+ C C++   G+
Sbjct: 2114 TCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGE--------KLGRFKCQCVPGWEGPNCDKNIDDCADSP--CALNATCV----DLINDYKCECPTGFSGKRCHIKENLCASSPCVHGLCIDKLYSRQCLCQPGWTGENCD-----QNIDECAASPCQNDAKCIDEINGYMCECADGYEGV 2277          

HSP 3 Score: 64.6994 bits (156), Expect = 2.939e-10
Identity = 62/220 (28.18%), Postives = 83/220 (37.73%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCV---------GPGNCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPK-NLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            +C PG+ G  C +   D C +  C+         G   C C  GWTG  CE     C   P   +G C                + C C PG  G+NC+     C   P  C N G C    GD  +H  C C A ++G+ CE K   C+  +   K   +      C C PGF+G  C+ N       +       S   CV+      C C  NL G+
Sbjct: 2347 VCKPGYTGPRC-DVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFC----------VSLVADYFCVCPPGVSGKNCESAPNRCIGQP--CHNGGEC----GDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNID-----ECSTAHCPSGATCVDQVNTHICVCPFNLTGV 2544          

HSP 4 Score: 62.3882 bits (150), Expect = 1.511e-9
Identity = 61/215 (28.37%), Postives = 87/215 (40.47%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI------CLPGWKGIFCSEALCDDCQ------NGRCVGPG---NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQ 1225
            C   + G NCD    D+    P  N  + +  I      C  G++G+ C + L D C       N  C   G   +C C  G+ G +CE+      C    C  + G   S +     F C CKPG+ G  CD+    C ++P  C N   C +  G     Y C C +G++G  CE   G C             L  +  C+C PG SG +C+
Sbjct: 2232 CQPGWTGENCDQNI-DECAASPCQNDAKCIDEINGYMCECADGYEGVHC-QHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEM--NIDECAENQCD-KLGT-ESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSP--CLNDAQCVDMGG----AYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCE 2434          

HSP 5 Score: 50.0618 bits (118), Expect = 6.943e-6
Identity = 40/138 (28.99%), Postives = 59/138 (42.75%), Query Frame = 2
Query:  947 CSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKI----FPKNLSKILTPNCLCYPGFSGSHC-QINDTLQNQIKSFQNSLKSRGYCVNSKEG-FHCSCSNNLGG 1342
            C CKPG+ G  C++   +C+  P  C N G C          Y C C   ++G  C+ ++ +C   K        +L  + +  CLC  GF+G  C +I D     I S  N  ++   C+  K G F C C     G
Sbjct: 2037 CHCKPGYVGDRCEMLEDVCSTQP--CYNGGKCEQVG----TTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITD-----ICSTNNPCRNGARCIGEKLGRFKCQCVPGWEG 2163          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: dsl-4 (Delta-like protein [Source:UniProtKB/TrEMBL;Acc:Q93519])

HSP 1 Score: 81.6481 bits (200), Expect = 3.935e-16
Identity = 79/273 (28.94%), Postives = 116/273 (42.49%), Query Frame = 2
Query:  572 ITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD-DCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKT--------GDCQHDKI--FPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKC 1354
             TV   N++   + F +   CDEN+   +C  FCKD++     F C +     C PG+ G  C +  C  +C N G C  PG C C +G+ G+ CE C+ S  C HG   +       ++L    +TC C  G+ G N D D  +C    K C++     N        + C C   + GR CE +         G CQ+  +  F   +S+     C C  GF+G HC        + K+ +  LK +      +EGF C   N   G   C
Sbjct:  108 FTVHTKNDS--FLHFAVRNVCDENWRTHSCSIFCKDRSD--SKFKCDDDDGYKCAPGYSGPNCDKVDCPFNCHNHGSCEVPGKCMCSQGFFGTYCEYCKPSTTCKHGAVLV-------NELGCHPYTCRCFEGYAGDNGDKD-DVCY-YAKPCRHGNCVSNV--TVSGGFECICPKAFGGRRCEKRIARWDCSDEGYCQNKGVCSFVDGISR-----CRCAVGFTGKHC--------ERKTAKTCLKKK-----CREGFICIIDNKKTGTMPC 347          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 80.8777 bits (198), Expect = 2.869e-15
Identity = 42/131 (32.06%), Postives = 60/131 (45.80%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCM-HGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            C  GW  + CS+  C  C NG C+  G+C C++GW GSNC   + + GC   G C  +              +C C  GW G+NC ID       P  C  +G C      + + + C+C AG +G  C +
Sbjct:  645 CESGWDSVDCSQQACQ-CVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDG-------------SCKCSSGWNGENCAID-----GCPNQCSGKGECG--MDRRSSEWSCRCQAGSTGVDCSV 754          

HSP 2 Score: 61.6178 bits (148), Expect = 2.037e-9
Identity = 40/135 (29.63%), Postives = 55/135 (40.74%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGN-CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            C PG+ G  C EA+C    +G  V  G  C C  G+ G  CE+    CE +     G C  +               C C PGW G+ C  +L+ C +    C +RG+C N          C C  G+ G  C +
Sbjct:  458 CAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDG-------------RCRCNPGWTGEAC--ELRACPHAS--CHDRGVCVN--------GTCYCMDGWRGNDCSV 567          

HSP 3 Score: 58.9214 bits (141), Expect = 1.615e-8
Identity = 50/201 (24.88%), Postives = 78/201 (38.81%), Query Frame = 2
Query:  668 FCKDKNKVYPNFNCTETVQRICLP------GWKG--------IFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQI 1228
            F  ++++V P     E +QR   P      G  G        +   E+ C+  Q G CV  G C C  G+TG  C+           +C     V+ S    F    C CK G+ G+ C++    C      C  RG C            C+C+ G++G  CE++   C H     + +   +   C C  G+ G+ C +
Sbjct:  396 FINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCN--QRGECVH-GKCHCAPGFTGRTCD---------EAVCP----VVCSGNGVFSGGICVCKSGFKGKECEMRHNWC--EVADCNGRGRCD-------TDGRCRCNPGWTGEACELRA--CPHASCHDRGVC--VNGTCYCMDGWRGNDCSV 567          

HSP 4 Score: 55.0694 bits (131), Expect = 2.396e-7
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 2
Query:  698 NFNCTETVQRICLPGWKGIFCSEALCD-DCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCM-HGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKL 1000
            N +C +     C  GW+G  C++  C   C++ G+C   G+C C  GW G NC I      C   G C ++         R   ++C C+ G  G +C + +++
Sbjct:  663 NGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDR--------RSSEWSCRCQAGSTGVDCSVSVEM 758          

HSP 5 Score: 52.7582 bits (125), Expect = 1.317e-6
Identity = 40/129 (31.01%), Postives = 50/129 (38.76%), Query Frame = 2
Query:  632 CDENYYGSNCD-----YFCKDKNKVYPNFNCTETVQRICLPGWKGIFCS--EALCD--DCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDI 988
            C   + G  CD       C   N V+    C      +C  G+KG  C      C+  DC   GRC   G C C  GWTG  CE+      C H  C  + GV  +        TC C  GW G +C +
Sbjct:  458 CAPGFTGRTCDEAVCPVVCSG-NGVFSGGIC------VCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACEL----RACPHASCH-DRGVCVNG-------TCYCMDGWRGNDCSV 567          

HSP 6 Score: 50.8322 bits (120), Expect = 4.737e-6
Identity = 34/132 (25.76%), Postives = 52/132 (39.39%), Query Frame = 2
Query:  947 CSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C C PG+ G+ CD    +C   P +C   G+         +  +C C +G+ G+ CEM+   C+      +         C C PG++G  C++             S   RG CVN      C C +   G
Sbjct:  456 CHCAPGFTGRTCD--EAVC---PVVCSGNGV--------FSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDT-DGRCRCNPGWTGEACELR-------ACPHASCHDRGVCVNGT----CYCMDGWRG 562          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 80.8777 bits (198), Expect = 2.881e-15
Identity = 42/131 (32.06%), Postives = 60/131 (45.80%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCM-HGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            C  GW  + CS+  C  C NG C+  G+C C++GW GSNC   + + GC   G C  +              +C C  GW G+NC ID       P  C  +G C      + + + C+C AG +G  C +
Sbjct:  724 CESGWDSVDCSQQACQ-CVNGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDG-------------SCKCSSGWNGENCAID-----GCPNQCSGKGECG--MDRRSSEWSCRCQAGSTGVDCSV 833          

HSP 2 Score: 61.6178 bits (148), Expect = 2.043e-9
Identity = 40/135 (29.63%), Postives = 55/135 (40.74%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGN-CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            C PG+ G  C EA+C    +G  V  G  C C  G+ G  CE+    CE +     G C  +               C C PGW G+ C  +L+ C +    C +RG+C N          C C  G+ G  C +
Sbjct:  537 CAPGFTGRTCDEAVCPVVCSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDG-------------RCRCNPGWTGEAC--ELRACPHAS--CHDRGVCVN--------GTCYCMDGWRGNDCSV 646          

HSP 3 Score: 58.9214 bits (141), Expect = 1.620e-8
Identity = 50/201 (24.88%), Postives = 78/201 (38.81%), Query Frame = 2
Query:  668 FCKDKNKVYPNFNCTETVQRICLP------GWKG--------IFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQI 1228
            F  ++++V P     E +QR   P      G  G        +   E+ C+  Q G CV  G C C  G+TG  C+           +C     V+ S    F    C CK G+ G+ C++    C      C  RG C            C+C+ G++G  CE++   C H     + +   +   C C  G+ G+ C +
Sbjct:  475 FINERSRVEPISFVAEELQRPTTPPKTSSSGTSGAKEHPLASVLVCESNCN--QRGECVH-GKCHCAPGFTGRTCD---------EAVCP----VVCSGNGVFSGGICVCKSGFKGKECEMRHNWC--EVADCNGRGRCD-------TDGRCRCNPGWTGEACELRA--CPHASCHDRGVC--VNGTCYCMDGWRGNDCSV 646          

HSP 4 Score: 55.0694 bits (131), Expect = 2.402e-7
Identity = 29/104 (27.88%), Postives = 48/104 (46.15%), Query Frame = 2
Query:  698 NFNCTETVQRICLPGWKGIFCSEALCD-DCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCM-HGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKL 1000
            N +C +     C  GW+G  C++  C   C++ G+C   G+C C  GW G NC I      C   G C ++         R   ++C C+ G  G +C + +++
Sbjct:  742 NGDCLDDGSCQCWKGWRGSNCTDKKCAIGCEDRGKCASDGSCKCSSGWNGENCAIDGCPNQCSGKGECGMDR--------RSSEWSCRCQAGSTGVDCSVSVEM 837          

HSP 5 Score: 52.7582 bits (125), Expect = 1.320e-6
Identity = 40/129 (31.01%), Postives = 50/129 (38.76%), Query Frame = 2
Query:  632 CDENYYGSNCD-----YFCKDKNKVYPNFNCTETVQRICLPGWKGIFCS--EALCD--DCQN-GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDI 988
            C   + G  CD       C   N V+    C      +C  G+KG  C      C+  DC   GRC   G C C  GWTG  CE+      C H  C  + GV  +        TC C  GW G +C +
Sbjct:  537 CAPGFTGRTCDEAVCPVVCSG-NGVFSGGIC------VCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPGWTGEACEL----RACPHASCH-DRGVCVNG-------TCYCMDGWRGNDCSV 646          

HSP 6 Score: 50.8322 bits (120), Expect = 4.747e-6
Identity = 34/132 (25.76%), Postives = 52/132 (39.39%), Query Frame = 2
Query:  947 CSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C C PG+ G+ CD    +C   P +C   G+         +  +C C +G+ G+ CEM+   C+      +         C C PG++G  C++             S   RG CVN      C C +   G
Sbjct:  535 CHCAPGFTGRTCD--EAVC---PVVCSGNGV--------FSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDT-DGRCRCNPGWTGEACELR-------ACPHASCHDRGVCVNGT----CYCMDGWRG 641          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083739)

HSP 1 Score: 121.324 bits (303), Expect = 5.838e-28
Identity = 87/281 (30.96%), Postives = 128/281 (45.55%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFD-----NKNGDKYLTKFIHAKKLLRYE-DTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP-------NCLCYPGFSGSHCQ 1225
            +FP    WP       +FSL  +     N +G+    K +  + L++   +   E       +    + +   + CD NYYGS C  FC+ ++  + +  C+ET + ICL GW+G +C    C   C++G C  P  C C  GW G+ C  C   P C+HG C              K +TC C  GWGG  C+ DL  CTN+ + C+N G C N  G+ +  Y C+C+ GYSG  CE +   C  D    +N    +          C C  G+SG  C+
Sbjct:  115 QFPFSFSWPG------TFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN-------------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFN-TGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCE 372          

HSP 2 Score: 66.6254 bits (161), Expect = 6.164e-11
Identity = 80/295 (27.12%), Postives = 111/295 (37.63%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQRI----CLPGWKG------IFCSEALCDDCQNG-RCVGPGN------CSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKI----CQNRGICHNYYG-------------------------DQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C+E + G  C+    +C +         C  T + +    C PG+ G      I+  +A  + CQNG  C+   +      C C  GW+G  CE     C   P C  G+C+     L S   + + + C C  G+ G NCD+ L  C+ NP I    CQ  G C    G                         D +N Y CQC  G+ G HC  K   C    I P  N    L  N    C C  GF+G  C ++       +       + G C+N    F C C+N   G
Sbjct:  279 CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGS---KGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCL---IRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDID-----ECSSGPCHNGGTCMNRVNSFECVCANGFRG 561          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083740)

HSP 1 Score: 121.324 bits (303), Expect = 5.838e-28
Identity = 87/281 (30.96%), Postives = 128/281 (45.55%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFD-----NKNGDKYLTKFIHAKKLLRYE-DTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP-------NCLCYPGFSGSHCQ 1225
            +FP    WP       +FSL  +     N +G+    K +  + L++   +   E       +    + +   + CD NYYGS C  FC+ ++  + +  C+ET + ICL GW+G +C    C   C++G C  P  C C  GW G+ C  C   P C+HG C              K +TC C  GWGG  C+ DL  CTN+ + C+N G C N  G+ +  Y C+C+ GYSG  CE +   C  D    +N    +          C C  G+SG  C+
Sbjct:  115 QFPFSFSWPG------TFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN-------------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFN-TGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCE 372          

HSP 2 Score: 66.6254 bits (161), Expect = 6.164e-11
Identity = 80/295 (27.12%), Postives = 111/295 (37.63%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQRI----CLPGWKG------IFCSEALCDDCQNG-RCVGPGN------CSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKI----CQNRGICHNYYG-------------------------DQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C+E + G  C+    +C +         C  T + +    C PG+ G      I+  +A  + CQNG  C+   +      C C  GW+G  CE     C   P C  G+C+     L S   + + + C C  G+ G NCD+ L  C+ NP I    CQ  G C    G                         D +N Y CQC  G+ G HC  K   C    I P  N    L  N    C C  GF+G  C ++       +       + G C+N    F C C+N   G
Sbjct:  279 CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGS---KGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCL---IRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDID-----ECSSGPCHNGGTCMNRVNSFECVCANGFRG 561          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0304658)

HSP 1 Score: 121.324 bits (303), Expect = 5.838e-28
Identity = 87/281 (30.96%), Postives = 128/281 (45.55%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFD-----NKNGDKYLTKFIHAKKLLRYE-DTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP-------NCLCYPGFSGSHCQ 1225
            +FP    WP       +FSL  +     N +G+    K +  + L++   +   E       +    + +   + CD NYYGS C  FC+ ++  + +  C+ET + ICL GW+G +C    C   C++G C  P  C C  GW G+ C  C   P C+HG C              K +TC C  GWGG  C+ DL  CTN+ + C+N G C N  G+ +  Y C+C+ GYSG  CE +   C  D    +N    +          C C  G+SG  C+
Sbjct:  115 QFPFSFSWPG------TFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN-------------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFN-TGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCE 372          

HSP 2 Score: 66.6254 bits (161), Expect = 6.164e-11
Identity = 80/295 (27.12%), Postives = 111/295 (37.63%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQRI----CLPGWKG------IFCSEALCDDCQNG-RCVGPGN------CSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKI----CQNRGICHNYYG-------------------------DQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C+E + G  C+    +C +         C  T + +    C PG+ G      I+  +A  + CQNG  C+   +      C C  GW+G  CE     C   P C  G+C+     L S   + + + C C  G+ G NCD+ L  C+ NP I    CQ  G C    G                         D +N Y CQC  G+ G HC  K   C    I P  N    L  N    C C  GF+G  C ++       +       + G C+N    F C C+N   G
Sbjct:  279 CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGS---KGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCL---IRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDID-----ECSSGPCHNGGTCMNRVNSFECVCANGFRG 561          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Ser (gene:FBgn0004197 transcript:FBtr0344121)

HSP 1 Score: 114.005 bits (284), Expect = 1.891e-25
Identity = 71/217 (32.72%), Postives = 103/217 (47.47%), Query Frame = 2
Query:  506 DKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFL--------MTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLC-TNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            D Y T +  A++L+  E+T     +      K L        +T+ + ++C   YY + C  FC+ ++  + ++ C    Q++CL GW+G+ C EA+C    D  +G+C  PG C C  GW G  C  C   PGC HG C               A+ C C   WGG  CD DL  C T+ P  C++ G C N   D+   Y C C+ G SG  CE+
Sbjct:  192 DMYNTSYPDAERLI--EETSYSGVILPSPEWKTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHGSCN------------GSAWKCVCDTNWGGILCDQDLNFCGTHEP--CKHGGTCENTAPDK---YRCTCAEGLSGEQCEI 389          

HSP 2 Score: 65.855 bits (159), Expect = 1.440e-10
Identity = 53/176 (30.11%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  731 CLPGWKGIFCSEAL----CDDCQNGRCVGPGN----CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDC--QHDKIFPKNLSKILTPNCLCYPGFSGSHCQI 1228
            C  G  G FC   L     + C+NG     G+    C C  GWTG  C   E++ GC  G CQ     +  +  +     C C PGW G  C   +  C   P  C N G C +  G     + C C+ G+SG  C +   +C  Q  +     +  I   +C+C PG  G  C+I
Sbjct:  786 CHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCS--ERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQP--CHNGGTCESGAG----WFRCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEI 953          

HSP 3 Score: 63.929 bits (154), Expect = 4.663e-10
Identity = 69/268 (25.75%), Postives = 99/268 (36.94%), Query Frame = 2
Query:  695 PNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRC---------VGPGNCSCYRGWTGSNCEI----CEK--SPGCMH-------------------GMCQIETGVLHSSKLRFK-------------AFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKS---RGYCVNSKEGFHCSCSNNLGG 1342
            P+F C       C  GW G  C E   D+C  G C         +G   C C   W G  C++    CE   S G                       +    T  + S+ L                +F C CK GWGG  C  +L  C      C+N   C     D +N Y C C++G+ GR CE    +C           +  +   NC+C  G+SGS C+         ++ +N   S    G+C+N+ EG++C C  +  G
Sbjct:  472 PDFTCD------CAAGWTGPTC-EINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQ---CRNGATCI----DLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNCICPLGYSGSLCE---------EAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAG 716          

HSP 4 Score: 53.1434 bits (126), Expect = 9.218e-7
Identity = 42/162 (25.93%), Postives = 67/162 (41.36%), Query Frame = 2
Query:  941 FTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE------GFHCSCSNNLGGICKCRFL-----KCLNKEICIE 1393
            FTC C  GW G  C+I++  C   P  C++ G C     D I  + C+C   + G  C++   +C+         + +LT       G + S   +   L + + S   ++   G C+N+KE       F C C    GG+     L     +C N   CI+
Sbjct:  474 FTCDCAAGWTGPTCEINIDECAGGP--CEHGGTCI----DLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAI---GPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQCRNGATCID 626          

HSP 5 Score: 52.373 bits (124), Expect = 1.998e-6
Identity = 59/239 (24.69%), Postives = 85/239 (35.56%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTD 1513
            C C+ G TG+ CE     C  +P    G+C    G           FTC C  GW G+ C      C      CQN G C     D+     C+C+ G++G  C      C+           S      C+C  GFSG  C+IN       +      +    C++   G+ C C     G+ +C  L            L D K     + N+I  Y +  R +N  +  +     D
Sbjct:  784 CKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDG----------DFTCECMSGWTGKRCSERATGCYAG--QCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGWFRCVCAQGFSGPDCRINVN-----ECSPQPCQGGATCIDGIGGYSCICPPGRHGL-RCEIL------------LSDPKSACQNASNTISPYTALNRSQNWLDIALTGRTED 992          

HSP 6 Score: 51.6026 bits (122), Expect = 2.855e-6
Identity = 42/151 (27.81%), Postives = 56/151 (37.09%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP 1183
            C PGW G+FC+EA+ D C+   C   G C    GW                                   F C C  G+ G +C I++  C+  P+ CQ    C     D I  Y C C  G  G  CE+   D    K   +N S  ++P
Sbjct:  866 CAPGWTGLFCAEAI-DQCRGQPCHNGGTCESGAGW-----------------------------------FRCVCAQGFSGPDCRINVNECS--PQPCQGGATCI----DGIGGYSCICPPGRHGLRCEILLSD---PKSACQNASNTISP 971          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Ser (gene:FBgn0004197 transcript:FBtr0085128)

HSP 1 Score: 114.005 bits (284), Expect = 1.891e-25
Identity = 71/217 (32.72%), Postives = 103/217 (47.47%), Query Frame = 2
Query:  506 DKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFL--------MTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLC-TNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            D Y T +  A++L+  E+T     +      K L        +T+ + ++C   YY + C  FC+ ++  + ++ C    Q++CL GW+G+ C EA+C    D  +G+C  PG C C  GW G  C  C   PGC HG C               A+ C C   WGG  CD DL  C T+ P  C++ G C N   D+   Y C C+ G SG  CE+
Sbjct:  192 DMYNTSYPDAERLI--EETSYSGVILPSPEWKTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHGSCN------------GSAWKCVCDTNWGGILCDQDLNFCGTHEP--CKHGGTCENTAPDK---YRCTCAEGLSGEQCEI 389          

HSP 2 Score: 65.855 bits (159), Expect = 1.440e-10
Identity = 53/176 (30.11%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  731 CLPGWKGIFCSEAL----CDDCQNGRCVGPGN----CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDC--QHDKIFPKNLSKILTPNCLCYPGFSGSHCQI 1228
            C  G  G FC   L     + C+NG     G+    C C  GWTG  C   E++ GC  G CQ     +  +  +     C C PGW G  C   +  C   P  C N G C +  G     + C C+ G+SG  C +   +C  Q  +     +  I   +C+C PG  G  C+I
Sbjct:  786 CHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCS--ERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQP--CHNGGTCESGAG----WFRCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEI 953          

HSP 3 Score: 63.929 bits (154), Expect = 4.663e-10
Identity = 69/268 (25.75%), Postives = 99/268 (36.94%), Query Frame = 2
Query:  695 PNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRC---------VGPGNCSCYRGWTGSNCEI----CEK--SPGCMH-------------------GMCQIETGVLHSSKLRFK-------------AFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKS---RGYCVNSKEGFHCSCSNNLGG 1342
            P+F C       C  GW G  C E   D+C  G C         +G   C C   W G  C++    CE   S G                       +    T  + S+ L                +F C CK GWGG  C  +L  C      C+N   C     D +N Y C C++G+ GR CE    +C           +  +   NC+C  G+SGS C+         ++ +N   S    G+C+N+ EG++C C  +  G
Sbjct:  472 PDFTCD------CAAGWTGPTC-EINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQ---CRNGATCI----DLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNCICPLGYSGSLCE---------EAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAG 716          

HSP 4 Score: 53.1434 bits (126), Expect = 9.218e-7
Identity = 42/162 (25.93%), Postives = 67/162 (41.36%), Query Frame = 2
Query:  941 FTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE------GFHCSCSNNLGGICKCRFL-----KCLNKEICIE 1393
            FTC C  GW G  C+I++  C   P  C++ G C     D I  + C+C   + G  C++   +C+         + +LT       G + S   +   L + + S   ++   G C+N+KE       F C C    GG+     L     +C N   CI+
Sbjct:  474 FTCDCAAGWTGPTCEINIDECAGGP--CEHGGTCI----DLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAI---GPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCVGQCRNGATCID 626          

HSP 5 Score: 52.373 bits (124), Expect = 1.998e-6
Identity = 59/239 (24.69%), Postives = 85/239 (35.56%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTD 1513
            C C+ G TG+ CE     C  +P    G+C    G           FTC C  GW G+ C      C      CQN G C     D+     C+C+ G++G  C      C+           S      C+C  GFSG  C+IN       +      +    C++   G+ C C     G+ +C  L            L D K     + N+I  Y +  R +N  +  +     D
Sbjct:  784 CKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDG----------DFTCECMSGWTGKRCSERATGCYAG--QCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTCESGAGWFRCVCAQGFSGPDCRINVN-----ECSPQPCQGGATCIDGIGGYSCICPPGRHGL-RCEIL------------LSDPKSACQNASNTISPYTALNRSQNWLDIALTGRTED 992          

HSP 6 Score: 51.6026 bits (122), Expect = 2.855e-6
Identity = 42/151 (27.81%), Postives = 56/151 (37.09%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP 1183
            C PGW G+FC+EA+ D C+   C   G C    GW                                   F C C  G+ G +C I++  C+  P+ CQ    C     D I  Y C C  G  G  CE+   D    K   +N S  ++P
Sbjct:  866 CAPGWTGLFCAEAI-DQCRGQPCHNGGTCESGAGW-----------------------------------FRCVCAQGFSGPDCRINVNECS--PQPCQGGATCI----DGIGGYSCICPPGRHGLRCEILLSD---PKSACQNASNTISP 971          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 149.443 bits (376), Expect = 3.216e-37
Identity = 124/449 (27.62%), Postives = 187/449 (41.65%), Query Frame = 2
Query:  131 RLLIILLFNFFPKKLCWHTGRIMDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWP--------------SDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP----NCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG-FHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            R+L+   F      L   +G + ++K LSF+  S + K              S D  I  R     +Q  +L     T      + +++   + +A +      KWP              SDQ TE          N +  +++    ++L   ED  +++ +   +  +F    +    CDE Y+G  C  FC+ +N  + +FNC     RICLPGWKG +C+E +C   C  +NG C  PG C C  GW G  C+ C + PGC+HG C              + F C+CK GWGG  C+ DL  CTN+ K C+N   C N        Y C C  G+SG++CE++T +C  +    KN            C C  GF G +C+++         F       G C+    G + C C     G      I +C    C N   C++
Sbjct:    3 RVLLTCFFILISSHLGKSSG-VFELKVLSFTSTSSVCK-------------GSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTE----------NNNNMISRLATKRRLAIGEDWSQDVHLGEQSQLRFSYRVV----CDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN-------------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTN---TGQGSYTCICKPGFSGKNCEIETNECDSNPC--KNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNG-----GTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLD 399          

HSP 2 Score: 68.5514 bits (166), Expect = 2.067e-11
Identity = 64/221 (28.96%), Postives = 95/221 (42.99%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQR----ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQI 1228
            C E + G  C+    FC +      +  CT T Q     IC PG+ G  C E   ++C +  C   G+C         +C +G+ G NCE+    C   P C +G   +E G          +++C C PG+ G NC+  +  C+++P  C N G C     D  N   C+C  G++G  CE    DC  +        +  I    C C  GFSG  C++
Sbjct:  253 CKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNC-EIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGP-CFNGGTCMEKGS--------GSYSCRCPPGYMGSNCEKKIDRCSSDP--CANGGQCL----DLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRV 457          

HSP 3 Score: 62.7734 bits (151), Expect = 1.029e-9
Identity = 55/191 (28.80%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQR-------ICLPGWKGIFCSEAL----CDDCQNG-RCVGPGN---CSCYRGWTGSNCEI---------CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMK 1123
            C + +YG NC+     C D     P FN    +++        C PG+ G  C + +     D C NG +C+  GN   C C  G+TGS CE          C+ +  C+ G+                 +TC+C  G+ G++C +    C+  P  CQN G C+ ++   +    CQC AG+ G  CE K
Sbjct:  331 CPQGFYGKNCEVSAMTCADG----PCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGI---------------NGYTCTCTLGFSGKDCRVRSDACSFMP--CQNGGTCYTHFSGPV----CQCPAGFMGTQCEYK 496          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 149.828 bits (377), Expect = 3.228e-37
Identity = 124/449 (27.62%), Postives = 187/449 (41.65%), Query Frame = 2
Query:  131 RLLIILLFNFFPKKLCWHTGRIMDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWP--------------SDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP----NCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG-FHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            R+L+   F      L   +G + ++K LSF+  S + K              S D  I  R     +Q  +L     T      + +++   + +A +      KWP              SDQ TE          N +  +++    ++L   ED  +++ +   +  +F    +    CDE Y+G  C  FC+ +N  + +FNC     RICLPGWKG +C+E +C   C  +NG C  PG C C  GW G  C+ C + PGC+HG C              + F C+CK GWGG  C+ DL  CTN+ K C+N   C N        Y C C  G+SG++CE++T +C  +    KN            C C  GF G +C+++         F       G C+    G + C C     G      I +C    C N   C++
Sbjct:    3 RVLLTCFFILISSHLGKSSG-VFELKVLSFTSTSSVCK-------------GSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTE----------NNNNMISRLATKRRLAIGEDWSQDVHLGEQSQLRFSYRVV----CDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN-------------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTN---TGQGSYTCICKPGFSGKNCEIETNECDSNPC--KNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNG-----GTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLD 399          

HSP 2 Score: 68.5514 bits (166), Expect = 1.719e-11
Identity = 64/221 (28.96%), Postives = 95/221 (42.99%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQR----ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQI 1228
            C E + G  C+    FC +      +  CT T Q     IC PG+ G  C E   ++C +  C   G+C         +C +G+ G NCE+    C   P C +G   +E G          +++C C PG+ G NC+  +  C+++P  C N G C     D  N   C+C  G++G  CE    DC  +        +  I    C C  GFSG  C++
Sbjct:  253 CKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNC-EIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGP-CFNGGTCMEKGS--------GSYSCRCPPGYMGSNCEKKIDRCSSDP--CANGGQCL----DLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRV 457          

HSP 3 Score: 63.1586 bits (152), Expect = 8.179e-10
Identity = 55/191 (28.80%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQR-------ICLPGWKGIFCSEAL----CDDCQNG-RCVGPGN---CSCYRGWTGSNCEI---------CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMK 1123
            C + +YG NC+     C D     P FN    +++        C PG+ G  C + +     D C NG +C+  GN   C C  G+TGS CE          C+ +  C+ G+                 +TC+C  G+ G++C +    C+  P  CQN G C+ ++   +    CQC AG+ G  CE K
Sbjct:  331 CPQGFYGKNCEVSAMTCADG----PCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGI---------------NGYTCTCTLGFSGKDCRVRSDACSFMP--CQNGGTCYTHFSGPV----CQCPAGFMGTQCEYK 496          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dld (deltaD [Source:NCBI gene;Acc:30138])

HSP 1 Score: 140.969 bits (354), Expect = 2.695e-34
Identity = 88/293 (30.03%), Postives = 138/293 (47.10%), Query Frame = 2
Query:  485 EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGGI 1345
            +   +N D+ +++    + L   E+  +++ V      K+   F+    CDE+YYG  C  FC+ ++  + +F C E  + IC  GWKG +C+E +C    D  +G C  PG C C  G++G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K CQN   C N        Y C C  G++G  CE++  +C             L  T +C C PGF G +C+++         F       G+C ++ E G+ C C     G 
Sbjct:  132 DLSTENPDRLISRMTTQRHLTVGEEWSQDLQVGGRTELKYSYRFV----CDEHYYGEGCSVFCRPRDDTFGHFTCGERGEIICNSGWKGQYCTEPICLPGCDEDHGFCDKPGECKCRVGFSGKYCDDCIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCQNGATCTN---TGQGSYTCSCRPGFTGDSCEIEVNECSGSPCRNGGSCTDLENTYSCTCPPGFYGRNCELSAMTCADGPCFNG-----GHCADNPEGGYFCQCPMGYAGF 398          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dla (deltaA [Source:NCBI gene;Acc:30131])

HSP 1 Score: 134.806 bits (338), Expect = 4.118e-32
Identity = 91/315 (28.89%), Postives = 140/315 (44.44%), Query Frame = 2
Query:  485 EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV-NSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            +   +N ++ ++     + L   ED  +++        K+   F+    CDE+YYG  C  FC+ ++  + +F C E  + IC  GWKG +C+E +C    D ++G C  PG C C  G+ G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C N   C N        Y C C  G+SG  CE++  +C  +          +  T +C C PGF G +C+++         F       G C  N   G+ C C     G      I  C    C N   C++
Sbjct:  136 DLTTENPERIISTMTTQRHLTVGEDWSQDLHSVGRTELKYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICDAGWKGQYCTEPICLPGCDEEHGFCEKPGECKCRVGFKGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCSN---TGQGSYTCSCRPGFSGASCEIEVNECTGNPCRNGGSCTDMENTYSCTCPPGFYGKNCELSAMTCADGPCFNG-----GRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVD 424          

HSP 2 Score: 60.8474 bits (146), Expect = 4.489e-9
Identity = 58/193 (30.05%), Postives = 77/193 (39.90%), Query Frame = 2
Query:  608 MTFILSIECDENYYGSNCD---YFCKDKNKVYPNFNCTETVQRI-------CLPGWKGIFCSEAL----CDDCQNG-RCVGPGN---CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            M    S  C   +YG NC+     C D     P FN               C  G+ G  C + +       C NG RCV   N   C C  G+TG NC+     C   P    G CQ               + C+C PG+ G+NC   +  C +NP  C N   CH    ++ N Y+C C +GY GR+C+ 
Sbjct:  348 MENTYSCTCPPGFYGKNCELSAMTCADG----PCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTCQEGA----------SGYMCTCPPGYTGRNCSSPVSRCQHNP--CHNGATCH----ERNNRYVCACVSGYGGRNCQF 520          

HSP 3 Score: 59.6918 bits (143), Expect = 1.161e-8
Identity = 55/185 (29.73%), Postives = 75/185 (40.54%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
             C PG+ G  C E     C +G C   G C+          C  G+ G NCE     C  SP C +G   ++            ++ C C  G+ G NCD     C+  P  CQN G C     +  + Y+C C  GY+GR+C      CQH+     N +     N    C C  G+ G +CQ 
Sbjct:  355 TCPPGFYGKNC-ELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSP-CSNGARCVDL---------VNSYLCQCPDGFTGMNCDRAGDECSMYP--CQNGGTCQ----EGASGYMCTCPPGYTGRNCSSPVSRCQHNPCH--NGATCHERNNRYVCACVSGYGGRNCQF 520          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dla (deltaA [Source:NCBI gene;Acc:30131])

HSP 1 Score: 134.035 bits (336), Expect = 5.216e-32
Identity = 91/315 (28.89%), Postives = 140/315 (44.44%), Query Frame = 2
Query:  485 EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV-NSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            +   +N ++ ++     + L   ED  +++        K+   F+    CDE+YYG  C  FC+ ++  + +F C E  + IC  GWKG +C+E +C    D ++G C  PG C C  G+ G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C N   C N        Y C C  G+SG  CE++  +C  +          +  T +C C PGF G +C+++         F       G C  N   G+ C C     G      I  C    C N   C++
Sbjct:  136 DLTTENPERIISTMTTQRHLTVGEDWSQDLHSVGRTELKYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICDAGWKGQYCTEPICLPGCDEEHGFCEKPGECKCRVGFKGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCSN---TGQGSYTCSCRPGFSGASCEIEVNECTGNPCRNGGSCTDMENTYSCTCPPGFYGKNCELSAMTCADGPCFNG-----GRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVD 424          

HSP 2 Score: 60.4622 bits (145), Expect = 6.405e-9
Identity = 58/193 (30.05%), Postives = 77/193 (39.90%), Query Frame = 2
Query:  608 MTFILSIECDENYYGSNCD---YFCKDKNKVYPNFNCTETVQRI-------CLPGWKGIFCSEAL----CDDCQNG-RCVGPGN---CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            M    S  C   +YG NC+     C D     P FN               C  G+ G  C + +       C NG RCV   N   C C  G+TG NC+     C   P    G CQ               + C+C PG+ G+NC   +  C +NP  C N   CH    ++ N Y+C C +GY GR+C+ 
Sbjct:  348 MENTYSCTCPPGFYGKNCELSAMTCADG----PCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTCQEGA----------SGYMCTCPPGYTGRNCSSPVSRCQHNP--CHNGATCH----ERNNRYVCACVSGYGGRNCQF 520          

HSP 3 Score: 59.3066 bits (142), Expect = 1.548e-8
Identity = 55/185 (29.73%), Postives = 75/185 (40.54%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
             C PG+ G  C E     C +G C   G C+          C  G+ G NCE     C  SP C +G   ++            ++ C C  G+ G NCD     C+  P  CQN G C     +  + Y+C C  GY+GR+C      CQH+     N +     N    C C  G+ G +CQ 
Sbjct:  355 TCPPGFYGKNC-ELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSP-CSNGARCVDL---------VNSYLCQCPDGFTGMNCDRAGDECSMYP--CQNGGTCQ----EGASGYMCTCPPGYTGRNCSSPVSRCQHNPCH--NGATCHERNNRYVCACVSGYGGRNCQF 520          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 142.51 bits (358), Expect = 1.633e-34
Identity = 82/279 (29.39%), Postives = 138/279 (49.46%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQIN 1231
            RFP    WP       +      + + + +N ++ +++    + L   E   +++  +     K+   F+    CDE+YYG  C  +C+ ++  + +F+C E  +++C PGWKG++C+E +C    D  +G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C  +          L  + +C C PGF G +C+++
Sbjct:  121 RFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSSDRTELKYSYRFV----CDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELS 378          

HSP 2 Score: 68.9366 bits (167), Expect = 2.260e-11
Identity = 70/222 (31.53%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
            C   Y GSNC+      D N      +CT+        C PG+ G  C E     C +G C   G CS          C  G++G NCE     C  +P C +G         H   L   ++ C C+ G+ G+NCD +L  C + P  CQN G C     D IN Y C C  GY G++C M    C+H+     N +     N    C C  G+ G++CQ 
Sbjct:  328 CRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNC-ELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNP-CANGA--------HCEDLG-NSYICQCQEGFSGRNCDDNLDDCASFP--CQNGGTCQ----DGINDYTCTCPPGYIGKNCSMPITKCEHNPC--HNGATCHERNNRYVCQCARGYGGNNCQF 530          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 141.739 bits (356), Expect = 2.368e-34
Identity = 82/279 (29.39%), Postives = 138/279 (49.46%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQIN 1231
            RFP    WP       +      + + + +N ++ +++    + L   E   +++  +     K+   F+    CDE+YYG  C  +C+ ++  + +F+C E  +++C PGWKG++C+E +C    D  +G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C  +          L  + +C C PGF G +C+++
Sbjct:  111 RFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSSDRTELKYSYRFV----CDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELS 368          

HSP 2 Score: 68.5514 bits (166), Expect = 3.005e-11
Identity = 70/222 (31.53%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
            C   Y GSNC+      D N      +CT+        C PG+ G  C E     C +G C   G CS          C  G++G NCE     C  +P C +G         H   L   ++ C C+ G+ G+NCD +L  C + P  CQN G C     D IN Y C C  GY G++C M    C+H+     N +     N    C C  G+ G++CQ 
Sbjct:  318 CRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNC-ELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNP-CANGA--------HCEDLG-NSYICQCQEGFSGRNCDDNLDDCASFP--CQNGGTCQ----DGINDYTCTCPPGYIGKNCSMPITKCEHNPC--HNGATCHERNNRYVCQCARGYGGNNCQF 520          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 141.739 bits (356), Expect = 2.468e-34
Identity = 82/279 (29.39%), Postives = 138/279 (49.46%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQIN 1231
            RFP    WP       +      + + + +N ++ +++    + L   E   +++  +     K+   F+    CDE+YYG  C  +C+ ++  + +F+C E  +++C PGWKG++C+E +C    D  +G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C  +          L  + +C C PGF G +C+++
Sbjct:  111 RFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSSDRTELKYSYRFV----CDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELS 368          

HSP 2 Score: 68.1662 bits (165), Expect = 3.299e-11
Identity = 70/222 (31.53%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
            C   Y GSNC+      D N      +CT+        C PG+ G  C E     C +G C   G CS          C  G++G NCE     C  +P C +G         H   L   ++ C C+ G+ G+NCD +L  C + P  CQN G C     D IN Y C C  GY G++C M    C+H+     N +     N    C C  G+ G++CQ 
Sbjct:  318 CRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNC-ELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNP-CANGA--------HCEDLG-NSYICQCQEGFSGRNCDDNLDDCASFP--CQNGGTCQ----DGINDYTCTCPPGYIGKNCSMPITKCEHNPC--HNGATCHERNNRYVCQCARGYGGNNCQF 520          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 141.354 bits (355), Expect = 2.868e-34
Identity = 82/279 (29.39%), Postives = 138/279 (49.46%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQIN 1231
            RFP    WP       +      + + + +N ++ +++    + L   E   +++  +     K+   F+    CDE+YYG  C  +C+ ++  + +F+C E  +++C PGWKG++C+E +C    D  +G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C  +          L  + +C C PGF G +C+++
Sbjct:  111 RFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSSDRTELKYSYRFV----CDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELS 368          

HSP 2 Score: 68.1662 bits (165), Expect = 3.806e-11
Identity = 70/222 (31.53%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
            C   Y GSNC+      D N      +CT+        C PG+ G  C E     C +G C   G CS          C  G++G NCE     C  +P C +G         H   L   ++ C C+ G+ G+NCD +L  C + P  CQN G C     D IN Y C C  GY G++C M    C+H+     N +     N    C C  G+ G++CQ 
Sbjct:  318 CRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNC-ELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNP-CANGA--------HCEDLG-NSYICQCQEGFSGRNCDDNLDDCASFP--CQNGGTCQ----DGINDYTCTCPPGYIGKNCSMPITKCEHNPC--HNGATCHERNNRYVCQCARGYGGNNCQF 520          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 138.272 bits (347), Expect = 3.366e-33
Identity = 84/274 (30.66%), Postives = 137/274 (50.00%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQIN 1231
            RFP    WP         S  F ++N ++ +++    + L   E   +++  +     K+   F+    CDE+YYG  C  +C+ ++  + +F+C E  +++C PGWKG++C+E +C    D  +G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C  +          L  + +C C PGF G +C+++
Sbjct:  111 RFPFGFTWP--------VSNVF-HENPERLISRLATQRHLTVGEQWSQDLHSSDRTELKYSYRFV----CDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELS 354          

HSP 2 Score: 68.1662 bits (165), Expect = 3.905e-11
Identity = 70/225 (31.11%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  623 SIECDENYYGSNCDYFCK--DKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS----------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQI 1228
            +  C   Y GSNC+      D N      +CT+        C PG+ G  C E     C +G C   G CS          C  G++G NCE     C  +P C +G         H   L   ++ C C+ G+ G+NCD +L  C + P  CQN G C     D IN Y C C  GY G++C M    C+H+     N +     N    C C  G+ G++CQ 
Sbjct:  301 TCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNC-ELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNP-CANGA--------HCEDLG-NSYICQCQEGFSGRNCDDNLDDCASFP--CQNGGTCQ----DGINDYTCTCPPGYIGKNCSMPITKCEHNPC--HNGATCHERNNRYVCQCARGYGGNNCQF 506          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dll1 (delta like canonical Notch ligand 1 [Source:MGI Symbol;Acc:MGI:104659])

HSP 1 Score: 140.969 bits (354), Expect = 3.625e-34
Identity = 90/320 (28.12%), Postives = 146/320 (45.62%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEAL----CDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + ++   F+    CDE+YYG  C  FC+ ++  + +F C +  +++C PGWKG +C++ +    CDD Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C       KN +       + +C C PGF G  C+++         F     S     N   G+ C C     G 
Sbjct:  108 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDD-QHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCRNGATCTN---TGQGSYTCSCRPGYTGANCELEVDECAPSPC--KNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSD----NPDGGYTCHCPLGFSGF 399          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag1 (jagged 1 [Source:MGI Symbol;Acc:MGI:1095416])

HSP 1 Score: 124.02 bits (310), Expect = 1.444e-28
Identity = 90/327 (27.52%), Postives = 135/327 (41.28%), Query Frame = 2
Query:  440 LKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDC---QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEIC 1387
              WP   R+       +D+ N        I         +  ++      N       + + + CD++YYG  C+ FC+ ++  + ++ C +   + C+ GW G  C++A+C      ++G C  PG+C C  GW G  C+ C   PGC+HG C              + + C C+  WGGQ CD DL  C  + + C NRG C N   D+   Y C C  GYSG +CE+    C  D    +   K  +    C C PG++G  C  N           N+    G C +   GF C C     G  C+     C    C+N   C
Sbjct:  126 FAWP---RSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCN-------------EPWQCLCETNWGGQLCDKDLNYCGTH-QPCLNRGTCSNTGPDK---YQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNID-----DCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSC 427          

HSP 2 Score: 84.3445 bits (207), Expect = 3.190e-16
Identity = 79/257 (30.74%), Postives = 107/257 (41.63%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQIN------DTLQNQIKSFQNSLKSRGYCVNSKEGFHCS 1321
            C E Y G NC+   + C   +  +   +C ET       C PGW G  CS  + DDC    C   G C          C   WTG  C++    CE  P C++           S K    ++ C C PGW GQNCDI++  C      CQN   C     D +N Y C C  GY+G HCE    +C  +         ++I    CLC  GFSG+ CQ++      +  QN  + +  +      C    EG +CS
Sbjct:  324 CPEGYSGPNCEIAEHACL-SDPCHNRGSCKETSSGFECECSPGWTGPTCSTNI-DDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP-CVNA---------RSCKNLIASYYCDCLPGWMGQNCDININDCLGQ---CQNDASCR----DLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCS 561          

HSP 3 Score: 64.6994 bits (156), Expect = 3.970e-10
Identity = 62/213 (29.11%), Postives = 91/213 (42.72%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCKD--KNKVYPNFNCTETVQRI---CLPGWKGIFC--SEALCDD--CQNGRC----VGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHD--KIFPKNLSKILTPNCLCYPGFSGSHCQ 1225
            C + + G++C+    D  +N  +    C + V      C  GWKG  C   ++ CD+  C NG      V    C C  GW G+ C I   S  C+   C      +    +   +FTC CK GW G  C  +   C+ +P  C N G C     D  N Y C+C+ G++G  C +   +CQ          + +I    C+C PG SG+ C 
Sbjct:  655 CSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNIARNS-SCLPNPCHNGGTCV----VNGDSFTCVCKEGWEGPICTQNTNDCSPHP--CYNSGTCV----DGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQCICPPGHSGAKCH 856          

HSP 4 Score: 56.225 bits (134), Expect = 1.571e-7
Identity = 64/221 (28.96%), Postives = 81/221 (36.65%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDL-KLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGY-CVNSKEGFHCSCSNNLGGI 1345
            IC  GW+G  C   + +DC    C   G C          C  GW G  C    +   C    C    G  +        F C C  GW G  C+I     C  NP  C N G C    GD    + C C  G+ G  C   T DC     +  N    +  +    C C PGF+G  C+IN      I   Q+S  + G  CV+   G+ C C     G 
Sbjct:  654 ICSDGWEGAHCENNI-NDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCH--SRDSQCDEATCN-NGGTCYD---EVDTFKCMCPGGWEGTTCNIARNSSCLPNP--CHNGGTCV-VNGDS---FTCVCKEGWEGPICTQNTNDCSPHPCY--NSGTCVDGDNWYRCECAPGFAGPDCRIN------INECQSSPCAFGATCVDEINGYQCICPPGHSGA 853          

HSP 5 Score: 54.6842 bits (130), Expect = 5.398e-7
Identity = 44/157 (28.03%), Postives = 65/157 (41.40%), Query Frame = 2
Query:  881 HGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            HG C+ ++G           FTC C  G+ G  C  ++  C +NP  C+N G C     D +N Y C CS G+ G HCE    DC  +        + L  +  C C  G+ G  C   D+  ++      +  + G C +  + F C C     G 
Sbjct:  602 HGKCKSQSG---------GKFTCDCNKGFTGTYCHENINDCESNP--CKNGGTCI----DGVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEA-----TCNNGGTCYDEVDTFKCMCPGGWEGT 738          

HSP 6 Score: 54.299 bits (129), Expect = 6.565e-7
Identity = 75/279 (26.88%), Postives = 117/279 (41.94%), Query Frame = 2
Query:  629 ECDENYYGSNCDYFCKDKNKVYPNF---NCTETVQRICLPGWKGI-FCSEALCDDCQNGRC----VGPGNCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN----LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNL-GGIC-----KCRFLKCLNKEICIENN 1399
            +C E+Y G NC +  KD  +        +CT  +     P  +G+ + S  +C    +G+C     G   C C +G+TG+ C      CE +P C +G   I+ GV         ++ C C  GW G +C+ ++  C+ NP  C   G C     D +N + C C  G+ G+ C  +  D Q D+    N      ++ T  C+C  G+ G+ C I            N   + G CV + + F C C     G IC      C    C N   C++ +
Sbjct:  550 KCPEDYEGKNCSHL-KDHCRTTTCEVIDSCTVAMASNDTP--EGVRYISSNVCG--PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNP-CKNGGTCID-GV--------NSYKCICSDGWEGAHCENNINDCSQNP--CHYGGTCR----DLVNDFYCDCKNGWKGKTCHSR--DSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNI----ARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGD 801          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dll4 (delta like canonical Notch ligand 4 [Source:MGI Symbol;Acc:MGI:1859388])

HSP 1 Score: 120.939 bits (302), Expect = 7.161e-28
Identity = 95/361 (26.32%), Postives = 145/361 (40.17%), Query Frame = 2
Query:  398 IIKNLNAVLQRFPL-----LKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVAL------DNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIE---------TGVLHSSKLRF------------------KAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP----KNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            ++++ N+   R PL       WP       S +++  +  GD    +      L+     +  + V         N+    +++   + C +NYYG +C   CK ++  + ++ C       CLPGW G +C + +C   C  QNG C  P  C C  GW G  C  C    GC HG C I           G+     L +                  K +TC+C PG+ G++C++ L  C +NP  C+N G C     DQ N Y C C  GY G+HCE  T  C     F     +  ++  +  C C P F+GS+C+     +   +   N   + G C N      C C     G 
Sbjct:   91 VVRDKNSGSGRNPLQLPFNFTWPG----TFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKIWRTDEQNDTLTRLSYSYRVICSDNYYGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECICRPGWQGRLCNECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPKGYTCTCLPGYTGEHCELGLSKCASNP--CRNGGSCK----DQENSYHCLCPPGYYGQHCEHSTLTCADSPCFNGGSCRERNQGSSYACECPPNFTGSNCE-----KKVDRCTSNPCANGGQCQNRGPSRTCRCRPGFTGT 436          

HSP 2 Score: 70.0922 bits (170), Expect = 7.137e-12
Identity = 63/224 (28.12%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQR----ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDT 1237
            CDE + G  CD    +C   +       C+ +  +     CLPG+ G  C   L   C +  C   G+C          C  G+ G +CE     C  SP    G C+         + +  ++ C C P + G NC+  +  CT+NP  C N G C N    +     C+C  G++G HCE+   DC             L   P C C  GFSG  C++  T
Sbjct:  273 CDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPKGYTCTCLPGYTGEHCELGL-SKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHCEHSTLTCADSPCFNGGSCR--------ERNQGSSYACECPPNFTGSNCEKKVDRCTSNP--CANGGQCQNRGPSRT----CRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRIT 481          

HSP 3 Score: 61.6178 bits (148), Expect = 3.039e-9
Identity = 60/188 (31.91%), Postives = 82/188 (43.62%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNC-----------SCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMK-TGD-CQHDKIF-PKNLSKILTPN---CLCYPGFSGSHCQI 1228
            +C PG+ G  C  +    C +  C   G+C            C   +TGSNCE     C  +P    G CQ           R  + TC C+PG+ G +C++ +  C  +P  C + G CH    D  N  +C C AG+SGR CE++ T D C     F        L+PN   C C  GF GS C+ 
Sbjct:  350 LCPPGYYGQHCEHSTLT-CADSPCFNGGSCRERNQGSSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCQN----------RGPSRTCRCRPGFTGTHCELHISDCARSP--CAHGGTCH----DLENGPVCTCPAGFSGRRCEVRITHDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEF 520          

HSP 4 Score: 51.9878 bits (123), Expect = 2.759e-6
Identity = 54/192 (28.12%), Postives = 79/192 (41.15%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQR--------ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLK--LCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTG 1129
            C   YYG +C++    C D     P FN     +R         C P + G  C + + D C +  C   G C          C  G+TG++CE+    C +SP C HG      G  H  +       C+C  G+ G+ C++ +    C + P  C N   C  Y G   N+++C C  G+ G  CE   G
Sbjct:  351 CPPGYYGQHCEHSTLTCADS----PCFNGGSCRERNQGSSYACECPPNFTGSNCEKKV-DRCTSNPCANGGQCQNRGPSRTCRCRPGFTGTHCELHISDCARSP-CAHG------GTCHDLE---NGPVCTCPAGFSGRRCEVRITHDACASGP--CFNGATC--YTGLSPNNFVCNCPYGFVGSRCEFPVG 523          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag2 (jagged 2 [Source:MGI Symbol;Acc:MGI:1098270])

HSP 1 Score: 122.094 bits (305), Expect = 7.714e-28
Identity = 94/329 (28.57%), Postives = 140/329 (42.55%), Query Frame = 2
Query:  440 LKWPSDQRTEISFSLEFDNKN--GDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQN---GRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNN-LGGICK-----CRFLKCLNKEIC 1387
              WP    T I  + ++DN     ++ L + +    ++  ED  K +  +        +   + + CDENYY + C+ FC+ +N  + ++ C +   + C+ GW G  C EA+C    N   G C  PG C C  GW G  C+ C   PGC+HG C              + + C C+  WGG  CD DL  C ++   C N G C N   DQ   YLC C  GY G++CE     C  +          +     C C  G++G  C ++       +   N   + G CV+  +GF C C    +G  C+     C    CLN   C
Sbjct:  136 FAWPR-SFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFS---GHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSC-------------VEPWHCDCETNWGGLLCDKDLNYCGSH-HPCVNGGTCINAEPDQ---YLCACPDGYLGKNCERAEHACASNPCANGGSCHEVPSGFECHCPSGWNGPTCALDID-----ECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSC 438          

HSP 2 Score: 75.485 bits (184), Expect = 1.895e-13
Identity = 70/258 (27.13%), Postives = 102/258 (39.53%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQRI---CLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C + Y G NC+   + C   N      +C E        C  GW G  C+  + D+C +  C   G C          C   W G+ C++    CE  P C++           S K     + C C PGW G NC I++  C      CQ+ G C     D +N Y C C  G+ GRHCE++   C         + + L     C C  G SG HC+++  L         +      C N +  ++C+C  + GG
Sbjct:  335 CPDGYLGKNCERAEHACA-SNPCANGGSCHEVPSGFECHCPSGWNGPTCALDI-DECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKP-CLNAF---------SCKNLIGGYYCDCLPGWKGINCQININDCHGQ---CQHGGTCK----DLVNGYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSPCLNGA-----RCYNLEGDYYCACPEDFGG 568          

HSP 3 Score: 65.0846 bits (157), Expect = 3.456e-10
Identity = 64/196 (32.65%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  728 ICLPGWKGIFC--SEALCD--DCQNG-RCVGPGN---CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIF--PKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRG 1285
             C  GWKG  C   E  CD   C NG  C   G+   C+C  GW GS C I  K+  C+   C +  G    S     +F+C C+ GW G+ C  +   C  NP  C N GIC     D +N + C+C+ G++G  C +   +CQ          + +I    C C PG SG  CQ       ++  F     SRG
Sbjct:  699 ACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCTI-AKNSSCVPNPC-VNGGTCVGSG---DSFSCICRDGWEGRTCTHNTNDC--NPLPCYNGGICV----DGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQ-------EVVIFTRPCWSRG 876          

HSP 4 Score: 61.6178 bits (148), Expect = 3.920e-9
Identity = 65/217 (29.95%), Postives = 89/217 (41.01%), Query Frame = 2
Query:  788 NGRCVG-PG---NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEICIEN 1396
            +G CV  PG   +C C  G+TG+ C   E    CM   C+     +        +F C C  GW G+ CDI+   C  +P  C +RG C+    D +N + C C  G+ G+ C  +   C  D     N         T  C C PG+ GS C    T+        N   + G CV S + F C C +   G  C      C  L C N  IC++ 
Sbjct:  609 HGHCVSLPGGNFSCICDSGFTGTYCH--ENIDDCMGQPCRNGGTCID----EVDSFRCFCPSGWEGELCDINPNDCLPDP--CHSRGRCY----DLVNDFYCACDDGWKGKTCHSREFQC--DAYTCSNGGTCYDSGDTFRCACPPGWKGSTC----TIAKNSSCVPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDG 807          

HSP 5 Score: 60.8474 bits (146), Expect = 6.371e-9
Identity = 69/226 (30.53%), Postives = 93/226 (41.15%), Query Frame = 2
Query:  710 TETVQRICLPGWKGIFC----SEALCDDCQN-GRCVGPGN---CSCYRGWTGSNCEICE---KSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDL-KLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGY-CVNSKEGFHCSCSNNLGG 1342
             ++ +  C  GW+G  C    ++ L D C + GRC    N   C+C  GW G  C   E    +  C +G    ++G           F C+C PGW G  C I     C  NP  C N G C    GD    + C C  G+ GR C   T DC     +   +    +    C C PGF+G  C+IN      I   Q+S  + G  CV+   G+ CSC     G
Sbjct:  655 VDSFRCFCPSGWEGELCDINPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSG---------DTFRCACPPGWKGSTCTIAKNSSCVPNP--CVNGGTCVGS-GDS---FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRIN------IDECQSSPCAYGATCVDEINGYRCSCPPGRSG 859          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dlk1 (delta like non-canonical Notch ligand 1 [Source:MGI Symbol;Acc:MGI:94900])

HSP 1 Score: 93.5893 bits (231), Expect = 1.551e-20
Identity = 61/193 (31.61%), Postives = 89/193 (46.11%), Query Frame = 2
Query:  779 DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTG-------DCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNL 1336
            D Q G C     C C+ GW G  C+ C  +PGC++G+C+             + + C CK GW G+ C+ID++ CT+ P  C N G C +    Q   Y C C+ G+SG+ C+ K G        CQH      +  +    +CLC PGFSG+ C+I   +        N  ++ G C +    F C C    
Sbjct:   31 DPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCK-------------EPWQCICKDGWDGKFCEIDVRACTSTP--CANNGTCVDLEKGQ---YECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEI---VAATNSCTPNPCENDGVCTDIGGDFRCRCPAGF 202          

HSP 2 Score: 53.9138 bits (128), Expect = 3.023e-7
Identity = 48/156 (30.77%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  698 NFNCTETVQRICLPGWKGIF-------CSEALCDDCQNGRCV----GPGNCSCYRGWTGSNCE------ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHC 1114
            N  C E  Q IC  GW G F       C+   C +  NG CV    G   CSC  G++G +C+      +   SP C HG      G     + +    +C C PG+ G  C+I     +  P  C+N G+C +  GD    + C+C AG+  + C
Sbjct:   65 NGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCAN--NGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSP-CQHG------GACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGD----FRCRCPAGFVDKTC 207          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q9IAT6|DLLC_DANRE (Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.967e-36
Identity = 124/449 (27.62%), Postives = 187/449 (41.65%), Query Frame = 2
Query:  131 RLLIILLFNFFPKKLCWHTGRIMDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWP--------------SDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP----NCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG-FHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            R+L+   F      L   +G + ++K LSF+  S + K              S D  I  R     +Q  +L     T      + +++   + +A +      KWP              SDQ TE          N +  +++    ++L   ED  +++ +   +  +F    +    CDE Y+G  C  FC+ +N  + +FNC     RICLPGWKG +C+E +C   C  +NG C  PG C C  GW G  C+ C + PGC+HG C              + F C+CK GWGG  C+ DL  CTN+ K C+N   C N        Y C C  G+SG++CE++T +C  +    KN            C C  GF G +C+++         F       G C+    G + C C     G      I +C    C N   C++
Sbjct:    3 RVLLTCFFILISSHLGKSSG-VFELKVLSFTSTSSVCK-------------GSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSEILSADSISSSAYISVPFNFKWPGIVSLIIETWNAETSDQSTE----------NNNNMISRLATKRRLAISEDWSQDVHLGRQSQLRFSYRVV----CDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN-------------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTN---TGQGSYTCICKPGFSGKNCEIETNECDSNPC--KNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNG-----GTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLD 399          

HSP 2 Score: 68.1662 bits (165), Expect = 1.761e-10
Identity = 64/221 (28.96%), Postives = 95/221 (42.99%), Query Frame = 2
Query:  632 CDENYYGSNCDY---FCKDKNKVYPNFNCTETVQR----ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQI 1228
            C E + G  C+    FC +      +  CT T Q     IC PG+ G  C E   ++C +  C   G+C         +C +G+ G NCE+    C   P C +G   +E G          +++C C PG+ G NC+  +  C+++P  C N G C     D  N   C+C  G++G  CE    DC  +        +  I    C C  GFSG  C++
Sbjct:  253 CKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNC-EIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCADGP-CFNGGTCMEKGS--------GSYSCRCPPGYMGSNCEKKIDRCSSDP--CANGGQCL----DLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRV 457          

HSP 3 Score: 62.7734 bits (151), Expect = 8.318e-9
Identity = 55/191 (28.80%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  632 CDENYYGSNCD---YFCKDKNKVYPNFNCTETVQR-------ICLPGWKGIFCSEAL----CDDCQNG-RCVGPGN---CSCYRGWTGSNCEI---------CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMK 1123
            C + +YG NC+     C D     P FN    +++        C PG+ G  C + +     D C NG +C+  GN   C C  G+TGS CE          C+ +  C+ G+                 +TC+C  G+ G++C +    C+  P  CQN G C+ ++   +    CQC AG+ G  CE K
Sbjct:  331 CPQGFYGKNCEVSAMTCADG----PCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGI---------------NGYTCTCTLGFSGKDCRVRSDACSFMP--CQNGGTCYTHFSGPV----CQCPAGFMGTQCEYK 496          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|P97677|DLL1_RAT (Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.417e-34
Identity = 95/340 (27.94%), Postives = 151/340 (44.41%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEAL----CDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + ++   F+    CDE+YYG  C  FC+ ++  + +F C E  +++C PGWKG +C++ +    CDD Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C             L  + +C C PGF G  C+++         F     S     N   G+ C C     G      I  C    C N   C++
Sbjct:  108 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKMCDPGWKGQYCTDPICLPGCDD-QHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCRNGATCTN---TGQGSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSD----NPDGGYTCHCPAGFSGFNCEKKIDLCSSSPCSNGAKCVD 421          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|O00548|DLL1_HUMAN (Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 8.689e-34
Identity = 99/342 (28.95%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + K+   F+    CDE+YYG  C  FC+ ++  + +F C E  +++C PGWKG +C+E +C    D Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G  CE+   +C  D    KN         + +C C PGF G  C+++         F       G C +S + G+ C C     G      I  C    C N   C++
Sbjct:  109 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTN---TGQGSYTCSCRPGYTGATCELGIDEC--DPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNG-----GRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVD 422          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q8UWJ4|DLLD_DANRE (Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 2.205e-33
Identity = 88/293 (30.03%), Postives = 138/293 (47.10%), Query Frame = 2
Query:  485 EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGGI 1345
            +   +N D+ +++    + L   E+  +++ V      K+   F+    CDE+YYG  C  FC+ ++  + +F C E  + IC  GWKG +C+E +C    D  +G C  PG C C  G++G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K CQN   C N        Y C C  G++G  CE++  +C             L  T +C C PGF G +C+++         F       G+C ++ E G+ C C     G 
Sbjct:  132 DLSTENPDRLISRMTTQRHLTVGEEWSQDLQVGGRTELKYSYRFV----CDEHYYGEGCSVFCRPRDDTFGHFTCGERGEIICNSGWKGQYCTEPICLPGCDEDHGFCDKPGECKCRVGFSGKYCDDCIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCQNGATCTN---TGQGSYTCSCRPGFTGDSCEIEVNECSGSPCRNGGSCTDLENTYSCTCPPGFYGRNCELSAMTCADGPCFNG-----GHCADNPEGGYFCQCPMGYAGF 398          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q61483|DLL1_MOUSE (Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 2.536e-33
Identity = 90/320 (28.12%), Postives = 146/320 (45.62%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEAL----CDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            RFP    WP       +        +   +N ++ +++    + L   E+  +++  +   + ++   F+    CDE+YYG  C  FC+ ++  + +F C +  +++C PGWKG +C++ +    CDD Q+G C  PG C C  GW G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  GY+G +CE++  +C       KN +       + +C C PGF G  C+++         F     S     N   G+ C C     G 
Sbjct:  108 RFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFV----CDEHYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDD-QHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCRNGATCTN---TGQGSYTCSCRPGYTGANCELEVDECAPSPC--KNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSD----NPDGGYTCHCPLGFSGF 399          
BLAST of Delta-like protein vs. TrEMBL
Match: W6US92 (Delta-like protein OS=Echinococcus granulosus OX=6210 GN=EGR_03907 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.326e-39
Identity = 110/353 (31.16%), Postives = 160/353 (45.33%), Query Frame = 2
Query:  407 NLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYLTKFIHA---KKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI-CLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDT--LQNQIK-----------SFQNSLKSRGYCVNSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            NL A ++    L + S   +  S  L     + D  L   +     K   R   T + +  A + N    +T      C  +YYG  C+ +C  ++ +  ++ C     RI CLPGW+G  C+EALC + C +G C  PG C C  GW G  C  C   PGC HG C+      + +  + + FTC C+PGW G  C +D + C+N+P  C N G+CHN   +    Y CQC  GY G HCE    DC+  +     + +    NC C+ GF GS+CQ + T   QN  +           + ++ L+S    +N    F C C   L G      I +C    CL+   C+E
Sbjct:  141 NLYAKMEASEQLPFRSTISSVFSTLLSLPQPSTDAILLTRLQPLLIKGRPRNVWTTQTLQSAAEPNPHIRLTLSYRFACPPDYYGEACERYCSPRDSLLGHYKCDPKDGRIVCLPGWRGSQCNEALCKNGCLHGTCDSPGVCKCREGWEGEACNHCIPFPGCGHGTCK-----FNWTLGQHEPFTCECQPGWSGMLCTVDTQFCSNHPDTCLNDGVCHNTPTETSPGYACQCPLGYEGYHCETSNQDCRVHRCSGHGICQT-NGNCACFDGFYGSNCQFDQTECWQNPCQGNNSVCIPVKNTSESDLQSTKVAIN----FRCECQPGLSGMNCERKIRRCDARPCLHGGKCVE 483          

HSP 2 Score: 68.5514 bits (166), Expect = 4.467e-8
Identity = 65/223 (29.15%), Postives = 93/223 (41.70%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPG------NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGV-----------LHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C  G++G  C E    DC+  RC G G      NC+C+ G+ GSNC+  +    C    CQ    V           L S+K+    F C C+PG  G NC+  ++ C   P  C + G C     D  + Y C C +GY GRHCE+    CQH         + +     C C  G++G  C+     QN  +      K+   C +    + C C+    G
Sbjct:  367 CPLGYEGYHC-ETSNQDCRVHRCSGHGICQTNGNCACFDGFYGSNCQFDQTE--CWQNPCQGNNSVCIPVKNTSESDLQSTKVAIN-FRCECQPGLSGMNCERKIRRCDARP--CLHGGKCVELAQDS-DGYQCVCLSGYRGRHCELNDSVCQHLPCANGGQCVDRAHHVECRCPLGWTGPTCR-----QNVNECTTPICKNGAACRDRPGTYECLCTPGWTG 577          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A0R3U2I3 (Delta-like protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS676 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.479e-39
Identity = 100/291 (34.36%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  392 NSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYL-TKF--IHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI-CLPGWKGIFCSEALCD-DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQ 1249
              +++ L  VL+  PL          + FSL   +  GD+ L T+F  +  K+  R   T + +    D+     +T    I C  NYYG  C+ +C  ++    ++ C     RI CLPGW+G  C+EA+C   C +G C  PG C C  GW G  C+ C   PGC HG C+    + H      + FTC CKPGW G  C ID + C+N+P  C N G+CH+   + +  Y CQC  GY G HCE    DC+  +     + +    +C C+ GF G +CQ N T  +Q
Sbjct:   55 GGLVRKLT-VLKAGPL---------HLQFSLYHRSPIGDEVLLTQFSPLSIKERPRRVWTTQTLKTP-DSAIAITLTLSHRISCPPNYYGDACERYCAPRDSDLGHYKCDSKDGRIVCLPGWRGSQCTEAICKAGCLHGTCESPGVCKCREGWEGDACDQCIPFPGCTHGTCKFNLSLGH-----HEPFTCECKPGWSGMLCTIDTQYCSNHPHTCLNGGVCHSTPTETLPGYTCQCPLGYEGYHCESPNQDCRVYRCSSHGICQT-NGDCACFDGFYGPNCQFNQTHCSQ 328          

HSP 2 Score: 63.5438 bits (153), Expect = 1.477e-6
Identity = 54/168 (32.14%), Postives = 77/168 (45.83%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHD--KIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNS 1300
            C C  G TG NCE+    C+  P C+H    +E       +L    + C C PG+ G++C++    C + P  C N G C     D+ N   C C AG+SG  C     +C++   K          T  CLC PG++G  C I  +L N   S  NS  +R  C++S
Sbjct:  359 CECQAGLTGRNCELKIRHCDSRP-CLHDGKCVEL------QLGSDGYQCICLPGFRGRHCELPNSACQHLP--CANGGQC----VDRANRVECHCPAGWSGPTCRQNVNECKNPVCKNGAACRDHPGTYECLCAPGWTGQDCDIPTSLYN--VSDANSTTARPGCISS 511          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A5K3EVY9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.564e-39
Identity = 110/335 (32.84%), Postives = 156/335 (46.57%), Query Frame = 2
Query:  467 EISFSLEFDNKNGDKYL-TKF--IHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI-CLPGWKGIFCSEALCD-DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV----------NSKE--GFHCSCSNNLGG------ICKCRFLKCLNKEICIENNL 1402
             + FSL   +  GD+ L T+F  +  K+  R   T + +    D+     +T    I C  NYYG  C+ +C  ++    ++ C     RI CLPGW+G  C+EA+C   C +G C  PG C C  GW G  C+ C   PGC HG C+    + H      + FTC CKPGW G  C ID + C+N+P  C N G+CH+   + +  Y CQC  GY G HCE    DC+  +     + +    +C C+ GF G +CQ N T  +Q         S+  C+          N+K+   + C C   L G      I  C    CL+   C+E  L
Sbjct:  104 HLQFSLYHRSPIGDEVLLTQFSPLSIKERPRRVWTTQTLKTP-DSAIAITLTLSHRISCPPNYYGDACERYCAPRDSDLGHYKCDSKDGRIVCLPGWRGSQCTEAICKAGCLHGTCESPGVCKCREGWEGDACDQCIPFPGCTHGTCKFNLSLGH-----HEPFTCECKPGWSGMLCTIDTQYCSNHPHTCLNGGVCHSTPTETLPGYTCQCPLGYEGYHCESPNQDCRVYRCSSHGICQT-NGDCACFDGFYGPNCQFNQTHCSQ----HPCQGSQSLCIPLNNTTPQPANAKKIINYRCECQAGLTGRNCELKIRHCDSRPCLHDGKCVELQL 427          

HSP 2 Score: 63.929 bits (154), Expect = 1.040e-6
Identity = 66/237 (27.85%), Postives = 99/237 (41.77%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGN--------CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHD--KIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNS 1300
            C + +YG NC +     N+ + + +  +  Q +C+P                N     P N        C C  G TG NCE+    C+  P C+H    +E       +L    + C C PG+ G++C++    C + P  C N G C     D+ N   C C AG+SG  C     +C++   K          T  CLC PG++G  C I  +L N   S  NS  +R  C++S
Sbjct:  344 CFDGFYGPNCQF-----NQTHCSQHPCQGSQSLCIP---------------LNNTTPQPANAKKIINYRCECQAGLTGRNCELKIRHCDSRP-CLHDGKCVEL------QLGSDGYQCICLPGFRGRHCELPNSACQHLP--CANGGQC----VDRANRVECHCPAGWSGPTCRQNVNECKNPVCKNGAACRDHPGTYECLCAPGWTGQDCDIPTSLYN--VSDANSTTARPGCISS 545          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A0V0J1Q4 (Delta-like protein OS=Schistocephalus solidus OX=70667 GN=TR113768 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.005e-39
Identity = 109/325 (33.54%), Postives = 146/325 (44.92%), Query Frame = 2
Query:  587 DNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI-CLPGWKGIFCSEALCDD-CQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINH---YLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDT-----------------------LQNQIK-SFQ---------------------NSLKSRGYCVNSKEGFHCSCSNNLGGI------CKCRFLKCLNKEICIE 1393
            D  A+  +T      C  NY+G  C+ FC  ++ V  ++ C     RI CLPGW+G  C+EA+C+D C +G C+ PG C C  GW G+ C  C    GC HG C       H      + FTCSC+PGWGG  C ID+K C+N+P  CQ+ GIC N    Q+     Y+CQC  G+ G HCE K   C+        L +  + NC C+ GF G++CQ N T                       L NQI  +F+                     N  K  G CV+  EG+ C C     G         C+ L C N   C++
Sbjct:  228 DQAAQLHITLSYRFICSPNYFGQTCERFCAPRDSVQGHYRCDPKDGRIVCLPGWRGTHCTEAICEDGCIHGDCIAPGVCKCLSGWQGATCSDCMPISGCKHGGCLFNWTTGHR-----EPFTCSCEPGWGGMLCSIDMKFCSNHPDTCQHGGICRNIQ-PQVGASPGYVCQCPLGFEGYHCERKNHHCRAHGCNGNGLCQ-ESGNCSCFNGFYGANCQFNQTQCSQNPCQGEHSVCTEVVAPMPSLANQITVNFRCDCPANRRGTNCELVVNHCESNPCKHGGICVDMPEGYQCVCLLGYKGRHCELPDSACQHLPCANGGQCVD 545          

HSP 2 Score: 70.0922 bits (170), Expect = 1.545e-8
Identity = 57/194 (29.38%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  788 NGRCVGPGNCSCYRGWTGSNCEI----CEKSPGCM--HGMCQIETGVLHSSKLRFKA-FTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            NG C   GNCSC+ G+ G+NC+     C ++P C   H +C      + S   +    F C C     G NC++ +  C +NP  C++ GIC     D    Y C C  GY GRHCE+    CQH         + +     C+C PG++G  C+ N       +      K+   C +    + C C++   G
Sbjct:  417 NGLCQESGNCSCFNGFYGANCQFNQTQCSQNP-CQGEHSVCTEVVAPMPSLANQITVNFRCDCPANRRGTNCELVVNHCESNP--CKHGGICV----DMPEGYQCVCLLGYKGRHCELPDSACQHLPCANGGQCVDRANRVECICPPGWTGLTCRANVNECALSRDEPPICKNGAACRDRPGTYECLCTSGWTG 603          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A564YA69 (Delta-like protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3840 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.172e-39
Identity = 104/302 (34.44%), Postives = 143/302 (47.35%), Query Frame = 2
Query:  530 HAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRI-CLPGWKGIFCSEALCD-DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDT--LQNQIKSFQNSLKSRGYCVNSKEG--FHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            H +K+     T + +    D      +T    I C  +YYG +C+ +C  ++    ++ C     RI CLPGW+G  C+EA+C   C +G C  PG C C  GWTG  CE C   PGC HG C+    + +      + FTC C+ GW G  C ID + C+N+P+ C N G+CHN   +    Y CQC  GY G HCE+   DC   +++  N   I   N  C C   F GS+CQ N T   QN  +  ++  K+      S     F C C   L G      I KC    CL+   C+E
Sbjct:  159 HPRKIW----TTQNLHSTTDTAPSIRLTLSYRIACPPDYYGEDCERYCAPRDSPLGHYKCDPKDGRIVCLPGWEGSQCTEAICKKGCIHGICESPGVCKCREGWTGETCEECIPFPGCKHGACKFNYSLGYQ-----EPFTCECQTGWSGMLCTIDTQYCSNHPETCLNGGVCHNTATETTPGYTCQCPLGYEGYHCEISNHDC---RVYGCNGHGICQTNGSCSCSDAFYGSNCQFNQTACWQNPCQGEKSVCKTLNENPKSSLAINFQCQCQPGLSGMNCENKIRKCDARPCLHGGKCVE 448          

HSP 2 Score: 69.3218 bits (168), Expect = 2.346e-8
Identity = 63/222 (28.38%), Postives = 94/222 (42.34%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQ------NGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKA-----FTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDK-------IFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C  G++G  C E    DC+      +G C   G+CSC   + GSNC+  + +  C    CQ E  V  +     K+     F C C+PG  G NC+  ++ C   P  C + G C     D+   Y C C  G+ GRHCE+    CQH         ++  N  +     C C PG++G  C+     +N  +  +   K+   C N    + C C+    G
Sbjct:  337 CPLGYEGYHC-EISNHDCRVYGCNGHGICQTNGSCSCSDAFYGSNCQFNQTA--CWQNPCQGEKSVCKTLNENPKSSLAINFQCQCQPGLSGMNCENKIRKCDARP--CLHGGKCVEL-ADEYEGYQCICLPGHRGRHCELSDSACQHHPCANGGQCVYRANHVE-----CRCLPGWTGPTCR-----ENVNECLKPVCKNGAACRNRPGTYECLCTPGWTG 542          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dll4 (delta like canonical Notch ligand 4 [Source:NCBI gene;Acc:103028783])

HSP 1 Score: 143.28 bits (360), Expect = 3.577e-35
Identity = 102/336 (30.36%), Postives = 144/336 (42.86%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEI-SFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQ--NGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG--FHCSCSNNLGG------ICKCRFLKCLNKEICI 1390
            R P    WP      I ++    D+ N D  ++ F   ++L    +  +++        ++   FI    C+ENYYG +C   C  ++  + ++ C    Q  CLPGWKG +C E +C   C   NG C  PG C C  GW G+ C  C+K P C HG C              + + C+CK GWGG  CD DL  CT++ K C+N   C N        Y C C  GY+G +CE++   C  +    +     L     C C PGF GSHC+ +      +  FQ      G C     G  + C C     G      + KC  L C N   C+
Sbjct:   96 RLPFSFGWPGSFSLIIEAWYSPVDSNNSDLKISTFAIQRQLDVGAEWSQDVQSGQQTELRYSYRFI----CNENYYGDSCSKICAPRDDRFGHYTCNPDGQLSCLPGWKGEYCEEPICLKGCSEANGNCSKPGECVCREGWQGTFCTECKKHPVCKHGTCN-------------QPWQCNCKEGWGGLFCDQDLNFCTHH-KPCKNGATCMN---TGQGSYTCTCMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYMCTCLPGFEGSHCEHSLLTCADMPCFQG-----GKCHEKDNGRSYSCDCPRGYTGLNCEKRVDKCTTLPCANGGACV 405          

HSP 2 Score: 87.4261 bits (215), Expect = 1.967e-17
Identity = 73/220 (33.18%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTE---TVQRICLPGWKGIFCSEAL--CDDC---QNGRCVGPGN-----CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL---TPNCLCYPGFSGSHCQ 1225
            C   Y G NC+   +  D N      +CTE        CLPG++G  C  +L  C D    Q G+C    N     C C RG+TG NCE     C   P    G C +  GV            CSC+ G+ GQ C+I++  C +NP  C N G CH    D+I+ Y+C C  GY GR+C + T  C             +    P C C  GF+G  C+
Sbjct:  299 CMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYMCTCLPGFEGSHCEHSLLTCADMPCFQGGKCHEKDNGRSYSCDCPRGYTGLNCEKRVDKCTTLPCANGGACVVLGGVR----------MCSCRAGFTGQRCEININDCASNP--CANGGTCH----DRISDYICSCPPGYGGRNCNLLTTACPAQLCLNGGSCATIPGGPPACFCPSGFTGPRCE 502          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dll4 (delta like canonical Notch ligand 4 [Source:NCBI gene;Acc:103028783])

HSP 1 Score: 143.28 bits (360), Expect = 4.460e-35
Identity = 102/336 (30.36%), Postives = 144/336 (42.86%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEI-SFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQ--NGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG--FHCSCSNNLGG------ICKCRFLKCLNKEICI 1390
            R P    WP      I ++    D+ N D  ++ F   ++L    +  +++        ++   FI    C+ENYYG +C   C  ++  + ++ C    Q  CLPGWKG +C E +C   C   NG C  PG C C  GW G+ C  C+K P C HG C              + + C+CK GWGG  CD DL  CT++ K C+N   C N        Y C C  GY+G +CE++   C  +    +     L     C C PGF GSHC+ +      +  FQ      G C     G  + C C     G      + KC  L C N   C+
Sbjct:   80 RLPFSFGWPGSFSLIIEAWYSPVDSNNSDLKISTFAIQRQLDVGAEWSQDVQSGQQTELRYSYRFI----CNENYYGDSCSKICAPRDDRFGHYTCNPDGQLSCLPGWKGEYCEEPICLKGCSEANGNCSKPGECVCREGWQGTFCTECKKHPVCKHGTCN-------------QPWQCNCKEGWGGLFCDQDLNFCTHH-KPCKNGATCMN---TGQGSYTCTCMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYMCTCLPGFEGSHCEHSLLTCADMPCFQG-----GKCHEKDNGRSYSCDCPRGYTGLNCEKRVDKCTTLPCANGGACV 389          

HSP 2 Score: 87.4261 bits (215), Expect = 2.359e-17
Identity = 73/220 (33.18%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTE---TVQRICLPGWKGIFCSEAL--CDDC---QNGRCVGPGN-----CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL---TPNCLCYPGFSGSHCQ 1225
            C   Y G NC+   +  D N      +CTE        CLPG++G  C  +L  C D    Q G+C    N     C C RG+TG NCE     C   P    G C +  GV            CSC+ G+ GQ C+I++  C +NP  C N G CH    D+I+ Y+C C  GY GR+C + T  C             +    P C C  GF+G  C+
Sbjct:  283 CMPGYTGVNCELEVRQCDSNPCRNRGHCTELDNGYMCTCLPGFEGSHCEHSLLTCADMPCFQGGKCHEKDNGRSYSCDCPRGYTGLNCEKRVDKCTTLPCANGGACVVLGGVR----------MCSCRAGFTGQRCEININDCASNP--CANGGTCH----DRISDYICSCPPGYGGRNCNLLTTACPAQLCLNGGSCATIPGGPPACFCPSGFTGPRCE 486          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dld (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:103044307])

HSP 1 Score: 140.969 bits (354), Expect = 2.165e-34
Identity = 92/318 (28.93%), Postives = 146/318 (45.91%), Query Frame = 2
Query:  428 RFPL-LKWPSD-----QRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL--TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV-NSKEGFHCSCSNNLGGI 1345
            RFP    WP       +      + +   +N ++ +++    + L   E+  +++ V      K+   F+    CDE+YYG  C  FC+ ++  + +F C E  + IC  GWKG +C+E +C    D ++G C  PG C C  G+TG  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C+N   C N        Y C C  G++G  CE++  +C  +          +  T NC C PG+ G +C+++         F       G C  NS+ G+ C C     G 
Sbjct:  112 RFPFGFTWPGTFSLIIEALHTDSNEDLSTENPERLISRMTTQRHLTVGEEWSQDLQVTGRTELKYSYRFM----CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFTGKYCDDCIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCENGATCTN---TGQGSYTCACRPGFTGASCEIEVNECSDNPCRNGGSCTDMENTYNCACPPGYYGRNCELSAMTCADGPCFNG-----GRCADNSEGGYFCECPTGYVGF 403          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 136.732 bits (343), Expect = 5.398e-33
Identity = 99/348 (28.45%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFDNKNGDKYLTK--FIHAKKLLRYEDTRKEITVALDNNAKF-----LMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDC---QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK----ILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV--NSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIENNL 1402
            R P   KWP       +FSL  D     +  ++    +   +L    T++ + V   N  K       + +   + CDE+YYG +C  +C+ ++  + ++ C  T  R+CL GWKG +C++ +C      ++G C  PG C C  GW G  C+ C + PGC HG C              + + C CK GWGG  C+ DL  CTN+ K C+N   C N        Y C C  G++G+ CE+     + D    KN       +   +C C  GF G +C+I+     +   F       G C+  ++  G+ C C     G      I +C    C N  IC +  L
Sbjct:  118 RVPFYFKWPG------TFSLIIDAWKASESTSEQSIENPDNVLIRLATKRTLAVGDSNQGKHNQNQSELLYSYHVACDEHYYGDSCSDYCRPRDDTFGHYTCDSTGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQCDECTRYPGCSHGTCD-------------QPWQCICKEGWGGLFCNQDLNFCTNH-KPCKNDATCTN---TGQGSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSCNDMLNDYSCTCPQGFYGKNCEISAMTCAERPCFNG-----GTCITDDTTGGYSCRCPPGYMGSNCEKKIDRCSSNPCANGGICRDQGL 437          

HSP 2 Score: 76.2554 bits (186), Expect = 6.337e-14
Identity = 63/210 (30.00%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  623 SIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILT----PNCLCYPGFSGSHCQ 1225
            S  C + +YG NC+             +     +R C  G         + DD   G      +C C  G+ GSNCE     C  +P    G+C+ + G+         +F C C+PG+ G  C+I++  C  NP  C+N G C     D IN Y C+C+ GY+G+ C +++  C    + P +N     T    P C C PGF GS C+
Sbjct:  362 SCTCPQGFYGKNCE------------ISAMTCAERPCFNG------GTCITDDTTGGY-----SCRCPPGYMGSNCEKKIDRCSSNPCANGGICR-DQGL---------SFVCQCRPGFRGSRCEINIDECARNP--CRNAGTCV----DGINDYTCKCTLGYTGKDCGVRSDTCS---LMPCENGGTCYTHFSGPVCQCPPGFMGSRCE 529          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 136.732 bits (343), Expect = 5.875e-33
Identity = 99/348 (28.45%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFDNKNGDKYLTK--FIHAKKLLRYEDTRKEITVALDNNAKF-----LMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDC---QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK----ILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCV--NSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIENNL 1402
            R P   KWP       +FSL  D     +  ++    +   +L    T++ + V   N  K       + +   + CDE+YYG +C  +C+ ++  + ++ C  T  R+CL GWKG +C++ +C      ++G C  PG C C  GW G  C+ C + PGC HG C              + + C CK GWGG  C+ DL  CTN+ K C+N   C N        Y C C  G++G+ CE+     + D    KN       +   +C C  GF G +C+I+     +   F       G C+  ++  G+ C C     G      I +C    C N  IC +  L
Sbjct:  118 RVPFYFKWPG------TFSLIIDAWKASESTSEQSIENPDNVLIRLATKRTLAVGDSNQGKHNQNQSELLYSYHVACDEHYYGDSCSDYCRPRDDTFGHYTCDSTGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQCDECTRYPGCSHGTCD-------------QPWQCICKEGWGGLFCNQDLNFCTNH-KPCKNDATCTN---TGQGSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSCNDMLNDYSCTCPQGFYGKNCEISAMTCAERPCFNG-----GTCITDDTTGGYSCRCPPGYMGSNCEKKIDRCSSNPCANGGICRDQGL 437          

HSP 2 Score: 76.2554 bits (186), Expect = 6.316e-14
Identity = 63/210 (30.00%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  623 SIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILT----PNCLCYPGFSGSHCQ 1225
            S  C + +YG NC+             +     +R C  G         + DD   G      +C C  G+ GSNCE     C  +P    G+C+ + G+         +F C C+PG+ G  C+I++  C  NP  C+N G C     D IN Y C+C+ GY+G+ C +++  C    + P +N     T    P C C PGF GS C+
Sbjct:  362 SCTCPQGFYGKNCE------------ISAMTCAERPCFNG------GTCITDDTTGGY-----SCRCPPGYMGSNCEKKIDRCSSNPCANGGICR-DQGL---------SFVCQCRPGFRGSRCEINIDECARNP--CRNAGTCV----DGINDYTCKCTLGYTGKDCGVRSDTCS---LMPCENGGTCYTHFSGPVCQCPPGFMGSRCE 529          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 112.849 bits (281), Expect = 8.022e-26
Identity = 81/286 (28.32%), Postives = 130/286 (45.45%), Query Frame = 2
Query:  500 NGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPG--NCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKI------FPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC 1324
            +G + +T+  ++  +   +       V         + + L + CDE+Y+ +NC   CK ++  + ++ C     ++CL GW G  C +A+C      ++G+C  PG  NC C  GW G  C+ C   PGC+HG C              K + C C   WGG  CD DL  C N+ + C+N G C N    Q + Y C C  GY G +CE+     QH  +         ++       CLC PG++G++C      ++  +   +   + G C+N   GF C+C
Sbjct:    7 SGTQLITRVTYSGMINPGDQWHNHSAVGA---RAVTVDYRLRVMCDEHYFSTNCTKLCKPRDDYFGHYACDSNGNKVCLDGWTGGDCKKAICRQGCSTEHGQCDNPGECNCRCQYGWQGHFCDQCIPYPGCVHGGCS-------------KPWECRCDTNWGGLLCDKDLNYCGNH-QPCRNGGSCSNA---QPDSYKCDCQKGYHGVNCEIDY--VQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANC-----TEDIDECASSPCGNGGTCLNLVNGFRCTC 265          

HSP 2 Score: 93.5893 bits (231), Expect = 8.218e-20
Identity = 74/229 (32.31%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK--ILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEG-FHCSCSNNLGGICKCRFLK 1366
            +C PGW G  C+E + D+C +  C   G C         +C   WTG  C +    C+ +P C+H           S K  F  + C C PGW GQNCDID+  C      C N G C     D +N Y C+C  GY+GR CE +  +C           +  I +  C+C  GF+G  C+++  L        N  ++   CVN   G + C CS N  G   C  LK
Sbjct:  226 LCAPGWTGANCTEDI-DECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDDNP-CVH---------ARSCKNLFGGYYCGCLPGWTGQNCDIDVNDCEGK---CLNGGTCK----DLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDL-----CVPNPCQNGARCVNLPNGDYFCHCSENFEGT-NCTLLK 430          

HSP 3 Score: 68.1662 bits (165), Expect = 4.974e-12
Identity = 70/227 (30.84%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  731 CLPGWKG-------IFCSEALCDDCQNGRCVGPGN---CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHC-EMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNK 1378
            C  GWKG         C EA C++   G C   G+   CSC  GW G  C I  +S  CM   CQ     +    +   ++ C C+ GW G NC  D+  C+++P  C N G C     D  N Y C+C+AG++G    E ++  C  D      + +I    C+C  G +G HC      Q  + S +N      +    +E   C CSN   G   C  + C NK
Sbjct:  560 CKNGWKGKTCHSKISHCDEATCNN--GGECFDVGDTFRCSCPTGWEGPTCNI-AQSIACMPNPCQNGATCV----ISGDSYKCICQSGWEGANCTQDINDCSSHP--CYNGGTCV----DGTNWYRCECAAGFAGEDINECQSMPCAKDATC---IDEINGYRCMCPLGRAGRHCHDEVPTQPCVASGRNHSHGSSW---KEECNMCHCSN---GNINCTKVWCGNK 764          

HSP 4 Score: 59.3066 bits (142), Expect = 2.734e-9
Identity = 64/217 (29.49%), Postives = 86/217 (39.63%), Query Frame = 2
Query:  788 NGRCV----GPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTN-NPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKIL----TPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            NGRC+    G   C C  G+ GS C   E    C  G C      L        +F C C  GW G+ C+ D+  C+N NP  C N G CH    D +N + C+C  G+ G+ C  K   C  D+    N  +      T  C C  G+ G  C I       I    N  ++   CV S + + C C +   G      I  C    C N   C++
Sbjct:  468 NGRCLSQAGGNFTCMCNSGFRGSFCH--ENVNDCAEGACHNGGTCLDG----INSFQCMCPDGWDGEFCENDVDDCSNHNP--CLNGGTCH----DLVNDFSCECKNGWKGKTCHSKISHC--DEATCNNGGECFDVGDTFRCSCPTGWEGPTCNI----AQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVD 666          

HSP 5 Score: 58.151 bits (139), Expect = 6.470e-9
Identity = 70/265 (26.42%), Postives = 100/265 (37.74%), Query Frame = 2
Query:  731 CLPGWKGIFCSEALCDDCQNGRCVGPG---------NCSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYY-GDQINHYLCQCSAGYSGRHCEMKTGDCQHDK---------IFPKNLSK---------ILTPN------------CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICKCRFLKCLNKEICI 1390
            CLPGW G  C   + +DC+ G+C+  G         +C C  G+TG  CE     C   P    G C          +    ++ C C  G+ G +C++D+ LC  NP  CQN   C N   GD    Y C CS  + G +C +    C               P N S+         +  PN            C+C  GF GS C      +N     + +  + G C++    F C C +   G  C+     C N   C+
Sbjct:  303 CLPGWTGQNCDIDV-NDCE-GKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQC----------RDAIDSYYCVCMDGFAGDSCELDVDLCVPNP--CQNGARCVNLPNGD----YFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCH-----ENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCL 544          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 5.982e-18
Identity = 51/149 (34.23%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  806 PGNCSCYRGWTGSNCEI----CEKSPGCMHG-MCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP---NCLCYPGFSGSHCQI 1228
            P  C+C  G+ G+ CE     C  +P C HG  CQ   G           F C C PG+ G  C+ D+  C   P  CQN G+CHN  G     + C CSAG+SG+ C++   +C     +  N S + T    +C C  G SG+ C++
Sbjct: 1514 PAVCTCTAGYAGTWCEADMDECLSTP-CRHGGSCQNLPG----------GFACRCLPGFSGTACETDVDECLEGP--CQNGGLCHNTQGG----FACDCSAGFSGKICDVTVDNCASSPCY-NNGSCVNTATGYSCRCPFGMSGARCEL 1644          

HSP 2 Score: 66.6254 bits (161), Expect = 1.771e-11
Identity = 41/137 (29.93%), Postives = 59/137 (43.07%), Query Frame = 2
Query:  947 CSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKT-----GDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C+C  G+ G  C+ D+  C + P  C++ G C N  G     + C+C  G+SG  CE        G CQ+  +            C C  GFSG  C +  T+ N   S      + G CVN+  G+ C C   + G
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTP--CRHGGSCQNLPGG----FACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGGFA---CDCSAGFSGKICDV--TVDNCASS---PCYNNGSCVNTATGYSCRCPFGMSG 1639          

HSP 3 Score: 55.0694 bits (131), Expect = 7.495e-8
Identity = 33/113 (29.20%), Postives = 48/113 (42.48%), Query Frame = 2
Query: 1076 LCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-IC-----KCRFLKCLNKEICI 1390
            +C C+AGY+G  CE    +C           + L     C C PGFSG+ C+ +       +  +   ++ G C N++ GF C CS    G IC      C    C N   C+
Sbjct: 1516 VCTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVD-----ECLEGPCQNGGLCHNTQGGFACDCSAGFSGKICDVTVDNCASSPCYNNGSCV 1623          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 5.990e-18
Identity = 51/149 (34.23%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  806 PGNCSCYRGWTGSNCEI----CEKSPGCMHG-MCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTP---NCLCYPGFSGSHCQI 1228
            P  C+C  G+ G+ CE     C  +P C HG  CQ   G           F C C PG+ G  C+ D+  C   P  CQN G+CHN  G     + C CSAG+SG+ C++   +C     +  N S + T    +C C  G SG+ C++
Sbjct: 1514 PAVCTCTAGYAGTWCEADMDECLSTP-CRHGGSCQNLPG----------GFACRCLPGFSGTACETDVDECLEGP--CQNGGLCHNTQGG----FACDCSAGFSGKICDVTVDNCASSPCY-NNGSCVNTATGYSCRCPFGMSGARCEL 1644          

HSP 2 Score: 66.6254 bits (161), Expect = 1.773e-11
Identity = 41/137 (29.93%), Postives = 59/137 (43.07%), Query Frame = 2
Query:  947 CSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKT-----GDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            C+C  G+ G  C+ D+  C + P  C++ G C N  G     + C+C  G+SG  CE        G CQ+  +            C C  GFSG  C +  T+ N   S      + G CVN+  G+ C C   + G
Sbjct: 1517 CTCTAGYAGTWCEADMDECLSTP--CRHGGSCQNLPGG----FACRCLPGFSGTACETDVDECLEGPCQNGGLCHNTQGGFA---CDCSAGFSGKICDV--TVDNCASS---PCYNNGSCVNTATGYSCRCPFGMSG 1639          

HSP 3 Score: 55.0694 bits (131), Expect = 7.500e-8
Identity = 33/113 (29.20%), Postives = 48/113 (42.48%), Query Frame = 2
Query: 1076 LCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-IC-----KCRFLKCLNKEICI 1390
            +C C+AGY+G  CE    +C           + L     C C PGFSG+ C+ +       +  +   ++ G C N++ GF C CS    G IC      C    C N   C+
Sbjct: 1516 VCTCTAGYAGTWCEADMDECLSTPCRHGGSCQNLPGGFACRCLPGFSGTACETDVD-----ECLEGPCQNGGLCHNTQGGFACDCSAGFSGKICDVTVDNCASSPCYNNGSCV 1623          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002938.1 (pep scaffold:Pmarinus_7.0:GL481088:8579:13413:1 gene:ENSPMAG00000002680.1 transcript:ENSPMAT00000002938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 6.412e-14
Identity = 55/168 (32.74%), Postives = 74/168 (44.05%), Query Frame = 2
Query:  749 GIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFP-KNLSKILTPN-------CLCYPGFSGSHCQI 1228
            G  C E    D + G C   G C C  GW G  C  C + PGC  G C +              + C C+ GW G+ CD DL  C +N + C N G C +   D    + C C+ G++G  CE + G C H + +P KN    +          CLC  GFSG  C++
Sbjct:   17 GAECKEGC--DLRQGYCEVDGECRCQPGWQGELCGNCTRFPGCQRGSCHM-------------PWQCDCEDGWTGRLCDRDLNFCGHN-RPCHNNGSCSD---DGSGGFTCTCADGFTGSRCEERAGPC-HQQGYPCKNGGACMDEAGSAHVLVCLCPRGFSGPLCEV 164          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 2.161e-12
Identity = 63/198 (31.82%), Postives = 86/198 (43.43%), Query Frame = 2
Query:  782 CQNG-RCVGPG---NCSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK--ILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI 1345
            CQNG RC+       C C +G+TG  CE     C   P C +G  Q   G          +FTCSC  G+ G  CD D+  CT++P  CQN G C N  G     + C C AGY+G  C+    +C           +  +    C C PGF+G+ C+   T  N+  S  +   + G C +    F C C+    G 
Sbjct:   20 CQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDP-CQNGG-QCVNGA--------GSFTCSCLAGYTGTLCDSDIDECTSDP--CQNGGQCVNGAG----SFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCE---TDVNECAS--SPCLNGGRCRDGVAAFTCECAPGFTGT 196          

HSP 2 Score: 63.929 bits (154), Expect = 8.681e-12
Identity = 52/142 (36.62%), Postives = 72/142 (50.70%), Query Frame = 2
Query:  731 CLPGWKGIFCS----EALCDDCQNG-RCV-GPGN--CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEM 1120
            CL G+ G  C     E   D CQNG +CV G G+  CSC  G+TG+ C+     C  SP C++G  +   GV         AFTC C PG+ G  C+ D+  C ++P  C N G C     D +  + C+C+ G++G  CE 
Sbjct:   75 CLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSP-CLNGG-RCRDGV--------AAFTCECAPGFTGTRCETDVNECASSP--CLNGGRCR----DGVAAFTCECAPGFTGTRCET 200          

HSP 3 Score: 63.1586 bits (152), Expect = 1.698e-11
Identity = 58/180 (32.22%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  731 CLPGWKGIFC----SEALCDDCQNG-RCV-GPGN--CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK--ILTPNCLCYPGFSGSHCQI 1228
            C  G+ G  C     E   D CQNG +CV G G+  CSC  G+TG+ C+     C   P C +G  Q   G          +FTCSC  G+ G  CD D+  C ++P  C N G C     D +  + C+C+ G++G  CE    +C           +  +    C C PGF+G+ C+ 
Sbjct:   37 CAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDP-CQNGG-QCVNGA--------GSFTCSCLAGYTGTLCDSDVNECASSP--CLNGGRCR----DGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCET 200          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: DELTA (Delta-like protein [Source:UniProtKB/TrEMBL;Acc:A7SL28])

HSP 1 Score: 86.6557 bits (213), Expect = 5.647e-19
Identity = 49/162 (30.25%), Postives = 74/162 (45.68%), Query Frame = 2
Query:  521 KFIHAKKLLRYEDTRKEI---------TVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGI-FCSEALCDDC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWG 970
            + +    L+   + R+E          T  +  ++ F ++F   + C+ N YG +C  FC+ ++  + +  C      +CLPGW+G+ +C+  +C      NG CV P  CSC  GWTG  C  C   P C+HG C              K F C C PGWG
Sbjct:  104 RSLEPGGLIARTEIRRETFFPGKLWANTSHIGVSSNFSLSF--RMVCNPNQYGDSCSKFCEPRDDKFGHMTCDANGTHVCLPGWQGLPYCTTPVCSKSCRPNGNCVSPDRCSCQGGWTGPQCNQCVPHPACVHGTCN-------------KPFDCICTPGWG 250          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO41506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S429])

HSP 1 Score: 86.2705 bits (212), Expect = 1.211e-17
Identity = 86/285 (30.18%), Postives = 123/285 (43.16%), Query Frame = 2
Query:  629 ECDENYYGSNCDYFCKDKNKVYPN-----FNCTETVQR---ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL--SKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQ-NSLKSRGYCVNSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
             C   Y GSNC+    D N+   N      NCT+ V      C PG+ G  C   + DDC +  C   G C+         C  G+ GS C+I    C+ +P C +G          +   +  A+ C+C PG+ G  C+ID+  C + P  CQN G C     DQ+N Y C C+AGYSG +CE+   DCQ            K+    C C  G++G  C+ +      I   Q N   + G C +   G+ C+C+    G      I  C    C+N   C++
Sbjct:  140 SCAPGYTGSNCE---TDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDI-DDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNP-CGNG---------GTCTDQLNAYLCTCPPGYTGSKCEIDINECASFP--CQNGGSCT----DQVNGYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDAYECTCPLGYTGLRCETD------INDCQPNPCLNGGSCTDRVNGYTCACAPGYTGNNCEKDIDDCASTPCMNGATCLD 398          

HSP 2 Score: 80.1073 bits (196), Expect = 1.128e-15
Identity = 67/233 (28.76%), Postives = 105/233 (45.06%), Query Frame = 2
Query:  671 CKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIF--PKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC 1324
            CKDK   Y         +  C  G+ G+ C   + +DCQ   C+  G+C         +C  G+TG+NCE     C  +P CM+G   ++            ++TC C  GW G  C I++  C++NP  C N G C+    D+   Y C C+AGY+G HCE    +C+ +          K+ +  C C PG++G HC+     +++         + G C +    F C+C
Sbjct:  320 CKDKVDAY---------ECTCPLGYTGLRCETDI-NDCQPNPCLNGGSCTDRVNGYTCACAPGYTGNNCEKDIDDCASTP-CMNGATCLD---------GVNSYTCICVTGWTGDQCTINVDECSSNP--CVNGGTCN----DEAGGYTCTCAAGYTGLHCETDIDECRTNPCLNGATCTDKVNSYTCTCAPGYAGVHCE-----KDEDDCASKPCLNGGTCTDLLADFECAC 521          

HSP 3 Score: 67.781 bits (164), Expect = 8.778e-12
Identity = 63/206 (30.58%), Postives = 82/206 (39.81%), Query Frame = 2
Query:  674 KDKNKVYPN-----FNCTETVQR---ICLPGWKGIFCSEALCDDCQNGRCVGPGNC---------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHC 1222
             D N   PN      +CT+ V      C PG+ G  C + + DDC +  C+    C          C  GWTG  C I    C  +P    G C  E G           +TC+C  G+ G +C+ D+  C  NP  C N   C     D++N Y C C+ GY+G HCE    DC             L  +  C C  GF G  C
Sbjct:  342 TDINDCQPNPCLNGGSCTDRVNGYTCACAPGYTGNNCEKDI-DDCASTPCMNGATCLDGVNSYTCICVTGWTGDQCTINVDECSSNPCVNGGTCNDEAG----------GYTCTCAAGYTGLHCETDIDECRTNP--CLNGATCT----DKVNSYTCTCAPGYAGVHCEKDEDDCASKPCLNGGTCTDLLADFECACVLGFIGKTC 530          

HSP 4 Score: 63.929 bits (154), Expect = 1.434e-10
Identity = 55/175 (31.43%), Postives = 84/175 (48.00%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN----LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCS 1327
            C C +G+ G NC+I      C+   CQ   G      L    + C C  GW G+NC  D+  C   P+ C+N   C+N +    N+Y C C+AGY+G +C     DC  + +  +N    +  +    C C PG++GS+C+  D  +  + S QN     G C +   GF C+C+
Sbjct:   24 CQCTQGFVGKNCQI--NINDCIPDPCQ--NGGWCCCDL-VNDWICQCPKGWTGKNCTEDVDECA--PQPCKNGATCNNLF----NNYTCTCAAGYTGINCTENIDDC--NGVVCQNGGNCVDGVNGYKCSCAPGYTGSNCET-DINECAVNSCQNG----GNCTDLVNGFSCTCA 180          

HSP 5 Score: 62.3882 bits (150), Expect = 4.308e-10
Identity = 52/179 (29.05%), Postives = 81/179 (45.25%), Query Frame = 2
Query:  815 CSCYRGWTGSNC----EICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKI-FPKNLSKILTP-NCLCYPGFSGSHCQ--INDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCS 1327
            C C +GWTG NC    + C   P C +G          +    F  +TC+C  G+ G NC  ++  C  N  +CQN G C     D +N Y C C+ GY+G +CE    +C  +      N + ++   +C C PG++G  C+  I+D             ++ G C +   G+ C C+
Sbjct:   63 CQCPKGWTGKNCTEDVDECAPQP-CKNGA---------TCNNLFNNYTCTCAAGYTGINCTENIDDC--NGVVCQNGGNCV----DGVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAP-------CRNGGTCTDQVNGYRCQCA 218          

HSP 6 Score: 51.6026 bits (122), Expect = 9.913e-7
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  938 AFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN-------CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCS 1327
            A+ C C  G+ G+NC I++  C   P  CQN G C     D +N ++CQC  G++G++C         D+  P+      T N       C C  G++G +C  N    N +       ++ G CV+   G+ CSC+
Sbjct:   21 AYRCQCTQGFVGKNCQININDCI--PDPCQNGGWCCC---DLVNDWICQCPKGWTGKNCTEDV-----DECAPQPCKNGATCNNLFNNYTCTCAAGYTGINCTENIDDCNGVV-----CQNGGNCVDGVNGYKCSCA 142          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO40730 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6D2])

HSP 1 Score: 77.7962 bits (190), Expect = 1.085e-16
Identity = 55/143 (38.46%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  728 ICLPGWKGIFCSEALCDDCQNGRCVGPGNCS---------CYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCE 1117
            ICL G  G  C + + + C++  C   GNC+         C  G+TG NCE     CE  P C +G          S   RF  +TC C+PG+ G+NC+ID+  C  NP  C+N+G C     D +N+Y C+C AG SGR+CE
Sbjct:   26 ICLQGHTGKRCEKEI-NKCESSPCKNGGNCTDQVNNYICTCQPGYTGRNCEKEHNDCESCP-CKNGG---------SCTDRFNDYTCKCQPGYTGKNCEIDIDECAGNP--CKNKGKCI----DHVNNYTCRCQAGVSGRNCE 151          

HSP 2 Score: 58.9214 bits (141), Expect = 4.330e-10
Identity = 40/136 (29.41%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  941 FTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQH--DKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG 1342
            + C C  G  G+ C+ ++  C ++P  C+N G C     DQ+N+Y+C C  GY+GR+CE +  DC+    K       +     C C PG++G +C+I+       +   N  K++G C++    + C C   + G
Sbjct:   23 YECICLQGHTGKRCEKEINKCESSP--CKNGGNCT----DQVNNYICTCQPGYTGRNCEKEHNDCESCPCKNGGSCTDRFNDYTCKCQPGYTGKNCEIDID-----ECAGNPCKNKGKCIDHVNNYTCRCQAGVSG 147          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO41508 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S431])

HSP 1 Score: 80.1073 bits (196), Expect = 7.312e-16
Identity = 76/223 (34.08%), Postives = 102/223 (45.74%), Query Frame = 2
Query:  782 CQNG-RCVGPGN---CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGD-----CQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC-SNNLGGICK-----CRFLKCLNKEICIE 1393
            CQNG  C   GN   C+C  G++G NCEI    CE +P C +G    E GV         ++ C C PGW G  C+ ++  C + P  C+N   C     D IN Y CQC+ GY+G +CE    D     CQ+       L       CLC PG +G  C IN    N+  S  N  ++ G CV+   GF C C    +G  C+     C    C+N   C++
Sbjct:   10 CQNGGSCTDMGNYYQCACVPGFSGVNCEINDDNCESNP-CKNGA-TCEDGV--------NSYQCKCAPGWTGPTCENNVNECMSAP--CKNGATCV----DGINSYTCQCAVGYTGVNCETNPDDCHPNPCQYGGTCVDGLDDFT---CLCVPGTTGKICHIN---INECNS--NPCRNNGTCVDGINGFTCRCLEGYIGAHCEVDVNYCDSEPCMNNATCVD 208          

HSP 2 Score: 70.0922 bits (170), Expect = 1.200e-12
Identity = 78/255 (30.59%), Postives = 110/255 (43.14%), Query Frame = 2
Query:  716 TVQRICLPGWKGIFC----SEALCDDCQNGR-CVGPGN---CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN---CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG------ICKCRFLKCLNKEICIENNLKDIKC 1417
            + Q  C PGW G  C    +E +   C+NG  CV   N   C C  G+TG NCE     C  +P C +G   ++             FTC C PG  G+ C I++  C +NP  C+N G C     D IN + C+C  GY G HCE+    C  +     N + +   +   C+C PG++G  C   D  +       N  +    C+N + GF C C     G      I  C    C+N   CI+  + D +C
Sbjct:   60 SYQCKCAPGWTGPTCENNVNECMSAPCKNGATCVDGINSYTCQCAVGYTGVNCETNPDDCHPNP-CQYGGTCVD---------GLDDFTCLCVPGTTGKICHININECNSNP--CRNNGTCV----DGINGFTCRCLEGYIGAHCEVDVNYCDSEPCM-NNATCVDEQDGFTCICAPGYTGPTCD-GDIDECAFNPCLNGAE----CINLENGFECVCLPGYTGKRCGIDIDDCTPSPCINGGRCID-QVNDYEC 291          

HSP 3 Score: 52.373 bits (124), Expect = 3.990e-7
Identity = 73/270 (27.04%), Postives = 112/270 (41.48%), Query Frame = 2
Query:  509 KYLTKFI--HAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETV------QRICLPGWKGIFCSEALCDDC------QNGRCVGPGN---CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGIC--HNYYGDQINHYLCQCSAGYSGRHCEMK-----TGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQIND 1234
            + L  +I  H +  + Y D+   +  A   + +   T I    C   Y G  CD    D+    P  N  E +      + +CLPG+ G  C   + DDC        GRC+   N   C C  G+ G NCE     C  +P C++G   I+             + C C  G+  +NC+     CT+    C+N G C   + YG    H+ C C  G+ G  CE+      T  CQ+     ++  K  +  C+C  GF+G +C+I +
Sbjct:  178 RCLEGYIGAHCEVDVNYCDSEPCMNNATCVDEQDGFTCI----CAPGYTGPTCDGD-IDECAFNPCLNGAECINLENGFECVCLPGYTGKRCGIDI-DDCTPSPCINGGRCIDQVNDYECQCLPGFVGDNCETNVDDCADNP-CLNGATCID---------GVNDYYCVCAIGYYSKNCEHKTSTCTD--CTCENGGTCGVSSVYG----HWFCVCPKGFKGERCEIADNGCATKPCQNGGSCCQDPVKGYS--CICREGFTGKNCEIGE 423          

HSP 4 Score: 51.6026 bits (122), Expect = 7.149e-7
Identity = 48/170 (28.24%), Postives = 72/170 (42.35%), Query Frame = 2
Query:  938 AFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIF--PKNLSKILTPNCLCYPGFSGSHCQ------INDTLQNQIKSFQNSLKSRGYCVNSK--EGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKC 1417
             F C C PG+ G+ C ID+  CT  P  C N G C     DQ+N Y CQC  G+ G +CE    DC  +        +  +    C+C  G+   +C+       + T +N      +S+    +CV  K  +G  C  ++N      C    C N   C ++ +K   C
Sbjct:  250 GFECVCLPGYTGKRCGIDIDDCT--PSPCINGGRCI----DQVNDYECQCLPGFVGDNCETNVDDCADNPCLNGATCIDGVNDYYCVCAIGYYSKNCEHKTSTCTDCTCENGGTCGVSSVYGHWFCVCPKGFKGERCEIADN-----GCATKPCQNGGSCCQDPVKGYSC 408          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO46513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPI0])

HSP 1 Score: 77.411 bits (189), Expect = 9.724e-16
Identity = 56/176 (31.82%), Postives = 89/176 (50.57%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC 1324
            C+C  G+TG NCE     C K+P    G+C+ E G           ++C+CK G+ G+NC+ D+  C+ NP  C+N G+C N +G     Y C C AG++G++CE    +C  +      + K       C C  GF+G +C+     Q+  +  +N  ++ G C N   G+ C+C
Sbjct:   24 CTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHG----------GYSCACKAGFTGKNCEQDVNECSENP--CKNGGVCKNEHGG----YSCACKAGFTGKNCEQDVNECSENPCKNGGVCKNEHGGYSCACKAGFTGKNCE-----QDVNECSKNPCQNGGVCKNEHGGYSCAC 178          

HSP 2 Score: 74.3294 bits (181), Expect = 1.056e-14
Identity = 63/204 (30.88%), Postives = 98/204 (48.04%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGI-C-----KCRFLKCLNKEICI 1390
            C+C  G+TG NCE     C ++P    G+C+ E G           ++C+CK G+ G+NC+ D+  C+ NP  C+N G+C N +G     Y C C AG++G++CE    +C  +      + K       C C  GF+G  C+     Q+  +  +N  ++ G C N   G+ C+C     G  C     +C+   CLN   CI
Sbjct:   62 CACKAGFTGKNCEQDVNECSENPCKNGGVCKNEHG----------GYSCACKAGFTGKNCEQDVNECSENP--CKNGGVCKNEHGG----YSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKICE-----QDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDKNECKVNPCLNNGKCI 244          

HSP 3 Score: 72.0182 bits (175), Expect = 5.704e-14
Identity = 55/176 (31.25%), Postives = 88/176 (50.00%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC 1324
            C+C  G+TG NCE     C ++P    G+C+ E G           ++C+CK G+ G+NC+ D+  C+ NP  CQN G+C N +G     Y C C AG++G+ CE    +C  +      + K       C C  GF+G +C+     Q++ +   N   + G C+N+   + C+C
Sbjct:  100 CACKAGFTGKNCEQDVNECSENPCKNGGVCKNEHG----------GYSCACKAGFTGKNCEQDVNECSKNP--CQNGGVCKNEHGG----YSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCE-----QDKNECKVNPCLNNGKCINTPGSYKCNC 254          

HSP 4 Score: 69.3218 bits (168), Expect = 4.719e-13
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = 2
Query:  938 AFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSC 1324
            A++C+CK G+ G+NC+ D+  C+ NP  C+N G+C N +G     Y C C AG++G++CE    +C  +      + K       C C  GF+G +C+     Q+  +  +N  K+ G C N   G+ C+C
Sbjct:   21 AYSCTCKSGFTGKNCEQDVNECSKNP--CKNGGVCKNEHGG----YSCACKAGFTGKNCEQDVNECSENPCKNGGVCKNEHGGYSCACKAGFTGKNCE-----QDVNECSENPCKNGGVCKNEHGGYSCAC 140          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dlb (delta-like protein B [Source:NCBI gene;Acc:101165992])

HSP 1 Score: 140.198 bits (352), Expect = 2.366e-34
Identity = 102/341 (29.91%), Postives = 150/341 (43.99%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALD--NNAKFL----MTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD-DC--QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN--CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            R P   KWP       +FSL  +  N +       +   L+    TR+ + +  D   +  F     + +   + CDE Y+G  C  +C+ ++    ++ C E   R+CL GWKG +CSE +C  DC  +NG C  PG C+C  GW G +C  C + PGC+HG C              + + C+C+ GWGG  CD DL  CTN+ K C N   C N        Y C C  G+ G +CE++T +C  +          L  +  C C  GF G +C+I          F       G CV +   G+ C C  +  G      + +C    CLN   C++
Sbjct:   89 RVPFHFKWPG------TFSLIIEAWNAESPTEYTDNQNNLVSRLATRRRLAIGEDWSQDVHFGEQSELRYSYHVFCDEYYFGDGCADYCRPRDDTLGHYTCDEEGSRVCLEGWKGNYCSEPICSADCSERNGYCEAPGGCTCRMGWQGPSCTECVRYPGCLHGTCG-------------QPWQCNCQEGWGGLFCDQDLNYCTNH-KPCANGATCSN---TGQGSYTCTCRPGFGGTNCELETNECDSNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIIAMTCADGPCFNG-----GTCVETMTGGYTCRCPPSYTGSNCEKKLDRCSNRPCLNGGQCLD 401          

HSP 2 Score: 64.6994 bits (156), Expect = 2.470e-10
Identity = 62/226 (27.43%), Postives = 92/226 (40.71%), Query Frame = 2
Query:  623 SIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICL--PGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCE----ICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKN--LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLK 1276
            S  C + +YG NC                 E +   C   P + G  C E +          G   C C   +TGSNCE     C   P C++G   ++ G             C C+ G+ G NC +++  C ++P  CQN G C     D +N Y C C+ GY+G++C +++  C            +    P C C  GF G  C+   TLQ    SF+ +L+
Sbjct:  330 SCTCPQGFYGKNC-----------------EIIAMTCADGPCFNGGTCVETM---------TGGYTCRCPPSYTGSNCEKKLDRCSNRP-CLNGGQCLDLG---------HGILCRCQAGFSGANCQVNVDDCASSP--CQNAGTCQ----DGVNDYTCSCTLGYTGKNCSVRSDACGARPCQNGGTCFTHFTGPVCQCPKGFMGPSCEF--TLQ---PSFKPALR 508          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dll4 (delta-like protein 4 [Source:NCBI gene;Acc:101163294])

HSP 1 Score: 139.813 bits (351), Expect = 4.762e-34
Identity = 94/315 (29.84%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  491 DNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDC---QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSK--EGFHCSCSNNLGG------ICKCRFLKCLNKEICI 1390
            D K+ D  ++ F   + L    D  ++         K+   F+    C+++YYG +C   C  ++  + ++NCT+  Q  CLPGWKG +C E +C +    +NG C  PG C C +GWTG  C+ CE  P C HG CQ+              + C+C+ GWGG  CD DL  CT++ + C N   C N        Y C C  G++G +CE+   +C  +    +N  K  +      C+C  GF G HC+     Q+ +    +     G C   +   G+ C C     G      + KC  L C N  +C+
Sbjct:  126 DYKSQDLLISFFAVQRHLSAGTDWSQDTQTDRLTELKYSYRFV----CNQSYYGESCSKKCTPRDDRFGHYNCTQDGQLTCLPGWKGKYCEEPVCQEGCSERNGNCSRPGECVCRKGWTGMFCDECETYPACNHGTCQL-------------PWQCNCQEGWGGLLCDQDLNFCTHH-RPCVNGATCMN---TGQGSYTCTCLPGFTGANCELVMKECDSNPC--RNSGKCTSLEGSYKCMCPQGFEGLHCE-----QSTLTCADSPCFHGGECRERRNGHGYMCKCPRGYTGLNCERRVDKCTLLPCANGGLCL 412          

HSP 2 Score: 72.4034 bits (176), Expect = 1.017e-12
Identity = 65/235 (27.66%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTE---TVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNC-----------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL------SKILTPNCLCYPGFSGSHCQINDTLQNQIKS 1258
            C   + G+NC+   K  D N    +  CT    + + +C  G++G+ C ++    C +  C   G C            C RG+TG NCE     C   P    G+C ++ G+            CSC+ G+ GQ C+I++  C+ +P  C N G C     D+IN Y C C  G++GR+C+    +C         L      S      C+C  GF+G  C+    L + + S
Sbjct:  306 CLPGFTGANCELVMKECDSNPCRNSGKCTSLEGSYKCMCPQGFEGLHCEQSTLT-CADSPCFHGGECRERRNGHGYMCKCPRGYTGLNCERRVDKCTLLPCANGGLCLLQGGMS----------VCSCRAGFTGQRCEININDCSGSP--CLNGGTCK----DRINDYTCSCPTGFTGRNCQRVLDECTLHPCLNGGLCTESGASGEPAVACICPSGFTGPQCESFVLLSSGVAS 523          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dll4 (delta-like protein 4 [Source:NCBI gene;Acc:101163294])

HSP 1 Score: 139.813 bits (351), Expect = 5.037e-34
Identity = 94/315 (29.84%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  491 DNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDC---QNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSK--EGFHCSCSNNLGG------ICKCRFLKCLNKEICI 1390
            D K+ D  ++ F   + L    D  ++         K+   F+    C+++YYG +C   C  ++  + ++NCT+  Q  CLPGWKG +C E +C +    +NG C  PG C C +GWTG  C+ CE  P C HG CQ+              + C+C+ GWGG  CD DL  CT++ + C N   C N        Y C C  G++G +CE+   +C  +    +N  K  +      C+C  GF G HC+     Q+ +    +     G C   +   G+ C C     G      + KC  L C N  +C+
Sbjct:  126 DYKSQDLLISFFAVQRHLSAGTDWSQDTQTDRLTELKYSYRFV----CNQSYYGESCSKKCTPRDDRFGHYNCTQDGQLTCLPGWKGKYCEEPVCQEGCSERNGNCSRPGECVCRKGWTGMFCDECETYPACNHGTCQL-------------PWQCNCQEGWGGLLCDQDLNFCTHH-RPCVNGATCMN---TGQGSYTCTCLPGFTGANCELVMKECDSNPC--RNSGKCTSLEGSYKCMCPQGFEGLHCE-----QSTLTCADSPCFHGGECRERRNGHGYMCKCPRGYTGLNCERRVDKCTLLPCANGGLCL 412          

HSP 2 Score: 72.4034 bits (176), Expect = 1.007e-12
Identity = 65/235 (27.66%), Postives = 101/235 (42.98%), Query Frame = 2
Query:  632 CDENYYGSNCDYFCK--DKNKVYPNFNCTE---TVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNC-----------SCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNL------SKILTPNCLCYPGFSGSHCQINDTLQNQIKS 1258
            C   + G+NC+   K  D N    +  CT    + + +C  G++G+ C ++    C +  C   G C            C RG+TG NCE     C   P    G+C ++ G+            CSC+ G+ GQ C+I++  C+ +P  C N G C     D+IN Y C C  G++GR+C+    +C         L      S      C+C  GF+G  C+    L + + S
Sbjct:  306 CLPGFTGANCELVMKECDSNPCRNSGKCTSLEGSYKCMCPQGFEGLHCEQSTLT-CADSPCFHGGECRERRNGHGYMCKCPRGYTGLNCERRVDKCTLLPCANGGLCLLQGGMS----------VCSCRAGFTGQRCEININDCSGSP--CLNGGTCK----DRINDYTCSCPTGFTGRNCQRVLDECTLHPCLNGGLCTESGASGEPAVACICPSGFTGPQCESFVLLSSGVAS 523          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000037553.1 (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:101166370])

HSP 1 Score: 137.502 bits (345), Expect = 4.554e-33
Identity = 101/349 (28.94%), Postives = 157/349 (44.99%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSL-----------EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN-----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +FSL           +   +N ++ +++    + L   E+  K++  A     ++   F+    CDE+YYG  C  FC+ ++  + +F+C E  + IC  GWKG +C+E +C    D ++G C  PG C C  G++G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C N   C N        Y C C  GY+G  CE++  +C  +   P       + N     C C PGF G++C+++         F       G C ++ E G+ C C     G      I  C    CLN   C++
Sbjct:   99 RFPFGFTWPG------TFSLIIEALHTDSLDDLTTENPERLISRITTQRHLSVGEEWFKDMQTADRTELRYSYRFL----CDEHYYGDGCSVFCRPRDDAFGHFSCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCTN---TGQGSYTCTCLPGYTGASCEIQVSECSGN---PCRNGGSCSDNDNGYKCACPPGFYGNNCELSANTCADGPCFNG-----GRCADNPEGGYFCQCPAGYAGFNCEKKIDHCSSNPCLNGAECVD 412          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000013302.2 (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:101166370])

HSP 1 Score: 137.117 bits (344), Expect = 5.951e-33
Identity = 101/349 (28.94%), Postives = 157/349 (44.99%), Query Frame = 2
Query:  428 RFPL-LKWPSDQRTEISFSL-----------EFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCD---DCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN-----CLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKE-GFHCSCSNNLGG------ICKCRFLKCLNKEICIE 1393
            RFP    WP       +FSL           +   +N ++ +++    + L   E+  K++  A     ++   F+    CDE+YYG  C  FC+ ++  + +F+C E  + IC  GWKG +C+E +C    D ++G C  PG C C  G++G  C+ C + PGC+HG CQ             + + C+C+ GWGG  C+ DL  CT++ K C N   C N        Y C C  GY+G  CE++  +C  +   P       + N     C C PGF G++C+++         F       G C ++ E G+ C C     G      I  C    CLN   C++
Sbjct:  111 RFPFGFTWPG------TFSLIIEALHTDSLDDLTTENPERLISRITTQRHLSVGEEWFKDMQTADRTELRYSYRFL----CDEHYYGDGCSVFCRPRDDAFGHFSCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQ-------------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCTN---TGQGSYTCTCLPGYTGASCEIQVSECSGN---PCRNGGSCSDNDNGYKCACPPGFYGNNCELSANTCADGPCFNG-----GRCADNPEGGYFCQCPAGYAGFNCEKKIDHCSSNPCLNGAECVD 424          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000036778.1 (SMESG000036778.1)

HSP 1 Score: 1123.23 bits (2904), Expect = 0.000e+0
Identity = 593/598 (99.16%), Postives = 594/598 (99.33%), Query Frame = 2
Query:  197 MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPXXXXXXXXXAIXXXXXXXXXXXTSIKTIHNDLGNLNNQVKQPVMFIEXXXXXXXXXXXXXXQIQSCKNNLLSIQDSQNFNFKSGDIESSKKPDEEDITKSDLLKQSSEEPVKTPIKESVICNPNLLINNYKNINESKL 1990
            MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKY TKFIHAKKLLRYEDTRKEITVALDNNAKFL+TFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK LTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPLLLVVLIVVAIKFRYKFRRKFKTSIKTIHNDLGNLNNQVKQPVMFIEQRFLLNQRSLLNSLQIQSCKNNLLSIQDS NFNFKSGDIESSKKPDEEDITKSDLLKQSSEEP KTPIKESVICNPNLLINNYKNINESKL
Sbjct:    1 MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYQTKFIHAKKLLRYEDTRKEITVALDNNAKFLLTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKRLTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPLLLVVLIVVAIKFRYKFRRKFKTSIKTIHNDLGNLNNQVKQPVMFIEQRFLLNQRSLLNSLQIQSCKNNLLSIQDSHNFNFKSGDIESSKKPDEEDITKSDLLKQSSEEPAKTPIKESVICNPNLLINNYKNINESKL 598          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000036778.1 (SMESG000036778.1)

HSP 1 Score: 1103.97 bits (2854), Expect = 0.000e+0
Identity = 578/595 (97.14%), Postives = 583/595 (97.98%), Query Frame = 2
Query:  197 MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPXXXXXXXXXAIXXXXXXXXXXXTSIKTIHNDLGNLNNQVKQPVMFIEXXXXXXXXXXXXXXQIQSCKNNLLSIQDSQNFNFKSGDIESSKKPDEEDITKSDLLKQSSEEPVKTPIKESVICNPNLLINNYKNINE 1981
            MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKY TKFIHAKKLLRYEDTRKEITVALDNNAKFL+TFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK LTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPLLLVVLIVVAIKFRYKFRRKFKTSIKTIHNDLGNLNNQVKQPVMFIEQRFLLNQRSLLNSLQIQSCKNNLLSIQDS NFNFKSGDIESSKKPDEEDITKSDLLKQSSEEP KTPIKES    P++L N+ K+  E
Sbjct:    1 MDIKNLSFSGNSKIEKLFCVSNEQNRSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAVLQRFPLLKWPSDQRTEISFSLEFDNKNGDKYQTKFIHAKKLLRYEDTRKEITVALDNNAKFLLTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKRLTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRLENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPLLLVVLIVVAIKFRYKFRRKFKTSIKTIHNDLGNLNNQVKQPVMFIEQRFLLNQRSLLNSLQIQSCKNNLLSIQDSHNFNFKSGDIESSKKPDEEDITKSDLLKQSSEEPAKTPIKESEKSKPSILNNDDKSHQE 595          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 145.976 bits (367), Expect = 7.700e-36
Identity = 92/303 (30.36%), Postives = 134/303 (44.22%), Query Frame = 2
Query:  602 FLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINH-------------------YLCQCSAGYSGRHCEMKTGDCQHDKIFPKN---LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEICIEN-NLKDIKCT 1420
            F +       C +NY+G  CD  CK        +NC+    RIC  G+ G +C + +C   C NG CVGP  C C  GWTG +C+ C   PGC+HG C+ +      +       TC+CK  WGG  C+IDL  C+NNP +C+N G C N+   + N                    Y+C C   + G  C+     C  +     +     K     C C PGF+G +C+I++      +       + G C++   GF C C     G  C+     C+ L C+N   C++  N  D +CT
Sbjct:  164 FQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFD-----ETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDED-----ECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECT 456          

HSP 2 Score: 53.5286 bits (127), Expect = 5.817e-7
Identity = 49/171 (28.65%), Postives = 69/171 (40.35%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN---CLCYPGFSGSHCQINDTLQN----QIKSFQNSLKSRGYCV 1294
            C C  G+TG NCEI    C   P    GMC I+         R   F C C  G+ G  C ++   C      C N   C     D+ N   C+C+ G++GR C     +C  ++    N   I TP    C C   +SG  C +   + N    + K   N  ++ G C+
Sbjct:  377 CKCPPGFTGRNCEIDEDECSSKPCLNGGMC-ID---------RPSGFLCVCPVGFSGDRCQVNKNDCQK--LSCMNGAKCM----DRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI 531          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 145.976 bits (367), Expect = 8.548e-36
Identity = 92/303 (30.36%), Postives = 134/303 (44.22%), Query Frame = 2
Query:  602 FLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINH-------------------YLCQCSAGYSGRHCEMKTGDCQHDKIFPKN---LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEICIEN-NLKDIKCT 1420
            F +       C +NY+G  CD  CK        +NC+    RIC  G+ G +C + +C   C NG CVGP  C C  GWTG +C+ C   PGC+HG C+ +      +       TC+CK  WGG  C+IDL  C+NNP +C+N G C N+   + N                    Y+C C   + G  C+     C  +     +     K     C C PGF+G +C+I++      +       + G C++   GF C C     G  C+     C+ L C+N   C++  N  D +CT
Sbjct:  169 FQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFD-----ETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDED-----ECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECT 461          

HSP 2 Score: 53.5286 bits (127), Expect = 6.027e-7
Identity = 49/171 (28.65%), Postives = 69/171 (40.35%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN---CLCYPGFSGSHCQINDTLQN----QIKSFQNSLKSRGYCV 1294
            C C  G+TG NCEI    C   P    GMC I+         R   F C C  G+ G  C ++   C      C N   C     D+ N   C+C+ G++GR C     +C  ++    N   I TP    C C   +SG  C +   + N    + K   N  ++ G C+
Sbjct:  382 CKCPPGFTGRNCEIDEDECSSKPCLNGGMC-ID---------RPSGFLCVCPVGFSGDRCQVNKNDCQK--LSCMNGAKCM----DRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI 536          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 144.436 bits (363), Expect = 2.042e-35
Identity = 94/315 (29.84%), Postives = 140/315 (44.44%), Query Frame = 2
Query:  566 KEITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETVQRICLPGWKGIFCSEALC-DDCQNGRCVGPGNCSCYRGWTGSNCEICEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINH-------------------YLCQCSAGYSGRHCEMKTGDCQHDKIFPKN---LSKILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCSCSNNLGG-ICK-----CRFLKCLNKEICIEN-NLKDIKCT 1420
            K+++   D+   F +       C +NY+G  CD  CK        +NC+    RIC  G+ G +C + +C   C NG CVGP  C C  GWTG +C+ C   PGC+HG C+ +      +       TC+CK  WGG  C+IDL  C+NNP +C+N G C N+   + N                    Y+C C   + G  C+     C  +     +     K     C C PGF+G +C+I++      +       + G C++   GF C C     G  C+     C+ L C+N   C++  N  D +CT
Sbjct:  160 KQLSTPKDH---FQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFD-----ETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDED-----ECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECT 461          

HSP 2 Score: 52.7582 bits (125), Expect = 1.008e-6
Identity = 49/171 (28.65%), Postives = 69/171 (40.35%), Query Frame = 2
Query:  815 CSCYRGWTGSNCEI----CEKSPGCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKICQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSKILTPN---CLCYPGFSGSHCQINDTLQN----QIKSFQNSLKSRGYCV 1294
            C C  G+TG NCEI    C   P    GMC I+         R   F C C  G+ G  C ++   C      C N   C     D+ N   C+C+ G++GR C     +C  ++    N   I TP    C C   +SG  C +   + N    + K   N  ++ G C+
Sbjct:  382 CKCPPGFTGRNCEIDEDECSSKPCLNGGMC-ID---------RPSGFLCVCPVGFSGDRCQVNKNDCQK--LSCMNGAKCM----DRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI 536          
The following BLAST results are available for this feature:
BLAST of Delta-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLL11.809e-3428.95delta like canonical Notch ligand 1 [Source:HGNC S... [more]
DLL11.809e-3428.95delta like canonical Notch ligand 1 [Source:HGNC S... [more]
JAG28.837e-2929.18jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
JAG22.291e-2829.17jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
DLL48.788e-2826.19delta like canonical Notch ligand 4 [Source:HGNC S... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apx-19.871e-2228.83Anterior pharynx in excess protein 1 [Source:UniP... [more]
clec-781.534e-1830.89C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
dsl-43.935e-1628.94Delta-like protein [Source:UniProtKB/TrEMBL;Acc:Q... [more]
ten-12.869e-1532.06Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-12.881e-1532.06Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dl5.838e-2830.96gene:FBgn0000463 transcript:FBtr0083739[more]
Dl5.838e-2830.96gene:FBgn0000463 transcript:FBtr0083740[more]
Dl5.838e-2830.96gene:FBgn0000463 transcript:FBtr0304658[more]
Ser1.891e-2532.72gene:FBgn0004197 transcript:FBtr0344121[more]
Ser1.891e-2532.72gene:FBgn0004197 transcript:FBtr0085128[more]
back to top
BLAST of Delta-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlc3.216e-3727.62deltaC [Source:NCBI gene;Acc:30120][more]
dlc3.228e-3727.62deltaC [Source:NCBI gene;Acc:30120][more]
dld2.695e-3430.03deltaD [Source:NCBI gene;Acc:30138][more]
dla4.118e-3228.89deltaA [Source:NCBI gene;Acc:30131][more]
dla5.216e-3228.89deltaA [Source:NCBI gene;Acc:30131][more]
back to top
BLAST of Delta-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsdme1.633e-3429.39gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme2.368e-3429.39gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme2.468e-3429.39gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme2.868e-3429.39gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme3.366e-3330.66gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
back to top
BLAST of Delta-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dll13.625e-3428.13delta like canonical Notch ligand 1 [Source:MGI Sy... [more]
Jag11.444e-2827.52jagged 1 [Source:MGI Symbol;Acc:MGI:1095416][more]
Dll47.161e-2826.32delta like canonical Notch ligand 4 [Source:MGI Sy... [more]
Jag27.714e-2828.57jagged 2 [Source:MGI Symbol;Acc:MGI:1098270][more]
Dlk11.551e-2031.61delta like non-canonical Notch ligand 1 [Source:MG... [more]
back to top
BLAST of Delta-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IAT6|DLLC_DANRE1.967e-3627.62Delta-like protein C OS=Danio rerio OX=7955 GN=dlc... [more]
sp|P97677|DLL1_RAT3.417e-3427.94Delta-like protein 1 OS=Rattus norvegicus OX=10116... [more]
sp|O00548|DLL1_HUMAN8.689e-3428.95Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DL... [more]
sp|Q8UWJ4|DLLD_DANRE2.205e-3330.03Delta-like protein D OS=Danio rerio OX=7955 GN=dld... [more]
sp|Q61483|DLL1_MOUSE2.536e-3328.13Delta-like protein 1 OS=Mus musculus OX=10090 GN=D... [more]
back to top
BLAST of Delta-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6US921.326e-3931.16Delta-like protein OS=Echinococcus granulosus OX=6... [more]
A0A0R3U2I31.479e-3934.36Delta-like protein OS=Mesocestoides corti OX=53468... [more]
A0A5K3EVY91.564e-3932.84Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J1Q42.005e-3933.54Delta-like protein OS=Schistocephalus solidus OX=7... [more]
A0A564YA693.172e-3934.44Delta-like protein OS=Hymenolepis diminuta OX=6216... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dll43.577e-3530.36delta like canonical Notch ligand 4 [Source:NCBI g... [more]
dll44.460e-3530.36delta like canonical Notch ligand 4 [Source:NCBI g... [more]
dld2.165e-3428.93delta like canonical Notch ligand 1 [Source:NCBI g... [more]
dlc5.398e-3328.45deltaC [Source:NCBI gene;Acc:30120][more]
dlc5.875e-3328.45deltaC [Source:NCBI gene;Acc:30120][more]
back to top
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG18.022e-2628.32jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
ENSPMAT00000004043.15.982e-1834.23pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.15.990e-1834.23pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000002938.16.412e-1432.74pep scaffold:Pmarinus_7.0:GL481088:8579:13413:1 ge... [more]
ENSPMAT00000002014.12.161e-1231.82pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
DELTA5.647e-1930.25Delta-like protein [Source:UniProtKB/TrEMBL;Acc:A... [more]
EDO415061.211e-1730.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407301.085e-1638.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415087.312e-1634.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465139.724e-1631.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlb2.366e-3429.91delta-like protein B [Source:NCBI gene;Acc:1011659... [more]
dll44.762e-3429.84delta-like protein 4 [Source:NCBI gene;Acc:1011632... [more]
dll45.037e-3429.84delta-like protein 4 [Source:NCBI gene;Acc:1011632... [more]
ENSORLT00000037553.14.554e-3328.94delta like canonical Notch ligand 1 [Source:NCBI g... [more]
ENSORLT00000013302.25.951e-3328.94delta like canonical Notch ligand 1 [Source:NCBI g... [more]
back to top
BLAST of Delta-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036778.10.000e+099.16SMESG000036778.1[more]
SMESG000036778.10.000e+097.14SMESG000036778.1[more]
SMESG000022173.17.700e-3630.36SMESG000022173.1[more]
SMESG000022173.18.548e-3630.36SMESG000022173.1[more]
SMESG000022173.12.042e-3529.84SMESG000022173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034201 ID=SMED30034201|Name=Delta-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2243bp
TAAAGATAATCCGAAAAATTATTTCTGAAATGATGGTGTACAAATCATAT
TTATTCCGATTCGATACGGTTGATGTGGACAGATAAAATAAAAACTGGTT
TGATAATTATAAATTTTTCAGATGAATTATCGGTTGTTGATTATTTTGCT
TTTTAATTTTTTTCCTAAAAAATTATGCTGGCATACTGGACGAATTATGG
ACATTAAAAATTTGTCGTTTTCCGGTAATTCGAAAATTGAAAAGTTATTT
TGTGTTTCCAATGAGCAAAATCGCAGTCGAAATAATTCCATAGATGCAGT
AATCTGCCTAAGAAAAAACAGTCACATAAATCAGAATTTTGTTCTCAAAT
GCGAAAACGCAACCATAATTATTCACAGATTGGATTGCGTCAACTCCATT
ATTAAGAATTTGAACGCAGTATTACAAAGATTTCCATTACTTAAATGGCC
GAGTGACCAACGTACAGAAATTTCATTTTCGTTAGAATTTGATAATAAAA
ACGGTGACAAATATCTGACAAAATTCATACACGCAAAAAAGCTATTGAGA
TATGAAGACACAAGAAAAGAAATAACAGTAGCACTAGATAATAATGCCAA
ATTTCTTATGACATTTATCCTTTCAATTGAATGTGATGAAAATTATTATG
GCTCAAATTGTGACTATTTCTGTAAAGACAAAAATAAAGTTTACCCTAAC
TTTAATTGTACCGAAACAGTCCAGAGAATATGTCTCCCGGGATGGAAAGG
AATTTTTTGCTCCGAAGCACTTTGTGACGATTGTCAAAATGGCAGATGTG
TTGGGCCTGGAAATTGCAGCTGTTATCGTGGATGGACTGGCAGCAATTGT
GAAATTTGCGAGAAATCGCCTGGTTGCATGCATGGAATGTGTCAAATCGA
AACTGGAGTTTTACATTCATCAAAACTGCGATTCAAAGCGTTTACGTGTT
CGTGTAAACCGGGCTGGGGTGGACAAAATTGTGATATTGATCTCAAACTT
TGCACAAATAATCCAAAAATATGCCAAAATAGGGGCATTTGTCACAATTA
TTACGGTGATCAAATAAACCATTATTTGTGTCAGTGTTCAGCTGGATATT
CGGGGCGTCATTGTGAAATGAAAACCGGTGATTGTCAGCATGACAAAATT
TTTCCAAAGAACCTATCAAAGATATTAACTCCAAACTGTCTCTGTTATCC
GGGATTTTCTGGGTCACATTGCCAAATAAATGACACCCTTCAAAATCAGA
TCAAGTCTTTTCAAAATTCACTTAAATCACGTGGATATTGTGTGAATTCC
AAAGAAGGCTTCCATTGTTCGTGCTCCAATAACCTTGGCGGTATATGCAA
ATGCCGATTTCTGAAATGCCTCAACAAGGAAATTTGTATAGAAAATAATC
TCAAAGACATCAAGTGTACACAAATTGAGTCGAAAAATTCCATTTTCGAA
TATTTTAGCAATTTCAGATTAGAAAATTCGACTAATTATGTCATAATACC
AAACAAAACCGACATTAGATTAGAAACCCCGAAAATATTTGAGTTGCAAT
ATTTCAGTTCGTTCCTCTTCATTCCATTATTGTTGGTAGTTCTCATTGTG
GTCGCCATTAAGTTCAGATACAAATTTCGCAGAAAATTTAAGACTTCAAT
TAAAACAATTCACAATGATTTGGGTAATTTAAACAATCAAGTCAAACAAC
CAGTCATGTTTATAGAACAAAGATTTTTATTGAACCAAAGATCATTGCTA
AATAGCCTACAGATCCAATCTTGCAAAAATAATTTGCTTTCCATTCAAGA
TTCTCAGAATTTTAATTTTAAATCCGGTGACATTGAATCTTCAAAGAAAC
CCGATGAAGAGGATATTACAAAATCTGATCTATTAAAACAATCATCAGAA
GAACCAGTTAAAACTCCTATTAAAGAATCAGTTATTTGTAATCCAAATCT
GTTGATAAATAATTACAAAAATATTAATGAGAGTAAACTTTAAGAATTTC
TACAGCTGTGCCGTTGAGTCCGTAAAATTTACTGATGTTTCAGTATGGAA
CTGAATTTTTTGTAGAATTTGATTTGATAGATTCGTTCAGTTTTATTTTG
ATACGTTAAATTATTTTTTGTTTGGCTTCATTATTTAGGGTTGTCGAATC
CCTGAATGTGTGAAAGATTCGTGTTTTCGGCTAGTAAATGTCAGTATGGA
CAAATCAGAAATTAGATGATTAAATGATTTTATTAAAAAAAAA
back to top

protein sequence of SMED30034201-orf-1

>SMED30034201-orf-1 ID=SMED30034201-orf-1|Name=SMED30034201-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=624bp
MNYRLLIILLFNFFPKKLCWHTGRIMDIKNLSFSGNSKIEKLFCVSNEQN
RSRNNSIDAVICLRKNSHINQNFVLKCENATIIIHRLDCVNSIIKNLNAV
LQRFPLLKWPSDQRTEISFSLEFDNKNGDKYLTKFIHAKKLLRYEDTRKE
ITVALDNNAKFLMTFILSIECDENYYGSNCDYFCKDKNKVYPNFNCTETV
QRICLPGWKGIFCSEALCDDCQNGRCVGPGNCSCYRGWTGSNCEICEKSP
GCMHGMCQIETGVLHSSKLRFKAFTCSCKPGWGGQNCDIDLKLCTNNPKI
CQNRGICHNYYGDQINHYLCQCSAGYSGRHCEMKTGDCQHDKIFPKNLSK
ILTPNCLCYPGFSGSHCQINDTLQNQIKSFQNSLKSRGYCVNSKEGFHCS
CSNNLGGICKCRFLKCLNKEICIENNLKDIKCTQIESKNSIFEYFSNFRL
ENSTNYVIIPNKTDIRLETPKIFELQYFSSFLFIPLLLVVLIVVAIKFRY
KFRRKFKTSIKTIHNDLGNLNNQVKQPVMFIEQRFLLNQRSLLNSLQIQS
CKNNLLSIQDSQNFNFKSGDIESSKKPDEEDITKSDLLKQSSEEPVKTPI
KESVICNPNLLINNYKNINESKL*
back to top
Aliases
The feature 'Delta-like protein' has the following synonyms
Synonym
Smed_34343
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001774DSL
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007154cell communication
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001774Delta/Serrate/lag-2 (DSL) proteinSMARTSM00051dsl11coord: 149..213
e-value: 4.0E-5
score: 31.6
IPR001774Delta/Serrate/lag-2 (DSL) proteinPFAMPF01414DSLcoord: 161..213
e-value: 6.1E-14
score: 52.0
IPR001774Delta/Serrate/lag-2 (DSL) proteinPROSITEPS51051DSLcoord: 169..213
score: 13.911
IPR000742EGF-like domainSMARTSM00181egf_5coord: 170..214
e-value: 180.0
score: 1.6
coord: 217..244
e-value: 4.2
score: 16.3
coord: 293..332
e-value: 8.6E-4
score: 28.6
coord: 245..288
e-value: 0.0072
score: 25.5
IPR000742EGF-like domainPFAMPF00008EGFcoord: 294..330
e-value: 1.9E-5
score: 24.8
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 209..244
score: 7.776
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 290..332
score: 18.262
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 248..288
score: 8.701
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 217..292
e-value: 1.4E-15
score: 59.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.140coord: 172..216
e-value: 1.7E-11
score: 46.0
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 293..333
e-value: 1.1E-8
score: 37.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 569..600
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 569..591
NoneNo IPR availablePANTHERPTHR24044FAMILY NOT NAMEDcoord: 355..547
coord: 25..340
NoneNo IPR availablePANTHERPTHR24044:SF422DELTA-LIKE PROTEIN B-RELATEDcoord: 355..547
coord: 25..340
NoneNo IPR availableCDDcd00054EGF_CAcoord: 301..332
e-value: 5.08089E-5
score: 38.7718
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.574
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 293..340
NoneNo IPR availableTMHMMTMhelixcoord: 476..498
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 276..287
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 320..331
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 276..287
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 320..331
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 232..243