Alpha-int-4

Overview
NameAlpha-int-4
Smed IDSMED30034180
Length (bp)3559
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-int-4 (SMED30034180) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-int-4 (SMED30034180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-int-4 (SMED30034180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-int-4 (SMED30034180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034180SMESG000018926.1 dd_Smed_v4_11948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034180SMESG000018926.1 dd_Smed_v4_11948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034180SMESG000018926.1 dd_Smed_v4_11948_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30034180SMESG000018926.1 dd_Smed_v6_11948_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034180SMESG000018926.1 OX_Smed_1.0.10996ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30034180SMESG000018926.1 KU961520smed_ncbi_20200123PMID:28137894
Seebeck et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-int-4 vs. Ensembl Human
Match: ITGA8 (integrin subunit alpha 8 [Source:HGNC Symbol;Acc:HGNC:6144])

HSP 1 Score: 89.7373 bits (221), Expect = 2.189e-17
Identity = 112/455 (24.62%), Postives = 191/455 (41.98%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPII------SQPRNGLGKYYN--FGYSVA---LTSNSDGYVSSPL---SDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKC---IYSTDSNLEVQPLYMYDNITITLSLSLE------------DFIKNQYIDINFLKQLKVLSQVKINDNSQLNR-FKLI 1639
            ++++ GATVKA     ++  +V C PL+H   +  + E  P G CY+ ++N       +              C  GFS+D        NG +++VG P    + G         II N   K I+       Q       Y +   GYSVA    T +S   + + +   +  +G    +I     +T   N       S FG T+    +       V++GAP    +  ++    VG++Y++   +         L G E    FG  +A++GD+N DG  D+AI  PF   D+ +G V +Y  N++  +   P Q+L+     +A    FG  + G SD+D N +PD+IV +  +  + +Y +R + T      ++    NLE +   + D++T     SL               +    + ++ LKQ   + +    DN Q +R F L+
Sbjct:  132 SNQWFGATVKA-----HKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAYAEFSPCRNSNADPEGQGYCQAGFSLDFYK-----NG-DLIVGGPGSFYWQGQVITASVADIIANYSFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFG--YVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQIYLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQ-RGKVLIYNGNKDG-LNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMAEVQLDSLKQKGAIKRTLFLDNHQAHRVFPLV 571          
BLAST of Alpha-int-4 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 87.4261 bits (215), Expect = 1.262e-16
Identity = 110/407 (27.03%), Postives = 177/407 (43.49%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEF--CK---LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYN----------------FGYSVALTS-NSDG---------YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYA-VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDF----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYM-YDNITITL 1516
            ++ GA+V+     S +  I+ C PL  W     +E +P G C+L      Q+ T T +E+  C+   + A     C GGFS+D    +       +L+G P    + G ++I++   + +     N     YN                 GYSVA+   N DG           +  L   Y  +  N+      T      +  F V  T ++   G  YA V IGAP      S   +Q VG+V +       + A  DF    L+G E    FG  +A +GD++ DG  D+AI++P+   D+ KG V ++    +  +   P QIL+ Q    +    FG ++ G +D+D NG+PD+IV +   +   +Y +R + T       ++ LEV P  +  DN T +L
Sbjct:   76 QWFGASVR-----SKQDKILACAPLYHWRTEMKQEREPVGTCFL------QDGTKT-VEYAPCRSQDIDADGQGFCQGGFSIDFTKAD------RVLLGGPGSFYWQG-QLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDIN---GDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSL-----QRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDK-KGIVYIFN-GRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVIT------VNAGLEVYPSILNQDNKTCSL 447          
BLAST of Alpha-int-4 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 87.0409 bits (214), Expect = 1.421e-16
Identity = 110/407 (27.03%), Postives = 177/407 (43.49%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEF--CK---LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYN----------------FGYSVALTS-NSDG---------YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYA-VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDF----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYM-YDNITITL 1516
            ++ GA+V+     S +  I+ C PL  W     +E +P G C+L      Q+ T T +E+  C+   + A     C GGFS+D    +       +L+G P    + G ++I++   + +     N     YN                 GYSVA+   N DG           +  L   Y  +  N+      T      +  F V  T ++   G  YA V IGAP      S   +Q VG+V +       + A  DF    L+G E    FG  +A +GD++ DG  D+AI++P+   D+ KG V ++    +  +   P QIL+ Q    +    FG ++ G +D+D NG+PD+IV +   +   +Y +R + T       ++ LEV P  +  DN T +L
Sbjct:  122 QWFGASVR-----SKQDKILACAPLYHWRTEMKQEREPVGTCFL------QDGTKT-VEYAPCRSQDIDADGQGFCQGGFSIDFTKAD------RVLLGGPGSFYWQG-QLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDIN---GDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSL-----QRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDK-KGIVYIFN-GRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVIT------VNAGLEVYPSILNQDNKTCSL 493          
BLAST of Alpha-int-4 vs. Ensembl Human
Match: ITGA2B (integrin subunit alpha 2b [Source:HGNC Symbol;Acc:HGNC:6138])

HSP 1 Score: 81.2629 bits (199), Expect = 8.923e-15
Identity = 48/173 (27.75%), Postives = 94/173 (54.34%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFH----SVKSIQNVGKVYIFCSSNKNRS--APSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTA 1441
            S FG ++    +    R+ +++GAP +    + + +  VG+VY+F       +  APS  L G +    FG  +A +GD++ DG  D+A+++P+      +G V ++ + ++  ++  P Q+L S  P  +  FG ++ G  D+D NG+PD+IV +  +N + +Y ++ +  A
Sbjct:  129 SYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPY-GGPSGRGQVLVF-LGQSEGLRSRPSQVLDSPFPTGSA-FGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKA 298          
BLAST of Alpha-int-4 vs. Ensembl Human
Match: ITGA2B (integrin subunit alpha 2b [Source:HGNC Symbol;Acc:HGNC:6138])

HSP 1 Score: 80.8777 bits (198), Expect = 1.301e-14
Identity = 48/173 (27.75%), Postives = 94/173 (54.34%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFH----SVKSIQNVGKVYIFCSSNKNRS--APSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTA 1441
            S FG ++    +    R+ +++GAP +    + + +  VG+VY+F       +  APS  L G +    FG  +A +GD++ DG  D+A+++P+      +G V ++ + ++  ++  P Q+L S  P  +  FG ++ G  D+D NG+PD+IV +  +N + +Y ++ +  A
Sbjct:  318 SYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPY-GGPSGRGQVLVF-LGQSEGLRSRPSQVLDSPFPTGSA-FGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKA 487          
BLAST of Alpha-int-4 vs. Ensembl Celegans
Match: ina-1 (Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03600])

HSP 1 Score: 72.4034 bits (176), Expect = 1.942e-12
Identity = 97/402 (24.13%), Postives = 165/402 (41.04%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSAT----SYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGV-------KIINNPFGKPIISQP-----RNGLGKYYNFGYSVALTS----NSDGYVSSPLSD--QYG--------PNVTNIREDLQLTSPDNI-----PFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN--VGKVYIFCSSNKNRSA--------PSDFLHGKEKDEFFGYFLANIGDINGDGNQ--DLAISSPFLRNDEIKGFVALYTINENCE-MKQTPYQILKSQK-----PKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            N + L +T+  +S  +   + + C PL     +    P G CY L  N + + T  +     L  T     Y  CM GFS   ++ +  V G   L+G       GGV        I ++   K  ++QP     R  L  +   GYSV +        DG   + +S   +YG        P + +    L L     I       S+FG ++  + +       +++GAPF     I     G VY++ S    R          P   L   +    FG  +  +G+++GD ++  D A+ +PF  +    G V +Y   +N E  ++ P Q++K        P     FG +++GGSDMD NG+PD+++ S   N + +  SR + + +  +  +  +
Sbjct:  121 NDQLLASTI--VSKGTKNGSALVCAPLIRYHQTA-AYPQGACYELESNLRLQSTYATCAQKNLPTTDRHNEYGGCMEGFSA-AITQDTIVTG---LIGAVKWT--GGVFAKKSSANIFDSVVEKYTMNQPNGDMIRTRLVAHDYLGYSVDIGRFGFWYEDGKPITVVSGATRYGEHGAVIFLPFIQDSSSKLTLNEDKFIINGTAMGSAFGYSIEVVDLNGDGFDDLIVGAPFEHRSGIDGNFGGIVYVYFSQGVQRKQHESHLVFHPPKILKNPDFYSQFGLSITKLGNVDGDKSKLNDFAVGAPFAFDG--AGAVYIYLGTKNIEKFRKKPAQVIKGNDLPNLPPGGMRSFGFSLSGGSDMDENGYPDLLIGSPSKNFVALLRSRPVISIETKHKMEKRM 511          
BLAST of Alpha-int-4 vs. Ensembl Celegans
Match: pat-2 (Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot;Acc:P34446])

HSP 1 Score: 56.225 bits (134), Expect = 1.461e-7
Identity = 47/183 (25.68%), Postives = 91/183 (49.73%), Query Frame = 2
Query:  950 GVTLTTLSIFKGKRYAVVIGAPFH----SVKSIQ--------NVGKVYIFCSSNKNRSAPSDF-----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCE-MKQTPYQILKSQKPKNAGI--FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYT 1438
            G ++    + K  R  +++G PF+    SVK  +        +VGKV +       ++AP  F     + G ++   FG+ +A  GD+N DG  D+ + +P+   ++     A+Y I+ + + +++ P Q ++     +  I  FG ++TG  D+D NG PDI V + +S +  +  ++ + T
Sbjct:  304 GGSVAVADVNKDGRDDIIMGCPFYTDYGSVKDAKTQERKPQYDVGKVIVML-----QTAPGVFGKQIAVVGDDQWGRFGHAVAAAGDLNLDGYNDVIVGAPYAGKNKQG---AVYVIHGSKDGVRELPTQKIEGANIGHGNIKSFGFSLTGNEDVDGNGMPDIAVGAWKSGNAAVLLTKPVVT 478          
BLAST of Alpha-int-4 vs. Ensembl Fly
Match: ItgaPS4 (gene:FBgn0034005 transcript:FBtr0087371)

HSP 1 Score: 73.559 bits (179), Expect = 8.995e-13
Identity = 78/294 (26.53%), Postives = 133/294 (45.24%), Query Frame = 2
Query:  947 FGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSN----KNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK--SQKPKNAG--IFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQ---------YIDINFLKQLKVLSQVKINDNSQLN-RFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENC 1774
            FG ++    +    +  V+I AP +++++  + G +Y+F +      + R   S    G      FG  L+ IGDIN DG  D+A+ +PF  N    G V +Y  +EN  ++  P Q L   SQ+P   G  +FG  ++ GSD+D NG+ D  + +  + ++ +Y +  +     I        V P     NIT+   LS +   K +          IDI+   ++K L+       SQ++ + K   E I  EF         FT ++L+   +++  IP +    F E+C
Sbjct:  327 FGYSVLAEDLNGDGKTDVIISAPLYALRNSYDDGAIYVFINKGSFTFEERIIRSPAGSGGR----FGTTLSRIGDINKDGYNDVAVGAPFAGN----GSVFIYLGSENG-LRDPPSQCLDAPSQQPSKYGSYMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKIHAIIKPKLQ-NVNPEEERVNITVCYRLSSKSDSKAKALMEQELVIRIDIDTKSKIK-LAVFDEEHGSQMSFKAKAFHEEICSEFQIEMDKRAKFTPIALEMQYELSKKIPNS--GDFCEDC 607          
BLAST of Alpha-int-4 vs. Ensembl Fly
Match: scb (gene:FBgn0286785 transcript:FBtr0087370)

HSP 1 Score: 72.0182 bits (175), Expect = 2.662e-12
Identity = 61/232 (26.29%), Postives = 109/232 (46.98%), Query Frame = 2
Query:  947 FGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK--SQKPKNAG--IFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSL---SLEDFIKNQYIDINFL--KQLKVL--SQVKIND 1609
            FG ++    +    +  V++ AP H+++   + G +Y+F +               E    FG  L+ +GDIN DG  D+A+ +PF  N    G V +Y  +EN  ++  P Q L   SQ+P   G  +FG  ++ GSD+D NG+ D  + +  + ++ +Y +  +        ++S  E++P      IT    L   S +  ++ Q + I     KQLK +  +Q + N+
Sbjct:  350 FGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFAGN----GTVFIYLGSENG-LRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESR-EIKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMDKQLKRVKFTQTQTNE 575          
BLAST of Alpha-int-4 vs. Ensembl Fly
Match: scb (gene:FBgn0286785 transcript:FBtr0087369)

HSP 1 Score: 72.0182 bits (175), Expect = 2.662e-12
Identity = 61/232 (26.29%), Postives = 109/232 (46.98%), Query Frame = 2
Query:  947 FGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK--SQKPKNAG--IFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSL---SLEDFIKNQYIDINFL--KQLKVL--SQVKIND 1609
            FG ++    +    +  V++ AP H+++   + G +Y+F +               E    FG  L+ +GDIN DG  D+A+ +PF  N    G V +Y  +EN  ++  P Q L   SQ+P   G  +FG  ++ GSD+D NG+ D  + +  + ++ +Y +  +        ++S  E++P      IT    L   S +  ++ Q + I     KQLK +  +Q + N+
Sbjct:  350 FGYSVLAEDLNGDGKTDVIVSAPQHALEDSHDNGAIYVFINKGFFNFERQILRSPVETMARFGTALSRLGDINHDGYNDVAVGAPFAGN----GTVFIYLGSENG-LRDQPSQRLDAPSQQPSKYGSHMFGHGLSRGSDIDGNGFNDFAIGAPNAEAVYLYRAYPVVKVHATVKSESR-EIKPEQEKVKITACYRLSTTSTDKLVQEQELAIRIAMDKQLKRVKFTQTQTNE 575          
BLAST of Alpha-int-4 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0330398)

HSP 1 Score: 70.8626 bits (172), Expect = 6.331e-12
Identity = 97/402 (24.13%), Postives = 164/402 (40.80%), Query Frame = 2
Query:  353 CELKLNSTSTILDKVICSPLKADN--NSRYLGATVKAISLSSNEIA--IVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCK-----LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGK------------------PIISQPRNGL----GKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPF-SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDF---LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQK-----PKNAGI--FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQL 1432
            CE  +       D  I SP   D     +++G TV++  L +N     ++ C   +     +     G CYLL  ND Q + +   E CK          Y  C  G S  L+  +       M++G P    + G   +    G+                  P+      G+    G+++      A    S+G+    + D+   N   +   L     D   F SSFG  L T  I    R  +++ AP +  K+    G VY++   N   + P  +   L G  +  F G  LANIGD+N D  +DLA+ +P+    E  G V +Y +  +  +   P Q +++ +     P    I  FGI+I+G +D+D N +PD+++ +  S++  +  +R +
Sbjct:    8 CEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLL-TNDLQFEEVH--EPCKGRPVQRQHEDYGLCQAGTSAALLDDDT------MVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGHMSYAAGAPRSEGHGQVVIFDKSTDNPIPVHSIL-----DGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKT--EGGAVYVY--QNIQDTLPMKYTLKLTGPLESRF-GLALANIGDLNKDNCEDLAVGAPY----EGNGVVYIY-LGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPI 385          
BLAST of Alpha-int-4 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0340190)

HSP 1 Score: 70.8626 bits (172), Expect = 7.636e-12
Identity = 97/402 (24.13%), Postives = 164/402 (40.80%), Query Frame = 2
Query:  353 CELKLNSTSTILDKVICSPLKADN--NSRYLGATVKAISLSSNEIA--IVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCK-----LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGK------------------PIISQPRNGL----GKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPF-SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDF---LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQK-----PKNAGI--FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQL 1432
            CE  +       D  I SP   D     +++G TV++  L +N     ++ C   +     +     G CYLL  ND Q + +   E CK          Y  C  G S  L+  +       M++G P    + G   +    G+                  P+      G+    G+++      A    S+G+    + D+   N   +   L     D   F SSFG  L T  I    R  +++ AP +  K+    G VY++   N   + P  +   L G  +  F G  LANIGD+N D  +DLA+ +P+    E  G V +Y +  +  +   P Q +++ +     P    I  FGI+I+G +D+D N +PD+++ +  S++  +  +R +
Sbjct:  105 CEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYMYIVRENRYGQGLCYLL-TNDLQFEEVH--EPCKGRPVQRQHEDYGLCQAGTSAALLDDDT------MVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRFFGHMSYAAGAPRSEGHGQVVIFDKSTDNPIPVHSIL-----DGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKT--EGGAVYVY--QNIQDTLPMKYTLKLTGPLESRF-GLALANIGDLNKDNCEDLAVGAPY----EGNGVVYIY-LGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPI 482          
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Match: itga5 (integrin, alpha 5 (fibronectin receptor, alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-031116-52])

HSP 1 Score: 83.5741 bits (205), Expect = 1.048e-15
Identity = 95/382 (24.87%), Postives = 163/382 (42.67%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHV-PDSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPII-------------SQPRNGLGKYYNF-----GYSVALTS-----NSDGYVSSPLSDQYGPNVTNIREDL---QLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPS-DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI------FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCI 1450
            ++ GATV+      ++ +++ C PL  W    D+      G C++ +KN  +  E      EF       Y  C GGFS D           ++++G P    + G  I    F + I+              Q +    K   F     GYSVA+       + D     P   +    V+ +   L   ++ + + +  S +G ++    I       +++GAP   V+     ++ +G+VY++         P    L G +    FG  +  +GD+N DG  D+AISSPF   D+ +G V +Y  N    +++ P Q++  Q   +AG+      FG A+ GG D+D NG+PD+IV +  ++   +Y SR +     I
Sbjct:  126 QWFGATVRV-----HQDSVLACAPLYSWRTKEDTPHADTTGSCFMSVKNFTKFVEYAPCRTEFRGRKGQGY--CQGGFSADFTQEG------KVVLGGPGSYFWQGQVI--TAFKQEIVKAYYPGYFLTSVGGQIQTKQRKEIRFDDTYMGYSVAVGEFTGDDDEDFVTGVPRGVRLHGQVSILNSSLDVLKMFTGEQMG-SYYGYSVAATDINNDGMMDLLVGAPMFMVRDSDGRLEELGRVYVYMQKGPLDLIPQLPHLTGTQMFARFGSSITPLGDLNQDGYNDVAISSPFGGEDK-QGLVLIYNGNAGG-LREKPSQVISGQW-ASAGLSAIPASFGYALRGGKDLDNNGYPDLIVGAFGADKAVLYRSRPIVNTSAI 488          
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Match: itgav (integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616-382])

HSP 1 Score: 80.4925 bits (197), Expect = 1.127e-14
Identity = 101/437 (23.11%), Postives = 177/437 (40.50%), Query Frame = 2
Query:  275 VVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADN-------NSRYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATS---YSTCMGGFSVDLMSMNNQV-NGIEMLVGMPHMIPFGGVKIINN-------PFGKPIISQPRNGLGKYYNFGYSVALTS-NSDG---YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSS----FGVTLTTLSIFKGKRYAVVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ G  +  + D T +   E   V  C  + + T T +        K  N       ++++ GATV+     S+   I+ C PL  W      E +P G CYL     K+   +     C+  + S      C  GFS D +  N  V  G         +I     ++IN        P+   + ++P          GYSVA+   N DG   YV+     +      NI     + S  N   +     FG ++  + +    +  + +GAP      S   ++ VG+VY++             L G E    +G  + ++GD+N DG  D+AI++P+      +G V ++    +        Q+L+      +    FG ++ GG+D+D NG+PD+IV +  ++         LY A+ + S ++ L++ P
Sbjct:   59 ILVGAPRANTSDQTPSAVTERGAVFSCPWQKSGTCTQIQFDSTDDRKHSNGQQMEFKSNQWFGATVR-----SSGDQILACAPLYQWSTYGFSEREPVGTCYL-----KKGNNIVEYSPCRSKSNSPEGQGFCQAGFSADFVKKNRVVIGGPGSFYWQGQLISDDVTEVINRYNKEFLTPYSNQLSTKPAGAQYDDSYLGYSVAVGDFNEDGEDDYVTGVPRGEKALGYVNIFNGRNMESMYNFTGTQMAAYFGHSVAAVDVNNDGKMDLFVGAPLFMDRGSDGKLREVGQVYVYLGKGGFTFNSVIKLTGSEIYARYGSSVCSVGDLNMDGYNDVAIAAPY-GGPFHRGLVYIHN-GRSTGPNPVASQVLEGTWASVSMPSSFGYSMNGGTDVDQNGYPDLIVGAFGADKA------ILYRARPVISVNTTLDISP 477          
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 79.337 bits (194), Expect = 1.154e-14
Identity = 99/380 (26.05%), Postives = 163/380 (42.89%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQV-NGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRN-----GLGKYYN---FGYSVAL---TSNSDGYVSSPL---SDQYG----PNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI---FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ GATV+     +++  +V C PL+    V  S E  P G CY+ ++N       +              C  GFSVD       V  G         +I  G  +I+N    K I+ + +           Y+    GYSVA+   T +S+  + + +   +  +G     N TN+      T       S FG T+    +       V++GAP +  +  ++    VG+VY++   +    +P   L G      +G  +A +GDIN DG  D+AI +PF   D   G V +Y   ++  M Q   Q+LK     ++GI   FG  + G SD+D N +PD++V +   + +  Y SR + T       D+ L ++P
Sbjct:  134 QWFGATVR-----THKGKVVACAPLYQWRTVKVSSEMDPVGTCYVAVQNFSAYAEYSPCRTNNPDPEGQGFCQAGFSVDFTKEGTLVVGGPGSFYWQGQVITAGVAEILNGYSLKTILRKVQGEKQTVAASDTYDDSYLGYSVAVGEFTGDSEQELVAGVPRGAHNFGYVTVINATNLTFIQNFTGEQMA--SYFGYTIAVTDLNGDGLDDVLVGAPLYMDREFESKPREVGRVYLYLQEDVLLFSPPITLTGMHLFGRYGSAIAPLGDINQDGYLDVAIGAPFAGEDR-GGRVFIYNGQKSGLMLQAS-QVLKGDW-ASSGIPAGFGFTLRGDSDLDNNQYPDLLVGAFGVSKVVAYRSRPVVT------VDAQLILRP 497          
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 80.1073 bits (196), Expect = 1.174e-14
Identity = 111/451 (24.61%), Postives = 191/451 (42.35%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMP-------HMIPFGGVKIINNPFGKPIISQPRN-----GLGKYYN---FGYSVAL---TSNSDGYVSSPL---SDQYG----PNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI---FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTA---------------KCIYSTDSNLEVQPLYMYDNITITLS-LSLEDFIK-NQYIDINFLKQLKVLSQVKINDNSQLNR 1627
            ++ GATV+     +++  +V C PL+    V  S E  P G CY+ ++N       +              C  GFSVD            ++VG P        +I  G  +I+N    K I+ + +           Y+    GYSVA+   T +S+  + + +   +  +G     N TN+      T       S FG T+    +       V++GAP +  +  ++    VG+VY++   +    +P   L G      +G  +A +GDIN DG  D+AI +PF   D   G V +Y   ++  M Q   Q+LK     ++GI   FG  + G SD+D N +PD++V +   + +  Y SR + T                K     +S++ V  L +  N+   +S + + D++     + +++LKQ   + +V   D+ Q  R
Sbjct:  134 QWFGATVR-----THKGKVVACAPLYQWRTVKVSSEMDPVGTCYVAVQNFSAYAEYSPCRTNNPDPEGQGFCQAGFSVDFTKEGT------LVVGGPGSFYWQGQVITAGVAEILNGYSLKTILRKVQGEKQTVAASDTYDDSYLGYSVAVGEFTGDSEQELVAGVPRGAHNFGYVTVINATNLTFIQNFTGEQMA--SYFGYTIAVTDLNGDGLDDVLVGAPLYMDREFESKPREVGRVYLYLQEDVLLFSPPITLTGMHLFGRYGSAIAPLGDINQDGYLDVAIGAPFAGEDR-GGRVFIYNGQKSGLMLQAS-QVLKGDW-ASSGIPAGFGFTLRGDSDLDNNQYPDLLVGAFGVSKVVAYRSRPVVTVDAQLILRPRILNPEDKSCRMPNSDIMVTCLSV--NVCAKISGIGIPDYVALRMELQLDWLKQRGAVKRVLFMDSHQHQR 566          
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Match: itga3b (integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-050411-55])

HSP 1 Score: 80.1073 bits (196), Expect = 1.194e-14
Identity = 51/164 (31.10%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQIL--KSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASR 1426
            S FG  L    +       +++GAPF+  +  +  G VYIF + N +    +  +   +K   FG+ +A +GD+N DG QD+A+ +PF    +  G V ++ +     + + P Q++  KS  P     FG +++GG DMD N +PDI+V S   + I +  SR
Sbjct:  300 SYFGSCLAVTDLNNDDWNDLIVGAPFYFDRYKEEGGAVYIFMNENGSFQKKASLVLKGKKGSGFGFAVAAVGDVNQDGFQDIAVGAPF----QDSGKVYIW-MGSKSGITKEPSQVIEGKSLGPSGFQTFGYSLSGGMDMDGNDYPDILVGSL-DDRIALLRSR 457          
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Match: ITGA5 (integrin subunit alpha 5 [Source:NCBI gene;Acc:100492002])

HSP 1 Score: 91.2781 bits (225), Expect = 6.121e-18
Identity = 101/387 (26.10%), Postives = 164/387 (42.38%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPL--WHVP-DSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINN---------------PFGKPIISQPRNGLGKYYN--FGYSVALTSNS-----DGYVSSPLSDQ-YG----PNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQ--KPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            + ++ GATV+     S+   I+ C P   W    D K   P G CYL + N     E +    +F   +   Y  C GGFS +            +L+G P    + G  I                   + K +  Q R     Y +  FGYSVA+   S     D  V  P  +  YG     N T++R     +       S FG +++   +       ++IGAP    ++    +Q VG+VYI+   ++    P+  L G E+   FG  +A++GD++ DG  D+AI +PF   +  +G V ++   +   +   P Q+L+ Q    +    FG++  GG D+D NG+PD+IV +   +   +Y  R +  A    S   N+
Sbjct:  123 SEQWFGATVR-----SHGKTILACAPRYSWRTKKDEKHSDPVGTCYLSVNNFTTFVEYSPCRTDFSDAAGQGY--CQGGFSAEFTKSG------RVLLGGPGSYFWQGQVITATQDEIQEAYYPEYFVLEYKKQM--QTRQAASSYDDSYFGYSVAVGEFSGDDTEDFVVGVPKGNMTYGYVTILNGTDLRSLYNFSGEQMA--SYFGYSVSATDLNGDGLDDLLIGAPLLMDRTHDGRVQEVGRVYIYLQGDRMEGTPNLILTGTEEYGRFGSSIASLGDLDQDGFNDVAIGAPF-GGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGQDLDGNGYPDLIVGAFGVDKTLVYRGRPIIHASASLSISPNM 490          
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Match: ITGA5 (integrin subunit alpha 5 [Source:NCBI gene;Acc:100492002])

HSP 1 Score: 89.7373 bits (221), Expect = 2.139e-17
Identity = 91/370 (24.59%), Postives = 155/370 (41.89%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPL--WHVP-DSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPN--VTNIREDLQ----LTSPDNIPF----SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQ--KPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            + ++ GATV+     S+   I+ C P   W    D K   P G CYL + N     E +    +F   +   Y  C GGFS +            +L+G P                           G Y+  G  +  T +        + + Y P   V   ++ +Q     +S D+  F    S FG +++   +       ++IGAP    ++    +Q VG+VYI+   ++    P+  L G E+   FG  +A++GD++ DG  D+AI +PF   +  +G V ++   +   +   P Q+L+ Q    +    FG++  GG D+D NG+PD+IV +   +   +Y  R +  A    S   N+
Sbjct:  123 SEQWFGATVR-----SHGKTILACAPRYSWRTKKDEKHSDPVGTCYLSVNNFTTFVEYSPCRTDFSDAAGQGY--CQGGFSAEFTKSG------RVLLGGP---------------------------GSYFWQGQVITATQDE-------IQEAYYPEYFVLEYKKQMQTRQAASSYDDSYFGKMASYFGYSVSATDLNGDGLDDLLIGAPLLMDRTHDGRVQEVGRVYIYLQGDRMEGTPNLILTGTEEYGRFGSSIASLGDLDQDGFNDVAIGAPF-GGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGQDLDGNGYPDLIVGAFGVDKTLVYRGRPIIHASASLSISPNM 443          
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Match: ITGA5 (integrin subunit alpha 5 [Source:NCBI gene;Acc:100492002])

HSP 1 Score: 89.3521 bits (220), Expect = 2.310e-17
Identity = 91/370 (24.59%), Postives = 155/370 (41.89%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPL--WHVP-DSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPN--VTNIREDLQ----LTSPDNIPF----SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQ--KPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            + ++ GATV+     S+   I+ C P   W    D K   P G CYL + N     E +    +F   +   Y  C GGFS +            +L+G P                           G Y+  G  +  T +        + + Y P   V   ++ +Q     +S D+  F    S FG +++   +       ++IGAP    ++    +Q VG+VYI+   ++    P+  L G E+   FG  +A++GD++ DG  D+AI +PF   +  +G V ++   +   +   P Q+L+ Q    +    FG++  GG D+D NG+PD+IV +   +   +Y  R +  A    S   N+
Sbjct:  116 SEQWFGATVR-----SHGKTILACAPRYSWRTKKDEKHSDPVGTCYLSVNNFTTFVEYSPCRTDFSDAAGQGY--CQGGFSAEFTKSG------RVLLGGP---------------------------GSYFWQGQVITATQDE-------IQEAYYPEYFVLEYKKQMQTRQAASSYDDSYFGKMASYFGYSVSATDLNGDGLDDLLIGAPLLMDRTHDGRVQEVGRVYIYLQGDRMEGTPNLILTGTEEYGRFGSSIASLGDLDQDGFNDVAIGAPF-GGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGQDLDGNGYPDLIVGAFGVDKTLVYRGRPIIHASASLSISPNM 436          
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 87.8113 bits (216), Expect = 8.565e-17
Identity = 105/390 (26.92%), Postives = 166/390 (42.56%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSK---EPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPII------SQPRNGLGKYYN--FGYSVALTSNSDGYVSS-----PLSDQYGPNVTNIRED----LQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK---SQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYM 1492
            ++++ GATV+A     ++  +V C PL+H    K   E  P G CY+ ++N       +              C  GFS+D        NG ++ +G P    + G         II +   K II       Q +     Y +   GYSVA+   +D  V       P   Q    V+ I       +Q  + D +  S FG T+    +       +++GAP    +  ++    VGKVY++   +         L G E    FG  +A++GD+N DG  D+A+ SPF   D  KG V +Y  N N     T  QIL+   + +   AG FG  + G SD+D N +PD+IV +  +    +Y +R + T       D+ L + P+ +
Sbjct:  150 SNQWFGATVRA-----HKEKVVACAPLYHWRSIKPISEKDPVGTCYIAIQNFSAYAEYSPCRSDLADPAGQGVCQAGFSLDFYK-----NG-DLALGGPGSFYWQGQVFTASIADIIKDYSFKSIIRKISGEKQTKMAQSAYDDSYLGYSVAVGEFTDDSVQEVVAGVPRGAQNFGYVSIINSTDMTFIQNFTGDQMA-SYFGYTVAVSDVNNDGLDDILVGAPLFMDREFESNPREVGKVYLYMQESALEFRDPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDR-KGRVFIYNGNSNGLNTDT-SQILEGAWASQSMPAG-FGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVIT------VDAQLLLHPMIL 518          
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Match: rab5b (RAB5B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-489150])

HSP 1 Score: 85.1149 bits (209), Expect = 4.889e-16
Identity = 116/452 (25.66%), Postives = 192/452 (42.48%), Query Frame = 2
Query:  260 TNSSYVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNS------RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFC------KLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS-QPRNGLGKYYN-FGYSVALTSNSDGYV--SSPLSDQYGPNVTNIREDLQLTSPDNIPFSSF-GVTLTTLSIFKGKRYA-------------------VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKN--AGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ SY++ G  K    +++     E   VI C+ K +   +++     +   A N S      ++ GA+V+A         I+ C PL  W     +E +P G CYL   ND     +T +E+       K  A     C GGFS+D    N       +L+G P    + G ++I++   + +   +P      Y N      A  S  D Y+  S  + D  G N+ +    +   +      S + G T+T+L  F G++ A                   + IGAP      S   +Q +G+V ++   + N       L G E    F   +  +GDI+GDG  DLAI++P+   ++ KG V +Y    N  M   P QIL+ Q         FG ++ G +D+D NG+PD++V +  ++   +Y +R + T   +      LEV P
Sbjct:   50 SSGSYLLVGAPK---ANTSQPGIIEGGDVIKCDWKNSECRSVVFDPNGNRNYAVNESIEFKSHQWFGASVRA-----KHNKIMACAPLYHWRTEIKQEREPVGTCYL---NDG----ITVVEYAPCRSNAKTDAQEQGFCQGGFSIDFTEDN------RVLLGGPGSFYWQG-QLISDQVDEIVKKYKPEKYSITYENQLATRPASLSYDDSYLGYSVTVGDFSGDNIEDFVSGVPRAAKTLGMVSIYDGKTMTSLYNFTGEQMAAYFGYSVATSDINGDGLVDLFIGAPLFMDRGSDGKLQELGQVSVYLQHSTNGPQHLIKLTGFEIFARFSSCIGPLGDIDGDGFNDLAIAAPYGGVNK-KGLVYIYNGRPNG-MSIVPSQILEGQWASQHMPSSFGYSLKGATDVDENGYPDLLVGAFGADKAILYRARPVITVTSL------LEVNP 471          
BLAST of Alpha-int-4 vs. Ensembl Mouse
Match: Itgav (integrin alpha V [Source:MGI Symbol;Acc:MGI:96608])

HSP 1 Score: 85.8853 bits (211), Expect = 2.093e-16
Identity = 107/393 (27.23%), Postives = 173/393 (44.02%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEF--CK---LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYN----------------FGYSVALTS-NSDG---YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSS----FGVTLTTLSIFKGKRYA-VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDF----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ GA+V+     S +  I+ C PL  W     +E +P G C+L      Q+ T T +E+  C+   + A     C GGFS+D    +       +L+G P    + G ++I++   + I     N     YN                 GYSVA+   N DG   +VS          +  I +   ++S  N         FG ++    I  G  YA V IGAP      S   +Q VG+V +       + A  DF    L+G E    FG  +A +GD++ DG  D+AI++P+   D+ KG V ++    +  +   P QIL+ Q    +    FG ++ G +D+D NG+PD++V +   +   +Y +R + T       ++ LEV P
Sbjct:  122 QWFGASVR-----SKQDKILACAPLYHWRTEMKQEREPVGTCFL------QDGTKT-VEYAPCRSKNIDADGQGFCQGGFSIDFTKAD------RVLLGGPGSFYWQG-QLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDI-NGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSL-----QRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDK-KGLVYIFN-GRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVT------VNAGLEVYP 481          
BLAST of Alpha-int-4 vs. Ensembl Mouse
Match: Itga2b (integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601])

HSP 1 Score: 80.4925 bits (197), Expect = 1.029e-14
Identity = 106/429 (24.71%), Postives = 183/429 (42.66%), Query Frame = 2
Query:  341 TVILCELKLNSTSTILDKVICSPLKAD--NNSRYLGATV----------KAISLSSNEIAIVYCDPL--WHV---PDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYST------------CMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYY----NF--------------GYSVALTS-----NSDGYVSSPLSDQYGPNVTNIRED----LQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFH----SVKSIQNVGKVYIFCSSNKNR--SAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTA 1441
             V LC  K N          C+PL  D  + +R LG  +           A  +S N++ IV C P   W+V    D  E  P G C+L      Q Q+    E+    A + S+            C  GFS+ +          E+++G P    F G+ +   P  + IIS  R G   ++     F              GYSVA+       ++  YVS   +  +      I +     L     + +  S FG ++    +    R+ +++GAP +    + + +  VG+VY+F      +  S P+  L G +    FG  +A +GD+N DG  D+A+++P+      +G V ++ + ++  +   P Q+L S  P  +G FG ++ G  D+D NG+PD+IV +  ++ + +Y ++ +  A
Sbjct:   83 AVFLCPWKANGGK-------CNPLLFDLRDETRNLGFQIFQTFKTGQGLGASVVSWNDV-IVACAPWQHWNVLEKRDEAEKTPVGGCFL-----AQLQSGGRAEYSPCRANTMSSVYAESFRGDKRYCEAGFSLAVTQAG------ELVLGAPGGYFFLGL-LARVPI-ENIISSYRPGTLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEILDSYYQPLHRLHGEQM-ASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPY-GGPSGQGQVLIF-LGQSEGLSPRPSQVLDSPFPTGSG-FGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRAQPVVMA 486          
BLAST of Alpha-int-4 vs. Ensembl Mouse
Match: Itga8 (integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442])

HSP 1 Score: 78.1814 bits (191), Expect = 6.313e-14
Identity = 96/390 (24.62%), Postives = 166/390 (42.56%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPII------SQPRNGLGKYYN--FGYSVA---LTSNSDGYVSSPL---SDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK----SQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPL 1486
            ++++ GATV+A     ++  +V C PL+H   +  +    P G CY+ ++N       +              C  GFS+D        NG +++VG P    + G         II N   K I+       Q       Y +   GYSVA    T +S   + + +   +  +G    +I     +T   N       S FG T+    +       +++GAP    +  ++    VG+VY++  ++         L G E    FG  +A++GD+N DG  D+AI  PF   D+ +G V +Y  N    +   P Q+L+    SQ   +   FG ++ G +D+D N +PD++V +     + +Y +R + T       D+ L + P+
Sbjct:  131 SNQWFGATVRA-----HKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYCQAGFSLDFYK-----NG-DLIVGGPGSFYWQGQVITVSIADIIANYSFKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFG--YVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQ-RGKVLIYNGNPR-GLHSKPSQVLQGIWGSQTIPSG--FGFSLRGDADIDKNDYPDLLVGAFGKGKVAVYRARPVVT------VDAQLLLHPM 497          
BLAST of Alpha-int-4 vs. Ensembl Mouse
Match: Itga8 (integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442])

HSP 1 Score: 77.411 bits (189), Expect = 6.713e-14
Identity = 98/398 (24.62%), Postives = 170/398 (42.71%), Query Frame = 2
Query:  407 PLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPIISQ----------PRNGLGKYYNFGYSVA---LTSNSDGYVSSPL---SDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK----SQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPL 1486
            P++  +N ++ GATV+A     ++  +V C PL+H   +  +    P G CY+ ++N       +              C  GFS+D        NG +++VG P    + G         II N   K I+ +          P +    Y   GYSVA    T +S   + + +   +  +G    +I     +T   N       S FG T+    +       +++GAP    +  ++    VG+VY++  ++         L G E    FG  +A++GD+N DG  D+AI  PF   D+ +G V +Y  N    +   P Q+L+    SQ   +   FG ++ G +D+D N +PD++V +     + +Y +R + T       D+ L + P+
Sbjct:  126 PIEFKSN-QWFGATVRA-----HKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYCQAGFSLDFYK-----NG-DLIVGGPGSFYWQGQVITVSIADIIANYSFKDILRKLAAEKQTDVAPASYDDSY--LGYSVAAGEFTGDSQQELVAGIPRGAQNFG--YVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVYLYLQASALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQ-RGKVLIYNGNPR-GLHSKPSQVLQGIWGSQTIPSG--FGFSLRGDADIDKNDYPDLLVGAFGKGKVAVYRARPVVT------VDAQLLLHPM 497          
BLAST of Alpha-int-4 vs. Ensembl Mouse
Match: Itga6 (integrin alpha 6 [Source:MGI Symbol;Acc:MGI:96605])

HSP 1 Score: 77.411 bits (189), Expect = 8.609e-14
Identity = 85/343 (24.78%), Postives = 155/343 (45.19%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYT-AKCIYSTDSNLEVQPLYMY---DNITITLSLSLEDFIKNQYID--INFLKQLKVLSQVKINDNSQLNRFK------LITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNL--LFPLINWEKCTTI---IPIKKYICSNIFICNADIAAELVDRFG 1918
            SSFG  +  + +       +VIGAP +  +  +  G VY++ +     S          KD  FG  + NIGDIN DG  D+A+ +P+   D++ G V +Y  +    + + P Q+L+   P     FG +I G  D+D N +PD+ V S  S+S+ ++ SR +    K I  T + ++++   M      I + +    E   K    +  I+ L  L+   + + +  S   +F+        T+ +T+         +  T+   +N++D    IP+T      E    R+ N+L  + P++N  +  T+   +   K  C +  +CN+++  E   +FG
Sbjct:  314 SSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGKWSNVKPIRLNGTKDSMFGISVKNIGDINQDGYPDIAVGAPY---DDL-GKVFIYHGSPTGIITK-PTQVLEGTSP----YFGYSIAGNMDLDRNSYPDLAVGSL-SDSVTIFRSRPVINILKTITVTPNRIDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLNRQKQRAC-MEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEY--KFG 643          
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Match: sp|Q06274|ITA5_XENLA (Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga5 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.041e-17
Identity = 100/387 (25.84%), Postives = 165/387 (42.64%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPK---PNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINN---------------PFGKPIISQPRNGLGKYYN--FGYSVAL-----TSNSDGYVSSPLSD-QYG----PNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQ--KPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            + ++ GATV+A     +   I+ C P +     KE K   P G CYL + N     E +    +F   +   Y  C GGFS +            +L+G P    + G  I                   + K +  Q R     Y +  FGYSVA+      +  D  V  P  +  YG     N T++R     +       S FG +++   +       ++IGAP    ++    +Q VG+VY++   +   S P   L G E+   FG  +A++GD++ DG  D+AI +PF   +  +G V ++   +   +   P Q+L+ Q    +    FG++  GG D+D NG+PD+IV +   ++  +Y  R +  A    S   N+
Sbjct:  127 SEQWFGATVRA-----HGKTILACAPRYSWRTEKEEKRSDPVGTCYLSVNNFTTFVEYSPCRTDFSDAAGQGY--CQGGFSAEFTKSG------RVLLGGPGSYFWQGQVITATQDEIQEAYYPEYFVLEYKKQM--QTRQAASSYDDSYFGYSVAVGEFSEDATEDFVVGVPKGNITYGYVTILNGTDLRSLYNFSGEQMA--SYFGYSVSATDLNSDGLDDLLIGAPLFMDRTHDGRVQEVGRVYVYLQGDHMESTPHLILTGMEEYGRFGSSIASLGDLDQDGFNDIAIGAPF-GGEAQRGAVFIFN-GQPGGVDSKPSQVLQGQWGSSQQPSFFGLSTRGGHDLDGNGYPDLIVGAFGVDTTLVYRGRPIIHASASLSISPNM 494          
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Match: sp|P53708|ITA8_HUMAN (Integrin alpha-8 OS=Homo sapiens OX=9606 GN=ITGA8 PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 1.051e-16
Identity = 112/455 (24.62%), Postives = 191/455 (41.98%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPII------SQPRNGLGKYYN--FGYSVA---LTSNSDGYVSSPL---SDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKC---IYSTDSNLEVQPLYMYDNITITLSLSLE------------DFIKNQYIDINFLKQLKVLSQVKINDNSQLNR-FKLI 1639
            ++++ GATVKA     ++  +V C PL+H   +  + E  P G CY+ ++N       +              C  GFS+D        NG +++VG P    + G         II N   K I+       Q       Y +   GYSVA    T +S   + + +   +  +G    +I     +T   N       S FG T+    +       V++GAP    +  ++    VG++Y++   +         L G E    FG  +A++GD+N DG  D+AI  PF   D+ +G V +Y  N++  +   P Q+L+     +A    FG  + G SD+D N +PD+IV +  +  + +Y +R + T      ++    NLE +   + D++T     SL               +    + ++ LKQ   + +    DN Q +R F L+
Sbjct:  132 SNQWFGATVKA-----HKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAYAEFSPCRNSNADPEGQGYCQAGFSLDFYK-----NG-DLIVGGPGSFYWQGQVITASVADIIANYSFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFG--YVSIINSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQIYLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQ-RGKVLIYNGNKDG-LNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMAEVQLDSLKQKGAIKRTLFLDNHQAHRVFPLV 571          
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Match: sp|P06756|ITAV_HUMAN (Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 6.826e-16
Identity = 110/407 (27.03%), Postives = 177/407 (43.49%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEF--CK---LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYN----------------FGYSVALTS-NSDG---------YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYA-VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDF----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYM-YDNITITL 1516
            ++ GA+V+     S +  I+ C PL  W     +E +P G C+L      Q+ T T +E+  C+   + A     C GGFS+D    +       +L+G P    + G ++I++   + +     N     YN                 GYSVA+   N DG           +  L   Y  +  N+      T      +  F V  T ++   G  YA V IGAP      S   +Q VG+V +       + A  DF    L+G E    FG  +A +GD++ DG  D+AI++P+   D+ KG V ++    +  +   P QIL+ Q    +    FG ++ G +D+D NG+PD+IV +   +   +Y +R + T       ++ LEV P  +  DN T +L
Sbjct:  122 QWFGASVR-----SKQDKILACAPLYHWRTEMKQEREPVGTCFL------QDGTKT-VEYAPCRSQDIDADGQGFCQGGFSIDFTKAD------RVLLGGPGSFYWQG-QLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDIN---GDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSL-----QRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDK-KGIVYIFN-GRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVIT------VNAGLEVYPSILNQDNKTCSL 493          
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Match: sp|P26009|ITA8_CHICK (Integrin alpha-8 OS=Gallus gallus OX=9031 GN=ITGA8 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.356e-15
Identity = 97/374 (25.94%), Postives = 160/374 (42.78%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGG-------VKIINNPFGKPII----SQPRNGLGK-YYN---FGYSVA---LTSNSDGYVSSPL---SDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCI 1450
            ++ GATVKA     ++  +V C PL+H   + DS E  P G CY+ ++N       +              C  GFS+D        NG +++VG P    + G         II N   K I+     + + G+    Y+    GYSVA    T +S+  + + +   +  +G    +I     LT   N       S FG T+    +       +++GAP    +  ++    VG+VY++   +         L G E    FG  + ++GD+N DG  D+A+ +PF   D  +G V +Y    N  +K  P Q+L       +    FG  + G SD+D N +PD+IV +  +    +Y +R + T   +
Sbjct:  116 QWFGATVKA-----HKEKVVACAPLYHWRTLKDSPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGFCQAGFSLDFYK-----NG-DLIVGGPGSFYWQGQVITASIADIITNYSFKDILRKLAHEKQTGVAPPTYDDNYMGYSVAAGEFTGDSEEELVAGVPRGAQNFG--YVSIINSSDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDILVGAPLFMEREFESKPKEVGQVYLYLQESAFLFRDPQILTGTEVFGRFGSAITHLGDLNQDGYNDIAVGAPFAGEDR-RGKVLIYNGYSNG-LKTDPSQVLNGAWASQSMPSGFGFTLRGDSDVDKNDYPDLIVGAFGAGKAVVYRARPVVTVNAL 474          
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Match: sp|P43406|ITAV_MOUSE (Integrin alpha-V OS=Mus musculus OX=10090 GN=Itgav PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 1.464e-15
Identity = 107/393 (27.23%), Postives = 173/393 (44.02%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEF--CK---LSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYN----------------FGYSVALTS-NSDG---YVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSS----FGVTLTTLSIFKGKRYA-VVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDF----LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ GA+V+     S +  I+ C PL  W     +E +P G C+L      Q+ T T +E+  C+   + A     C GGFS+D    +       +L+G P    + G ++I++   + I     N     YN                 GYSVA+   N DG   +VS          +  I +   ++S  N         FG ++    I  G  YA V IGAP      S   +Q VG+V +       + A  DF    L+G E    FG  +A +GD++ DG  D+AI++P+   D+ KG V ++    +  +   P QIL+ Q    +    FG ++ G +D+D NG+PD++V +   +   +Y +R + T       ++ LEV P
Sbjct:  122 QWFGASVR-----SKQDKILACAPLYHWRTEMKQEREPVGTCFL------QDGTKT-VEYAPCRSKNIDADGQGFCQGGFSIDFTKAD------RVLLGGPGSFYWQG-QLISDQVAEIISKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDI-NGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSL-----QRAVGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDK-KGLVYIFN-GRSTGLNSVPSQILEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVT------VNAGLEVYP 481          
BLAST of Alpha-int-4 vs. TrEMBL
Match: A0A1P8CUU5 (Alpha-int-4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1740.32 bits (4506), Expect = 0.000e+0
Identity = 887/889 (99.78%), Postives = 889/889 (100.00%), Query Frame = 2
Query:  638 MGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPXXXXXXXXXXXXXXXXXXFYKCGXXXXXXXXXXXXXXXVKKYDPIIVHPADIQTASS 3304
            MGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPI+SQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRIS+PLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASS
Sbjct:    1 MGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISIPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASS 889          
BLAST of Alpha-int-4 vs. TrEMBL
Match: A0A3R7CGW9 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_6734s PE=3 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.335e-101
Identity = 306/1204 (25.42%), Postives = 540/1204 (44.85%), Query Frame = 2
Query:   89 YINLISAK-------WIPEL--NFHPNFDQFQYYESDSFHQIYSASDGVF--------PANFEWQSIASTTLKSTNSSYVVFGGSKHIS---EDSTSAFYRESSTVILCELK---LNSTSTILD------KVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYL-LLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMS-------MNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS-----QPRNGLGKYYNFGYSVALTSNSDGYVSSP----LSDQYGPNVTNI-------REDLQLTSPDNIP-------FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS---------IQNVGKVYIFC---SSNKNRSAPS------DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFG-IAITGGSDMDFNGWPDII------VSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSL---------EDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDM----NLTIPVTIGYRFVENC--------ENRKCNN---LLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGN------------------------EVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTE----------SNFKDLISTNQTKATCKLEN----------YEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSR--NRSQPMNLG----QRVTIDIIGPRLSQTFIIDNIGKAV-INNIVVRISVP----LQTKENL---YILYLFDKIR----GVNQSQVGWMSIVPHAVV------GAEKYPCSL--PSEFVNPLKIIGFETHESHLK----------DIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWP 3133
            Y+NL   +       W P       P+F  FQ ++   F QI S S  +           NF W +++ T++K    SYV+ GGS   S   +   S   RE  T+ LCE +   LN             +++       +   +LG++  AI+LS N   + YCDPLW    ++   P G+C+L  ++N + ++ +   EFC+   T  + CM G SV L S       M   +  I + +G P  +P G ++I+++PFG  +++     +P + L    +FG+ +      DG  ++P    LSD +  N   +       R    L   D +        F+ FG+++  ++  K  + A+VIGAP+H   +           N G++Y+FC   +S+  R+  +      D++ G     F G+ L  +     DG+  +A  +P L N    G V +  I  +C   + P QI+  Q    +  FG I  T G D+DFN   D +      VSS+   S+ M A+R +  A+C ++    L ++ +   D++ IT+S+ L         E  I++ + D    + +  ++      +  + RFKL   P +    +   IS+ F +++  +V+DM    + T  + +GYRF++ C        E+  C++   +  PLINW +C T+IP+ +++C     C +D+   +  +                           ++IYG        L +K+YNYGPT   G+   +  + NLR +++   E          +N +  ++ N+T A C L+N          +  +      + +  Y+ ++  +         V +++ +   D  L +NV  + Y  + +P + LS   +    + SR  NR++P+  G    +RV +D IGPR+  T  ++ +G    + N+ +R+SVP    +  +E L   Y++Y+F +IR    G+   Q  W+ + P  V       G     C++   +E +NPL +IG +  +++ +          D   T +D  LH     S     +  + + +   L    RIP E ++C+R G  L+ P+C  I C +  LP N+   + +  WL+A TFF K ISD++V +T+SVD   +P+GV +    PV  +  +Q F F  ++  ++H  P WP
Sbjct:   28 YVNLAKQEYNERVHLWNPPTPDGLKPDFRPFQLFD---FTQIESVSRELLQVIRTKHPTGNFRWTTVSLTSIKGLKKSYVLLGGSAQRSSTFDTDLSVSPREGGTMFLCEFESKLLNENPLGFGSGKNGCRILPPGASGTSEHEFLGSSSSAITLSDNLSVLAYCDPLWR---AQSQVPVGRCFLNTIRNGQVDRFVELSEFCQSGLTVATPCMAGHSVALSSRKTPKPDMKGLLEDIRLWIGEPLSVPDGRIEIVSDPFGSAVVTTVSRPEPMSNLSFGSHFGFRIV-----DGVATAPQIFGLSDSHSVNTAQLIGIEKDGRGTRHLNYIDWVGGVNSTDMFTGFGMSMVRITFGKFGQIALVIGAPYHGSPNDTDASDKTRFVNRGRIYLFCPHLTSSTARTEEARFILYNDYIDGSANTSFLGFSLTALSKPTADGSVLIAAGAPDLDNRIGYGQVYILRILPDCSFDKVPVQIV--QGALGSLDFGAILPTDGVDIDFNNLSDFVIPTSSEVSSSVPTSLYMVAARPILQAECRFTFPPWLSIRRILTGDSLPITVSVYLSGNEGTGKSEGSIQSVFDDQEARRLIHQIAPDWNATSESVQRFKLQGRPRSNMDRTQKQISIDFILVAQMDVQDMLDIESPTKGLFVGYRFLQPCPEYSRTTDEDGTCSDGVGIRRPLINWSRCVTLIPLARFVCYPHENCESDVHVNVTHQLNTKKSSEEKIRMVQEENSEGSIVQLVDLIYGDADYSEPGLLIKLYNYGPTFAGGVWLELQFYGNLRFSRLQAYETEPDLTVGLDANIRVDVTANETWAACYLDNLPAPDTMDVMHRENVPAVWFLKLSTYYPNYTLAGVNFTLGAGVTIKVITGTPDPVLRDNVVHVKYRVMSDPKLRLSYGPEP---VTSRMDNRTKPVFWGSGFQRRVDVDEIGPRVEHTVQVEYMGPTRKLTNVTIRMSVPSALAMSDREGLLDAYVVYIFPEIRASVDGIGGLQ--WIDLAPKLVAKEGNAGGQRIGVCTVLNSNETMNPLNMIGMDIRKTYSRARRQAIPARGDDAYTQMDYSLHNRSTESTLSDSLEETISFSSTSL--FRRIPKEILQCDRVGYRLEQPVCAQIVCRLDELPKNRPVLLSVTGWLWARTFFHKHISDIEVVTTLSVDQGALPEGV-IPASEPVGYFHVWQTFFFPQIRPKLIHQIPTWP 1210          
BLAST of Alpha-int-4 vs. TrEMBL
Match: H2KNX5 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_100922 PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 8.964e-101
Identity = 305/1202 (25.37%), Postives = 540/1202 (44.93%), Query Frame = 2
Query:   89 YINLISAK-------WIPEL--NFHPNFDQFQYYESDSFHQIYSASDGVF--------PANFEWQSIASTTLKSTNSSYVVFGGSKHIS---EDSTSAFYRESSTVILCELK---LNSTSTILD------KVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYL-LLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMS-------MNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS-----QPRNGLGKYYNFGYSVALTSNSDGYVSSP----LSDQYGPNVTNI-------REDLQLTSPDNIP-------FSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS---------IQNVGKVYIFC---SSNKNRSAPS------DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFG-IAITGGSDMDFNGWPDII------VSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSL---------EDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDM----NLTIPVTIGYRFVENC--------ENRKCNN---LLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGN------------------------EVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTE----------SNFKDLISTNQTKATCKLENYEI-DANEFIA---------IDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSR--NRSQPMNLG----QRVTIDIIGPRLSQTFIIDNIGKAV-INNIVVRISVP----LQTKENL---YILYLFDKIR----GVNQSQVGWMSIVPHAVV------GAEKYPCSL--PSEFVNPLKIIGFETHESHLKDIDKT-PVDG------LLHFIRKRSANQPFINASANANKMPLGKM-NRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWP 3133
            Y+NL   +       W P       P+F  FQ ++   F QI S S  +           NF W +++ T++K    SYV+ GGS   S   +   S   RE  T+ LCE +   LN             +++       +   +LG++  AI+LS N   + YCDPLW    ++   P G+C+L  ++N + ++ +   EFC+   T  + CM G SV L S       M   +  I + +G P  +P G ++I+++PFG  +++     +P + L    +FG+ +      DG  ++P    LSD +  N   +       R    L   D +        F+ FG+++  ++  K  + A+VIGAP+H   +           N G++Y+FC   +S+  R+  +      D++ G     F G+ L  +     DG+  +A  +P L N    G V +  I  +C   + P QI+  Q    +  FG I  T G D+DFN   D +      VSS+   S+ M A+R +  A+C ++    L ++ +   D++ IT+S+ L         E  I++ + D    + +  ++      +  + RFKL   P +    +   IS+ F +++  +V+DM    + T  + +GYRF++ C        E+  C++   +  PLINW +C T+IP+ +++C     C +D+   +  +                           ++IYG        L +K+YNYGPT   G+   +  + NLR +++   E          +N +  ++ N+T A C L+N    D  + +          + +  Y+ ++  +         V +++ +   D  L +NV  + Y  + +P + LS   +    + SR  NR++P+  G    +RV +D IGPR+  T  ++ +G    + N+ +R+SVP    +  +E L   Y++Y+F +IR    G+   Q  W+ + P  V       G     C++   +E +NPL +IG +  +++ +   +  P  G      + + +  RS      +A           +  RIP E ++C+R G  L+ P+C  I C +  LP N+   + +  WL+A TFF K ISD++V +T+SVD   +P+GV +    PV  +  +Q F F  ++  ++H  P WP
Sbjct:   28 YVNLAKQEYNERVHLWNPPTPDGLKPDFRPFQLFD---FTQIESVSRELLQVIRTKHPTGNFRWTTVSLTSIKGLKKSYVLLGGSAQRSSTFDTDLSVSPREGGTMFLCEFESKLLNENPLGFGSGKNGCRILPPGASGTSEHEFLGSSSSAITLSDNLSVLAYCDPLWR---AQSQVPVGRCFLNTIRNGQVDRFVELSEFCQSGLTVATPCMAGHSVALSSRKTPKPDMKGLLEDIRLWIGEPLSVPDGRIEIVSDPFGSAVVTTVSRPEPMSNLSFGSHFGFRIV-----DGVATAPQIFGLSDSHSVNTAQLIGIEKDGRGTRHLNYIDWVGGVNSTDMFTGFGMSMVRITFGKFGQIALVIGAPYHGSPNDTDASDKTRFVNRGRIYLFCPHLTSSTARTEEARFILYNDYIDGSANTSFLGFSLTALSKPTADGSVLIAAGAPDLDNRIGYGQVYILRILPDCSFDKVPVQIV--QGALGSLDFGAILPTDGVDIDFNNLSDFVIPTSSEVSSSVPTSLYMVAARPILQAECRFTFPPWLSIRRILTGDSLPITVSVYLSGNEGTGKSEGSIQSVFDDQEARRLIHQIAPDWNATSESVQRFKLQGRPRSNMDRTQKQISIDFILVAQMDVQDMLDIESPTKGLFVGYRFLQPCPEYSRTTDEDGTCSDGVGIRRPLINWSRCVTLIPLARFVCYPHENCESDVHVNVTHQLNTKKSSEEKIRMVQEENSEGSIVQLVDLIYGDADYSEPGLLIKLYNYGPTFAGGVWLELQFYGNLRFSRLQAYETEPDLTVGLDANIRVDVTANETWAACYLDNLPAPDTTDVMHRENVPAVWFLKLSTYYPNYTLAGVNFTLGAGVTIKVITGTPDPVLRDNVVHVKYRVMSDPKLRLSYGPEP---VTSRMDNRTKPVFWGSGFQRRVDVDEIGPRVEHTVQVEYMGPTRKLTNVTIRMSVPTALAMSDREGLLDAYVVYIFPEIRASVDGIGGLQ--WIDLAPKLVAKEGNAGGQRIGVCTVLNSNETMNPLNMIGMDIRKTYSRARRQAIPARGGDAHTQMDYNLHNRSTESTLSDALEETISFSSTSLFRRIPKEILQCDRVGYRLEQPVCAQIVCRLDELPKNRPVLLSVTGWLWARTFFHKHISDIEVVTTLSVDQGALPEGV-IPASEPVGYFHVWQTFFFPQIRPKLIHQIPTWP 1210          
BLAST of Alpha-int-4 vs. TrEMBL
Match: A0A1S8WI91 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_10058 PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 1.047e-100
Identity = 305/1201 (25.40%), Postives = 536/1201 (44.63%), Query Frame = 2
Query:  119 PELNFHPNFDQFQYYESDSFHQIYSASDGV-------FP-ANFEWQSIASTTLKSTNSSYVVFGGSKHIS---EDSTSAFYRESSTVILCELK---LNSTSTILD------KVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYL-LLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMS---------MNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS-----QPRNGLGKYYNFGYSVALTSNSDGYVSSP----LSDQYGPNVTNI-------REDLQLTSPDNIP-------FSSFGVTLTTLSIFKGKRYAVVIGAPFH--------SVKSI-QNVGKVYIFCSSNKNRSAPS------DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFG-IAITGGSDMDFNGWPDIIV------SSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSL---------EDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDM-NLTIPVT---IGYRFVENC--------ENRKCNN---LLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGN------------------------EVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTE----------SNFKDLISTNQTKATCKLEN----------YEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLS-----ASSKQDTVIDSRNRSQPMNLG----QRVTIDIIGPRLSQTFIIDNIGKAV-INNIVVRISVP----LQTKENL---YILYLFDKIR----GVNQSQVGWMSIVPHAVV------GAEKYPCSL--PSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNR------------------------IPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWP 3133
            P     P+F  FQ ++     QI S S  +       +P  NF+W +++ T+ K    SYV+ GGS   S   +   S   RE  T+ LCE +   +N             +++    K+ +   +LG++  AI+LS +   + YCDPLW    ++   P G+C+L  ++N + ++++   EFC+   T  + CM G SV L S         M   +  I + +G P  +P G ++I+ +PFG  +++      P   L    +FG+ +      DG  ++P    LSD +  N   +       R    L   D +        F+ FG+++  ++  K  + A+V+GAP+H        S K++  N G++Y+FC  + + +  +      D++ G     F G+ L  +     DG+  +A  +P L N    G V +  I  +C   + P QI+  Q    +  FG I  T G D+DFN W D ++      SS+   S+ + A+R +  A+C ++    L ++ +   D+I IT+S+ L         E FI++ + D    + +  ++      +    RFKL   P +    +   +SV F +++  +V+DM ++  P     +GYRF++ C        E+  C++   +  PLINW +C T+IP+ +++C     C +D+   +  +                           ++IYG        L +K+YNYGPT   G+   +  + NLR +++   E          +N +  ++ N+T A C L+N          +  +      + +  Y+ ++  +         V +++ +   D  L +NV  + Y  I +P + LS      +S+ D      NR++P+  G    +RV +D IGPR+  T  ++ +G    + N+ +R+SVP    +  +E L   Y++Y+F +IR    G+   Q  W+ + P  V       G     C++   +E +NPL +IG +T  ++L        + LL + R R    P     A+  +M     NR                        IP E ++C+R G  L+ P+C  I C +  LP N+   + +  WL+A TFF K ISD++V +T+SVD   +P GV +    PV  +  +Q F F  ++  ++H  P WP
Sbjct:   47 PPDGLKPDFRPFQLFD---LTQIESVSQELLQVIRKKYPTGNFKWTTVSLTSNKGLKKSYVLLGGSAQRSSTFDTDISVSPREGGTMFLCEFESKLVNENPLGFGSGKNGCRILPPGAKSTSEHEFLGSSSSAITLSDDLSVLAYCDPLWR---AQSQVPVGRCFLNTIRNGQVDRSIELSEFCQSGLTVATPCMAGHSVALSSRKTSKPEPDMKRLLENIRLWIGEPLSVPDGRIEIVTDPFGSAVVTTVNRPDPMGNLSFGSHFGFRIV-----DGVATAPQIFDLSDSHSVNTAQLIGIEKEGRGTRHLNYIDWVGGVNSTDMFTGFGMSMVRITFGKFGQIALVVGAPYHGSPIDTDASNKTLFVNRGRIYLFCPQSTSPTEEAGFILYNDYIDGSANTSFLGFSLTALSKPRADGSVLIAAGAPDLDNRFGYGQVYILRILPDCSFDKVPVQIV--QGSLGSLDFGAILPTDGVDIDFNTWSDFVIPTSSEASSSAPTSLYVVAARPVLQAECRFTFPPWLSIRRILTGDSIPITVSVYLSGSDGTGKSEGFIQSVFDDQEARRLVHQIASDWNATSGSAQRFKLQGRPRSNMDRTQKQLSVDFILVAQMDVQDMLDIESPTKGFFVGYRFLQPCPGYSQTIDEDGTCSDGVGIRRPLINWSRCVTLIPLARFVCYPHENCESDVHINVTHQLYTKKSSEEKIHMVQEETSEGSIVQLVDLIYGDADYSEPGLLIKLYNYGPTFAGGVWLELQFYGNLRFSRLQAYETEQDLSVGLDANIRVDVTANETWAACYLDNLPAPDTADVMHRENVPAVWFLKLSTYYPNYTLAGINFTLGAGVTIKVITGTPDPVLRDNVVHVKYRVISDPKLRLSYGPDPVTSRMD------NRTKPVFWGSGFQRRVDVDEIGPRVEHTVQVEYMGPTRKLTNVTIRMSVPIALAMSDREGLLDAYVVYIFPEIRASVDGIGGLQ--WIDLAPKLVAKEGNAGGQRIGVCTVLNSNETLNPLNMIGRDTKTNYLS---HKRFESLLTYSRARRQAIPTRGGDAH-TQMDFNLQNRSMESTPGDSPEETISFSSTSLFRRIPKEILQCDRVGYRLEQPVCAQIVCHLDELPKNRPVLLTVTGWLWARTFFYKHISDIEVVTTLSVDQGALPDGV-VPASEPVGYFHVWQTFFFPQIRPKLIHQIPTWP 1221          
BLAST of Alpha-int-4 vs. TrEMBL
Match: A0A4S2LBP2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008456 PE=3 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.979e-100
Identity = 301/1204 (25.00%), Postives = 538/1204 (44.68%), Query Frame = 2
Query:   89 YINLISAK-------WIPEL--NFHPNFDQFQYYESDSFHQIYSASDGVF--------PANFEWQSIASTTLKSTNSSYVVFGGSKHISED---STSAFYRESSTVILCE-----LKLNSTSTILDKVICSPLKADNNS----RYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYL-LLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDL---------MSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS-----QPRNGLGKYYNFGYSVALTSNSDGYVSSP----LSDQYGPNVTNI-------REDLQLTSPDNIP-------FSSFGVTLTTLSIFKGKRYAVVIGAPFHSV---------KSIQNVGKVYIFCSSNKNRSAPS---------DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFG-IAITGGSDMDFNGWPDII------VSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSL---------EDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDM-NLTIPVT---IGYRFVENC--------ENRKCNN---LLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGN------------------------EVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTE----------SNFKDLISTNQTKATCKLENYEI-DANEFIA---------IDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSR--NRSQPMNLG----QRVTIDIIGPRLSQTFIIDNIGKA-VINNIVVRISVP----LQTKENL---YILYLFDKIR----GVNQSQVGWMSIVPHAVV------GAEKYPCSL--PSEFVNPLKIIGFETHESHLKDIDKT-PVDG------LLHFIRKRSANQPFINASANANKMPLGKM-NRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWP 3133
            Y+NL   +       W P       P+F  FQ ++   F QI S S  +           NF+W +++ T++K    SYV+ GGS   S       S   RE  T+ LCE     L  N       K  C  L   +N      +LG++  AI+LS +   + YCDPLW    ++   P G+C+L  ++N + ++++   EFC+   T  + CM G SV L         + +   +  I + +G P  +P G ++I+++PFG  +++      P   L    +FG+ +      DG  ++P    LSD +  N   +       R    L   D +        F+ FG+++  ++  K  + A+V+GAP+H               N G++Y+FC    + +A +         D++ G     F G+ L  +     DG+  +A  +P L N    G V +  I  +C + + P Q++  Q    +  FG I  T G D+DFN W D +      VSS+   S+ + A+R +  A+C ++    L ++ +   D++ +T+S+ L         E FI+  + D    + +  ++      +  + RFKL   P +    +   +S+ F +++  +V+DM ++  P     +GYRF++ C        E+  C++   +  PLINW +C T+IP+ +++C     C +D+   +  +                           ++IYG        L +K+YNYGPT   G+   +  + NLR +++   E          +N +  ++ N+T A C L+N    D  + +          + +  Y+ ++  +         V +++ +   D  L +NV  + Y  + +P + LS   +    + SR  NR++P++ G    +RV +D IGPR+  T  ++ +G    + N+ +R+SVP    +  +E L   Y++Y+F +IR    G+   Q  W+ + P  V       G     C++   +E +NPL +IG +  +++ +   +  P  G      + + ++ RS      +            +  RIP E ++C+R G  L+ P+C  I C +  LP N+   + +  WL+A TFF K ISD++V +T+SVD   +P GV +    PV  +  +Q F F  ++  ++H  P WP
Sbjct:   28 YVNLAKQEYNERVHLWNPPTPDGLKPDFRPFQLFD---FTQIESVSRELLQVIRTKHPTGNFKWTTVSLTSIKGLKKSYVLLGGSAQRSSKFDIDLSVSPREGGTMFLCEFESKSLNENPLGFGSGKNGCRILPPGSNGTSEHEFLGSSSSAITLSDDLSVLAYCDPLWR---AQSQVPVGRCFLNTIRNGQVDRSVELSEFCQSGLTVATPCMAGHSVALSARKTPKPEVDIKGLLENIRLWIGEPLSVPDGRIEIVSDPFGSAVVTTVSRPDPMGNLSFGSHFGFRIV-----DGVATAPQILGLSDSHSVNTAQLIGIEKEGRGTRHLNYIDWVGGVNSTDMFTGFGMSMVRITFGKFGQIALVVGAPYHGSPIDTDASDKTRFVNRGRIYLFCPQLTSPTARTEEARFILYNDYVDGSANTSFLGFSLTALSKPGADGSVLIAAGAPDLDNRIGYGQVYILRILPDCSLDKVPVQVV--QGALGSLDFGAILPTDGVDIDFNNWSDFVIPTSSEVSSSAPTSLYVVAARPVLQAECRFTFPPWLSIRRILTGDSLPVTVSVFLSGSDGTGKSEGFIQRAFDDQEARRLVHQIAPDWNATSGSVQRFKLQGRPRSNMDRTQKQLSIDFILVAQMDVQDMLDIESPTKGFFVGYRFLQPCPESSRTTDEDGTCSDDVGIRRPLINWSRCVTLIPLARFVCYPHENCESDVHVNVTHQLYTKKSSEEKIRMVQEETSEGSIVQLVDLIYGDADYSEPGLLIKVYNYGPTFAGGVWLELQFYGNLRFSRLQAYETEQDLAVGLDANIRVDVTANETWAACYLDNLPAPDTTDVMHRENVPAVWFLKLSTYYPNYTLAGVNFTLGAGVTIKVITGTPDPVLRDNVVYVKYRVMSDPKLRLSYGPEP---VTSRMDNRTKPVSWGSGFQRRVDVDEIGPRVEHTVQVEYMGPTKKLTNVTIRMSVPNALAMSDREGLLDAYVVYIFPEIRASVDGIGGLQ--WIDLAPKLVAKEGNAGGQRIGVCTVLNSNETLNPLNMIGMDIRKTYSRARRQAIPARGGDAYTQMDYNLQNRSIESTLSDPLEETISFSSTSLFRRIPKEILQCDRVGYRLEQPVCAQIVCRLDELPKNRPVLLTVTGWLWARTFFYKHISDIEVVTTLSVDQGALPDGV-VPASEPVGYFHVWQTFFFPQIRPKLIHQIPTWP 1212          
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Match: itga2b (integrin alpha-IIb [Source:NCBI gene;Acc:103045206])

HSP 1 Score: 89.7373 bits (221), Expect = 1.119e-17
Identity = 110/403 (27.30%), Postives = 176/403 (43.67%), Query Frame = 2
Query:  410 LKADNNSRYLGATVKAISLSSNEIAIVYCDPL--WHVPDSKEPK---PNGKCYLLLKNDKQEQTLTSIEFCKLSAT--SYST---------CMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIIS----QPRNGL-------GKYYNF----GYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYA-------------------VVIGAPFH----SVKSIQNVGKVYIFCSSNKNR--SAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKS--QKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAK 1444
            L +  + ++LGATV+A   S     I+ C PL  W+V   K+     P G C LL   D     L +   C+ +A   SY+          C  GFS D+           +++G P    F G +II  P  K + S     P + L        +Y+ +    GYSVA  + S G  SSP    Y   V  +  DL       I FS   VTLT     KG + A                   +++GAP        + ++ VG+VY++          AP   L G +    FG  +A +GD++ DG  D+A+ +P        G+V +Y + ++  +     Q+++S  Q PK A  FG ++ GG+D+D NG+PD+IV +  ++ + +Y ++ +   +
Sbjct:  112 LMSHKSDQWLGATVRAYKSS-----ILACAPLFHWNVVQGKDEAMNTPVGNCQLL---DTLTGNLANYAPCRGTAVEESYTRARNYQDRRYCEAGFSSDVTKDGT------VVLGAPGGFFFQG-QIITAPLQKIMASGKTFSPIHYLVGEAKSPERYHQYDVYLGYSVATGNFSAG--SSP---DY---VVGVPNDLNTIGSVKI-FSGSAVTLTAKKSLKGSQVASYFGHCVAVTDINSDGKDDILVGAPLFMELLPSQKLREVGQVYVYLQKEGYNISPAPDQTLTGTKTYGRFGSTIAPLGDLDHDGFNDVAVGAP---GSGEGGWVFIY-MGQSDGLNPHNMQVIESPFQPPKPAAAFGFSLRGGTDIDGNGYPDLIVGAWGADKVVVYRTKTVVKTR 486          
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Match: itga5 (integrin subunit alpha 5 [Source:NCBI gene;Acc:103025198])

HSP 1 Score: 89.3521 bits (220), Expect = 1.677e-17
Identity = 106/392 (27.04%), Postives = 167/392 (42.60%), Query Frame = 2
Query:  425 NSRYLGATVKAISLSSNEIAIVYCDPL--WHVP-DSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKI----------------INNPFGKPIISQPRNGLGKYYNFGYSVALTS----NSDGYVSS-PLSDQYGPNVTNIREDLQL--TSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNRSAPS-DFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCE-MKQTPYQILKSQ-----KPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            + ++ GATV+A     ++  ++ C PL  W    D+ E    G CYL ++N  +  E      EF       Y  C GGFS D           ++++G P    + G  I                + +  G+    Q +  +      GYSVA+      N + +V+  P   +    V+ +   L+   T       S FG  + T  I       +++GAP   V+     ++ +G+VY++  +      P    L G +    FG  +A +GD+N DG  D+AISSPF   DE +G V +Y  N   E ++  P Q+L  Q      P     FG A+ GG D+D NG+PD+IV +   +   +Y SR       I +T + L V P
Sbjct:  126 SHQWFGATVRA-----HKDTVLACAPLYSWRTKQDTPEADVTGSCYLSVRNFTKFVEYAPCRTEFHGEKGQGY--CQGGFSADFTKDG------KVVLGGPGSYFWQGQLISAVKEEIVKAYYPGFFLTSVMGQFQTKQKKEIVFDDTYMGYSVAVGEFSGDNEEDFVTGVPRGVRLHGQVSILNGSLETLKTFTGEQMGSYFGYAVATTDINNDGLMDLLVGAPMFMVRDSDGRLEELGRVYVYLQTGPLTLIPQLPHLTGTQTFGRFGSSIAPLGDLNQDGFNDVAISSPFSGKDE-QGQVFIY--NGYAEGLRDKPSQVLAGQWASNAPPAPPASFGFALRGGKDLDQNGYPDLIVGAFGVDKAVLYRSRP------IVNTSATLSVYP 495          
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Match: itga8 (integrin subunit alpha 8 [Source:NCBI gene;Acc:103045927])

HSP 1 Score: 84.7297 bits (208), Expect = 4.126e-16
Identity = 108/443 (24.38%), Postives = 181/443 (40.86%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPLWH---VPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQV-NGIEMLVGMPHMIPFGGVKIINNPFGKPIIS--QPRNGLGKYYN------FGYSVALT-----SNSDGYVSSPLSDQ-YG----PNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQN----VGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI---FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQ--------LYTAKCIYSTDSNLEVQ------PLYMYDNITITLSLSLEDFIK-NQYIDINFLKQLKVLSQVKINDNSQLNR 1627
            ++ GATV+     ++   +V C PL+H   V  S E  P G CY+ ++N       +              C  GFSVD       V  G         +I  G  +I+N    K I+   Q     G   +       GYSVA+      S  +     P   Q +G     N TN+      T       S FG T+    +       V++GAP +  +  ++    VG+VY++   +    +P+  L G      +G  +A +GDIN DG  D+A+ +PF  +D   G V +Y   ++  ++    Q+L+     ++GI   FG  + G SD+D N +PD+IV +  +  + +Y +R         L T + +   D    +       P    D       + + D +  N  + +++LKQ   + +V   D+ Q +R
Sbjct:  124 QWFGATVR-----THRGKVVACAPLYHWRTVKMSSEMDPVGTCYIAVQNFSAYAEYSPCRTNNPDPEGQGFCQAGFSVDFTKDGTLVLGGPGSFYWQGQVITAGVAEILNGYSLKAILRKVQGEKQTGAASDAYDDSYLGYSVAVGEFTGDSQQELVAGVPRGAQNFGYVAVINSTNLTFIQNFTGEQMA--SYFGYTVAVTDLNGDGLDDVLVGAPLYMDREFESKPREVGRVYLYLQEDALLFSPAIKLTGTHVFGRYGSAIAPLGDINQDGYLDVAVGAPFAGDDR-GGRVFIYN-GQHSGLRMEASQVLRGAW-ASSGIPAGFGFTLRGDSDLDNNQYPDLIVGAFGAGKVVVYRARPVVTVDAQLLLTPRILNPEDKTCHLPNSDTMVPCLRVDVCAKVSGIGIPDNVAVNMELQLDWLKQRGAVKRVLFLDSHQHHR 556          
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Match: itga6l (integrin alpha-6-like [Source:NCBI gene;Acc:103033526])

HSP 1 Score: 83.1889 bits (204), Expect = 1.375e-15
Identity = 60/187 (32.09%), Postives = 98/187 (52.41%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNV--GKVYIFCSSNKNRS----APSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            SSFG +LT + I       +++GAP  S   I +   G VYI+ +   ++      P+  LHG E    FG  +A+IGD+N DG  D A+ +P+   D + G V +Y        KQ P Q+L  ++ +N  +FG +++G  D+D NG+PD+ V S  +N +       ++ AK +   ++ LE+ P
Sbjct:  304 SSFGYSLTVVDINADGWDDLIVGAPQFSEPDINSFVGGAVYIYVNPKNSKDWDNIQPT-VLHGSEA-SMFGLAVASIGDVNHDGYNDFAVGAPY---DILDGAVYIYLGTAGDVSKQQP-QVLYGEQ-QNVKLFGYSLSGNMDIDGNGYPDLAVGSLSNNVV-------VFRAKPVVQLNTTLELSP 476          
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Match: ITGA7 (integrin subunit alpha 7 [Source:NCBI gene;Acc:103028643])

HSP 1 Score: 80.1073 bits (196), Expect = 1.180e-14
Identity = 92/389 (23.65%), Postives = 168/389 (43.19%), Query Frame = 2
Query:  413 KADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPD-----SKEPKPNGKCYLLLKNDKQEQTLTSIE--FCKLSATSYST---CMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQP-----RNGL-----GKYYNFGYSVALTSNSDGYVS----SPLSDQYGPNVTNIREDLQLTSPDNIPF-----SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI--FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPL 1486
            +   ++++LG TVK+  +      +V C  L+ +       S+   P G+CY+L ++  +   L   E  FC+     +     C  G +      NN V     L G P    + G+  + +P    ++ +      R+         Y  F    A    S G ++    +P ++  G  V   ++++    P+ I +     SSFG ++ T  +       +++GAP    +  +  G VY+F +   +             D  FG  ++++GD++ DG  D+A+ +PF    +  G V ++  + N  +   P Q+L      NAG+  FG +I+GG D+D N +PD+ V S  S+ + +Y SR +         D +LE QP+
Sbjct:  123 RESKDNQWLGVTVKSQGIGGK---VVACAHLYELRQRVNQLSETRDPIGRCYMLSEDLTERDDLDGGEWKFCEGRPQGHEQFGFCQQGLAASFTPDNNYV-----LFGAPGTYNWKGLLFMASPVEDALVYKTLEPSTRHAFEDVAQNSYLGFSVDSAKGIMSRGELTFVAGAPRANHTGAVVLLKKDNVYRLVPEYILWGEELASSFGYSVATTDLNSDGWTDLIVGAPNFFDRKAEIGGAVYVFLNPASHWEKARPIRLNGTYDSMFGMTVSSVGDLDQDGYGDVAVGAPF----DGDGKVFIFRGSANG-IDTKPSQVLDGL---NAGVKRFGYSISGGLDIDGNLYPDLAVGSL-SDQVVLYRSRPVIHV----VRDISLEPQPI 490          
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 84.7297 bits (208), Expect = 9.135e-17
Identity = 106/455 (23.30%), Postives = 187/455 (41.10%), Query Frame = 2
Query:  251 LKSTNSSYVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTIL------DKVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIE---FCKLSA-----TSYST------CMGGFSVDLMSMNNQV-NGIEMLVGMPHMIPFGGVKIINNPFGKPII------SQPRNGLGKYYN--FGYSVALTS----NSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIP----FSSFGVTLTTLSIFKGKRYAVVIGAPF----HSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQL-YTAKCIYSTDSNLEVQP 1483
            L +++S  VV G  +    ++T     E   V  C    ++  T +      D++I  P +A     Y        SL ++   ++ C PL+H             +  +K ++++  +T+     F K S      TS+        C GGFSVD       V  G         +I      ++ +P  + ++       Q  +    Y +   GYSV +      N   +V+             I +   +TS  N       S FG ++    +   K   V++GAP      S   ++ VG+VY+F               G+E    FG  LA +GD++ DG  D+A+  PF   +  +G V +Y  +++  +K  P Q+L+SQ P  +    FG A+ G  D+D NG+PD++V +         AS+ + Y A+ + + ++ L+++P
Sbjct:   54 LPASDSVSVVIGAPR---ANTTQPGVVEGGAVYNCPWAGDADCTTVKFDTKGDRMITLPTEAREKLEYKSKQWFGASLRTHGSKVLACAPLYH-------------WRTMKTNREKDPVTTYNINNFNKFSEYSPCRTSFGDPQGQGFCQGGFSVDFTKSGRVVLGGPGSFYWQGQLITAPSEAVMKDPTSESMVRSIEGQKQTSSAPPSYDDSYLGYSVTVGEFTGDNQQDFVTGVPKGFRTLGYVGILDGENMTSLYNFSGEQMASYFGFSVAVTDVNGDKLEDVLVGAPLFMDRGSDGKLREVGRVYLFLQERTLSFREPQRFTGEEMYSRFGSALAPLGDVDQDGFNDVAVGIPF-GGENRQGLVYIYNGDKDG-LKPAPSQVLESQWPGTSMPSSFGYALRGTVDVDKNGYPDLVVGA-------FGASKAIVYRARPVVTVEAELQLEP 483          
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005763.1 (pep scaffold:Pmarinus_7.0:GL478250:6840:43285:-1 gene:ENSPMAG00000005190.1 transcript:ENSPMAT00000005763.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 2.904e-14
Identity = 100/429 (23.31%), Postives = 186/429 (43.36%), Query Frame = 2
Query:  263 NSSYVVFGGSKHIS--EDSTSAF--YRESSTVILC-ELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSAT-------SYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINN-PFGKPIISQPRNGLGKYYNFGYSVAL----TSNSDGYVS-SPLSDQYGPN--VTNIREDLQLT--SPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNK-NRSAPSDFLHGKEK-DEFFGYFLANIGDINGDG--NQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNL 1471
            N ++V+ G  +  S  E S + F  + + +    C EL ++  +  +   +C   +AD   ++LG ++ A      E  ++ C       +  +  P+G C+L+   D +   +T    C + A         +++C  G +    + N       M++G P    + G  +++N   G    S P   + K    GYSV+        S G V+ +P  D  G    +T +  +LQ+T  S      S FG     + +       +++GAP HS    ++ G+V++F ++ + N       L G    +  FG  +  +GDIN D     D+AI +P    D+++G V +Y    +        +IL         +FG +I+G  DMD NG+PD+ V +  S++  ++ ++ + T +   S  S +
Sbjct:   59 NDTWVLIGAPQAQSGAERSGAVFKCHEDGAGGYSCSELPIDKRTGNVCGTLCRETRAD---QWLGVSL-AREAGGGESKVMACAHRRANVNPDDIFPHGICFLI-PPDLKPDAVTHTSPCSIGAVDAHDEMRQHASCQAGMAASSATQNF------MVLGGPGSFNWAGTVMLHNVSSGFTHFSTPDTVVTKDSYLGYSVSAGIFYNRTSLGVVAGAPRQDNVGKVYLLTLVEGELQITWQSSGKQLGSYFGSATCAVDLDADGLADLLVGAPQHS--ETRDEGRVHVFMNAGQGNLVEQKSLLSGANAYNAHFGQVIVALGDINDDRFEEPDVAIGAP--HEDDLRGAVYIYNGGPSGISHSFSQRILGRSVNGELSMFGHSISGVIDMDRNGYPDVTVGAFNSDAAVVFRAKAVVTVRAHVSLPSTV 472          
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 72.4034 bits (176), Expect = 4.694e-13
Identity = 59/234 (25.21%), Postives = 109/234 (46.58%), Query Frame = 2
Query:  791 LGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPF-----SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEV 1477
            LG   + G SV   +       +P ++  G  V   ++ L   +P+   +     SSFG  +T   +       +V+GAP +  +     G VY++ +        +       KD  FG  +ANIGDIN DG +D+A+ +P+    +  G V +Y         +    I+++ +      FG +ITGG D+D N +PD+++ S  S+ I +  +R + T   + ++D ++++
Sbjct:  260 LGFSMDSGKSVMARNRLSFVAGAPRANHTGAVVVLKKDSLSSLTPEQTIYGEELASSFGYDVTLADLNNDGWLDLVVGAPQYFDRREDIGGAVYVYMNQRGGFDEHNFIRLNGTKDSMFGLAVANIGDINQDGFEDIAVGAPY----DGSGKVFIYHGGRMGINPKASQVIVRTVEK-----FGYSITGGMDVDGNTYPDLLIGSL-SDKIALLRARPVITPNILVTSDKDIDI 483          
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 70.4774 bits (171), Expect = 1.857e-12
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFH----SVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMY 1495
            S FG T+    +       +++GAP +    S   ++ +G+VY++          +  L G++    +G  +  +GD++ DG  D+A+  PF   D   G V +Y    +  +   P Q L+ +         FG A+ GG+D+D NG+PD+IV +   +   +Y +R + T        + L V P+ ++
Sbjct:   86 SYFGYTVAVTDVNNDGLDDLLVGAPLYMERGSQGRLEELGRVYLYLQQAPLSLGAAQTLSGRDVYGRYGSAITPVGDLDQDGYNDVAVGMPFGGEDGT-GVVFVYN-GRDTGLMAIPSQTLRGRWASQGLPASFGFALRGGTDLDSNGYPDLIVGAFGVDKAIVYRARPVVT------VSAELTVSPMVLH 268          
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 67.0106 bits (162), Expect = 2.353e-11
Identity = 49/163 (30.06%), Postives = 89/163 (54.60%), Query Frame = 2
Query:  998 VVIGAPFHSVKSIQNVG-KVYIFCSSNKNRSAPSDF--LHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEV 1477
            +++GAP+   +S ++VG  VY++ + N           L G      FG  +A IGD++ DG QD+A+ +PF    E  G V +Y+   +  + + P Q+  + +P     FG +++GG D+D N +PD++V S  S+ + ++ SR + TA     TD ++++
Sbjct:  275 LLVGAPYFFDQSKKSVGGAVYVYLNDNDGGGERKKRVRLEGT-AGSGFGLTIAAIGDVDLDGFQDVAVGAPF----EESGRVYIYSGGPSGVITK-PAQVWHASQPG----FGYSLSGGLDVDGNLYPDLLVGSL-SDQVVLFRSRTVITADVHLLTDGDIDM 426          
BLAST of Alpha-int-4 vs. Ensembl Nematostella
Match: EDO48984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH6])

HSP 1 Score: 85.5001 bits (210), Expect = 1.126e-16
Identity = 53/172 (30.81%), Postives = 95/172 (55.23%), Query Frame = 2
Query:  935 PFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSS-----NKNRS-APSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQL 1432
            P S FG ++  + +       VVIGAPF+S K+  N G+V+++ ++     +K R  APS    G     +FG+ +AN+GD++ DG +D A+ +P+   +E  G V ++  +E    ++    I  +   ++   FG +I G  DMD NG+PD+++ +  S+S+ +  SR +
Sbjct:  322 PGSGFGFSVAGVDVNGDGWTDVVIGAPFYSTKNSPNEGRVFVYTNNGDGTFSKTRELAPSIARKGA----YFGHAVANLGDLDQDGYEDFAVGAPY---EEGTGVVYIFNGSETGVSQKAGQLIKPTDINQDLKTFGSSIAGKLDMDGNGYPDLLIGAYTSDSVVLLRSRPI 486          
BLAST of Alpha-int-4 vs. Ensembl Medaka
Match: ITGA7 (integrin subunit alpha 7 [Source:NCBI gene;Acc:101161550])

HSP 1 Score: 85.5001 bits (210), Expect = 2.384e-16
Identity = 92/370 (24.86%), Postives = 169/370 (45.68%), Query Frame = 2
Query:  413 KADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPD-----SKEPKPNGKCYLLLKNDKQEQTLTSIE--FCKLSATSYST---CMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGK---------PIISQPRNGLGKYYNFGYSV--ALTSNSDGYVS----SPLSDQYGPNVTNIREDLQLTSPDNIPF-----SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCS--SNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASR 1426
            K + ++++LG TVK+  +      +V C  L+ +       S+   P G+CY+L ++  +   L   E  FC+  +  +     C  G S      NN +     L G P    + G+  + +PF           P    P   +      G+SV  A+   S G ++    +P ++  G  V   ++++    P +I +     SSFG ++ T  + K     +++GAP    +  +  G VY++ +   + +  A    L+G   D  FG  + N+GD++ DG  D+A+ +PF  N    G V +Y    +  ++  P Q+L  +   + G FG +I+GG D+D N +PD+ V S  ++S+ ++ S+
Sbjct:  120 KENKDNQWLGVTVKSQGIGGK---VVTCAHLYELRQRVGQPSETRDPIGRCYVLSEDLTERDELDGGEWKFCEGRSQGHEQFGFCQQGLSASFTPDNNFI-----LFGAPGTYNWKGLLFMASPFEDGLLYKTVEPPKRPAPFEDVAHNSYLGFSVDSAMDLMSLGELTFVAGAPRANHTGAVVLLKKDNVHRLVPQHIFWGEELASSFGYSVATTDLNKDGWTDLIVGAPNFFDRKAEIGGAVYVYLNPFGHWDDQARPIRLNGT-YDSMFGMTVCNVGDLDQDGYGDIAVGAPFDGN----GKVFIYR-GSDAGIETKPAQVLDGRD-FDVGCFGYSISGGFDIDDNHYPDVAVGSL-NDSVVLFRSQ 473          
BLAST of Alpha-int-4 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 80.4925 bits (197), Expect = 8.506e-15
Identity = 55/168 (32.74%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAK 1444
            SSFG  L  L + K     +V+GAP   VK  +  G +YI+ + N N    +       KD  FG  + N+GDIN DG  D A+ +P+   D   G V +Y  +    + +   Q+L  Q P    +FG ++ G  D+D N +PD+ V S  S+S+ +Y +R +   K
Sbjct:  313 SSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYINKNGNWDQVTPTRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPY--KDNGVGQVYIYCGSATGIISEKDPQVLSGQ-PLGVKLFGYSLAGNMDLDKNTYPDLAVGSL-SDSVFVYRARPVVNIK 476          
BLAST of Alpha-int-4 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 80.4925 bits (197), Expect = 8.683e-15
Identity = 54/162 (33.33%), Postives = 82/162 (50.62%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASR 1426
            SSFG  L  L + K     +V+GAP   VK  +  G +YI+ + N N    +       KD  FG  + N+GDIN DG  D A+ +P+   D   G V +Y  +    + +   Q+L  Q P    +FG ++ G  D+D N +PD+ V S  S+S+ +Y +R
Sbjct:  313 SSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYINKNGNWDQVTPTRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPY--KDNGVGQVYIYCGSATGIISEKDPQVLSGQ-PLGVKLFGYSLAGNMDLDKNTYPDLAVGSL-SDSVFVYRAR 470          
BLAST of Alpha-int-4 vs. Ensembl Medaka
Match: itga6b (integrin alpha-6 [Source:NCBI gene;Acc:101167322])

HSP 1 Score: 80.4925 bits (197), Expect = 9.528e-15
Identity = 55/168 (32.74%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAK 1444
            SSFG  L  L + K     +V+GAP   VK  +  G +YI+ + N N    +       KD  FG  + N+GDIN DG  D A+ +P+   D   G V +Y  +    + +   Q+L  Q P    +FG ++ G  D+D N +PD+ V S  S+S+ +Y +R +   K
Sbjct:  313 SSFGYDLAVLDLNKDGWEDIVVGAPQFFVKDGEIGGAIYIYINKNGNWDQVTPTRINGPKDSMFGLAVENLGDINQDGYHDFAVGAPY--KDNGVGQVYIYCGSATGIISEKDPQVLSGQ-PLGVKLFGYSLAGNMDLDKNTYPDLAVGSL-SDSVFVYRARPVVNIK 476          
BLAST of Alpha-int-4 vs. Ensembl Medaka
Match: itga5 (integrin alpha-5-like [Source:NCBI gene;Acc:101158275])

HSP 1 Score: 78.9518 bits (193), Expect = 2.847e-14
Identity = 105/388 (27.06%), Postives = 165/388 (42.53%), Query Frame = 2
Query:  431 RYLGATVKAISLSSNEIAIVYCDPL--WHVP-DSKEPKPNGKCYLLLKNDKQ--EQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQV--NGIEMLVGMPHMIPFGGVKIIN----NPFGKPIISQPRNGLGKYYN----FGYSVALTSNSDGYVSSPLSD------QYGP----NVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKS----IQNVGKVYIFCSSNKNR-----SAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCE-MKQTPYQILKSQKPKNA--GIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQP 1483
            ++ GATV+     S+   ++ C PL  W    D+      G CYL ++N  +  E      E        Y  C GGFS D  +MN +V   G         +I      II       F + +  Q +   G+  +     GYSVA+   S   V   ++        YG     N T++   ++ T       S FG  L T  I       +++GAP   V+     ++ +G+VY++   +  +       P+    G +    FG  +A +GD+N DG  D+AIS PF   D+ KG V  Y  N   E +++   Q++K Q    A    FG ++ G  D+D NG+PD+IV +   +         LY A+ I +T ++L V P
Sbjct:  141 QWFGATVR-----SHGDTVLACAPLYSWRTEKDTPRSDVTGTCYLSVQNFTKFVEYAPCRTEISDADGQGY--CQGGFSADF-TMNGKVVLGGPGSYFWQGQVISAAKENIIRAYYPGYFMQAVDGQMQTKQGQSDHDDNYQGYSVAVGEFSGDEVEDFVTGVQKGRLLYGSVSILNGTDLTTMVEYTGEQM--GSYFGYALATTDINNDGMTDLLVGAPMFIVRGSDGHLEEMGRVYVYLQRSPLKLELRLPHPT----GTQMYGRFGSSIAALGDLNQDGFNDVAISCPFGGEDQ-KGLV--YIFNGFSEGLREKTSQVIKGQWAAGAVPPSFGFSLRGAKDLDMNGYPDLIVGAFGVDKA------VLYRARPIVNTSASLTVYP 505          
BLAST of Alpha-int-4 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 2172.51 bits (5628), Expect = 0.000e+0
Identity = 1095/1101 (99.46%), Postives = 1099/1101 (99.82%), Query Frame = 2
Query:   56 MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSSYVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPXXXXXXXXXXXXXXXXXXFYKCGXXXXXXXXXXXXXXXVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN 3358
            MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSS+VVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEI IVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPI+SQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDF+KNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPIT+EFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVG EKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN
Sbjct:    1 MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSSFVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIVIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFLKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITIEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGTEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN 1101          
BLAST of Alpha-int-4 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 1793.86 bits (4645), Expect = 0.000e+0
Identity = 876/883 (99.21%), Postives = 880/883 (99.66%), Query Frame = 2
Query:   56 MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSSYVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKT 2704
            MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSS+VVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEI IVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPI+SQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDF+KNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPIT+EFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVG EKYPCSLPSEFVNPLKIIGFETHESHLKDID T
Sbjct:    1 MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFEWQSIASTTLKSTNSSFVVFGGSKHISEDSTSAFYRESSTVILCELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIVIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFLKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITIEFDSATGISVTFTIMSLQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKYICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGTEKYPCSLPSEFVNPLKIIGFETHESHLKDIDAT 883          

HSP 2 Score: 383.259 bits (983), Expect = 3.307e-113
Identity = 220/221 (99.55%), Postives = 221/221 (100.00%), Query Frame = 2
Query: 2696 DKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPXXXXXXXXXXXXXXXXXXFYKCGXXXXXXXXXXXXXXXVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN 3358
            +KTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN
Sbjct: 1043 NKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRRHFRSKKVKKYDPIIVHPADIQTASSITTETRFTSHSALIDSTN 1263          
BLAST of Alpha-int-4 vs. Planmine SMEST
Match: SMESG000021746.1 (SMESG000021746.1)

HSP 1 Score: 328.946 bits (842), Expect = 2.774e-95
Identity = 275/1038 (26.49%), Postives = 500/1038 (48.17%), Query Frame = 2
Query:  113 WIPELNFHPNFDQFQYYESDSFHQIYSASDGVFPANFE-------WQSIASTTLKSTNSSYVVFGGSKHISEDSTSAFY-RESSTVILCELKLNSTSTILDKVICSPLKAD----NNSRYLGATVKAISLSSNEIAIVYCDPLWHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALTSNSDGYVSSPLSDQYGPNVTNIR-EDLQLTSPDNIPFSSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYIDINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNL-TIPVTIGYRFVENCE---NRKCNNLLFPLINWEKCTTIIPIKKYICSNIFI--CNADIAA-ELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIAIDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVN--QSQVGWMSIVPHAVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQ-PFINASANAN-------KMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVK-LRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWP 3133
            WIP            Y   ++F++ Y   D  F  NF+       W SIA +++ +   +++ F G+++ +  + ++ Y ++S  +ILC   +N+ S +   + C  L+      ++ +Y G+ V+++ L ++ IA +YCDPLW   +      NG+C L +  D   +       C      +  C+GGFSVD++++++ V   +++ G+P        K+ N      I   P N  G Y+N+GYSVA + +   Y SSP+ +   P VT +  E  + T      +  FG ++ T+++  G  YAVVIGAP+ S +++ NVG V++ C     +  P+D ++G+   + FGY +A +GDI+ +G+++  + +P L  D+  G + ++   E+C++ + P Q+ +S   K  G FGIAI+ G D++FNG PD  V+S  S    ++         C +     +E    ++ +  +  L +  +    N+Y +  +   + +L+Q +        RFKL    +  +       S    +  L +V+DM+  +IP  I  + V  C+   N+ C       + W  C  II + +  C   F+  C ++++   ++D  GN + YG    Y RT+ + I N GP     I+  I    ++RI+ I  + +    L  T    A+  ++N  I+A + + I +D+ + D +  S     N      ++S   D N+ NN   + Y  +++P + +S+ + ++  IDSR +   +    RV++  +G  LS +++I+N G   + N+ ++   P + + + YILYL DKIR     + ++   SI  +   G  KY C++  E +NPL +I  +  +S               +  KRSAN+  F N S + N        + L  + R  +  I+CN S   L  PICG++ C +  +P N +      AW++  TFF  +I  L V +T+  +   +PKG+  ++    + P    Q  +FN +K++     PLWP
Sbjct:   22 WIP-----------NYENENTFNEPYDFVDDKFLPNFQNFGSGYDWISIAGSSIINQKQAHIAFTGTRNNNVSNYNSVYTKQSGIIILCSSNINNASPLGFDLKCKNLEEQRLDSSSGKYFGSVVRSVKLKNDAIAFIYCDPLWMDNNLNLNISNGQCKLTIVKDSLIEKTIEYPVCD----KFKKCLGGFSVDIIAIDDDV---KIIFGLPFE---NSTKLSNLVEYSKIRDGPENK-GTYFNYGYSVAFSGDGSQYASSPVDNGDFPYVTRVNGEKFRPTDLKTQRYGGFGTSMDTVNL-GGNLYAVVIGAPYQSKQNLVNVGAVFLAC-----KGKPTDVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDK-PGKIYIFKTTESCQIFKKPLQVYQS---KFTG-FGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTW-----IEPSTGFIINEQSFELKVLFQSSNLNEYQNYGYQVAIDILNQGE-------PRFKLNNTELIED-------SYNLKLQPLLDVQDMDFKSIPFKIALKGVRKCKISGNKDCYLSKTSQVEWNHCEKIIKLPQQSC---FLRNCKSELSINSVIDTKGNIIYYGDRTDYLRTIRIVISNNGPDSLHRISMSIAMNPDIRIDNIKCSTTCKTKL--TAGRHASVLVKNL-IEAKDSVTISVDILYNDLEIMSSKTSIN----FTIWSINDDDNVANNNFNMEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEISLPSI--NNKNGLVKY-CNVAKEMLNPLNVIAHDYKKSET-------------YRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSL--IKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANL-ELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWP 977          
BLAST of Alpha-int-4 vs. Planmine SMEST
Match: SMESG000022733.1 (SMESG000022733.1)

HSP 1 Score: 125.946 bits (315), Expect = 7.697e-29
Identity = 236/1044 (22.61%), Postives = 427/1044 (40.90%), Query Frame = 2
Query:  434 YLGATVKAISLSSNEIAIVYCDPL------WHVPDSKEPKPN-GKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPH---------MIPFGGVKIINNPFGKPIISQPRNGLGKYYNFGYSVALT----------------SNSDGYVSSPL--SDQYGPNVTNIREDLQLTSPDNIP------FSSFGVTLTTLSIFKGKRYAVVIGAPFH-----SVKSIQNVGKVYIFCSSNKNR-----SAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI------------------FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLY----------TAKCIYSTDSNLEVQPLYMYDNITITLSL----------SLEDFIKNQYIDIN------FLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMSLQNVKDMNLTI------PVTIGYRFVENCENRKCN----NLLFPLINWEKCTTIIPI-KKYICSNIFICNADIA---AELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANE-----FIAIDIDLYFIDFKDSSKMIYENNFVL-VELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVG---WMSIVPH--AVVGAEKYPCSLPSEFVNPLKIIGFETHESHLKD--IDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPXXXXXXXXXXXXXXXXXXFYKCG 3202
            +LG +V      SN + +  CDP       + V  S++     G+C +   +     T+  I F   S T    C+ GFS  + + +++   I++ +GMP          +  FG + +I+    K   + P +   + YN GY + L                 SN     SSP   S++Y   V  +   L L+    IP       S+FG +L        K   +++GAPF+     S K + ++G +YIF     ++     S  +D L G      FG  +AN+GDI+GD   D A+  P   ND   G V +Y         + P Q+++ +   +  +                  FG ++ G  D+D N  PD+I+    S+ I +  S+ L           T+K I  T  N   +P +  D+    +SL          + E  I   YID++      F K+L+++S          ++  +IT+ +   F +       F+ +     + + L I       ++I Y+   +  N         +L P   ++  ++ I + +   C + + C +DI    ++L        IY  +K   R + + I N+G      +  +IT  + L    +       +    T    A C+  N  ++        ++ ++    F  +K+    I  +   + VE   +  D + +NN   I+Y       + +S  + +   +DSRN S  ++  QRV  + +GP     F I N+G + +  I + IS+P +T     ILY   +I    Q   G    +S +P   ++ G     C LP + ++PL +      E +LK    +K  V+ +   +  +S      N   +A+ +P  K+     E + CN S        C +I C I  L    + +++I A  +A TFF  K+SD  +Y++I  +   I     +     + P +     IF  ++  ++   P+WPI++G ++G ++L ++I+  +KCG
Sbjct:  117 WLGGSVSTTVNGSNGVQLG-CDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGS-----TIRDISFLACSVTDEGACLSGFSSSVSADDSE--KIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLK---TSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDMSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVLKGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDAT-GSVYIYLGGS-----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFG-DSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVS----------SKSSVITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWG-ENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVSPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQAAFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRIS--QQDSSGNPISISQLPQIISIKGTAHGNCRLPEDSIDPLNL---NAIERNLKQNYRNKRSVETIEKVVETKS------NPVKSASIVP--KIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPIVLGALLGLILLTLIILMLWKCG 1118          
BLAST of Alpha-int-4 vs. Planmine SMEST
Match: SMESG000034289.1 (SMESG000034289.1)

HSP 1 Score: 53.9138 bits (128), Expect = 7.809e-7
Identity = 59/201 (29.35%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  941 SSFGVTLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFC------SSNKNRSAPSD-----FLHGKEK--DEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILK-SQKPKNAGI------FGIAITG-GSDMDFNGWPDIIVSSTRSNSIEMYASR---QLYTAKCIYSTDSNL 1471
            S +G ++  + +       +V+GAPF +     N G+V+++       S+ ++++ P D      L   +K  +  +G  L NIGDIN D  QDLA+ +PF  ND   G V +Y  +         +QI+K SQK +   I      +G +I G   D+D N +PD IV S  S  +    +R   ++Y    + +TD  L
Sbjct:  291 SGYGYSVLAMDLNNDGMDELVVGAPFTN----NNNGQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAPF-ENDG-TGAVYIYLGDS--------HQIIKLSQKIEGQMISPDLRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAATDMQL 477          
The following BLAST results are available for this feature:
BLAST of Alpha-int-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA82.189e-1724.62integrin subunit alpha 8 [Source:HGNC Symbol;Acc:H... [more]
ITGAV1.262e-1627.03integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
ITGAV1.421e-1627.03integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
ITGA2B8.923e-1527.75integrin subunit alpha 2b [Source:HGNC Symbol;Acc:... [more]
ITGA2B1.301e-1427.75integrin subunit alpha 2b [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ina-11.942e-1224.13Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot... [more]
pat-21.461e-725.68Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ItgaPS48.995e-1326.53gene:FBgn0034005 transcript:FBtr0087371[more]
scb2.662e-1226.29gene:FBgn0286785 transcript:FBtr0087370[more]
scb2.662e-1226.29gene:FBgn0286785 transcript:FBtr0087369[more]
mew6.331e-1224.13gene:FBgn0004456 transcript:FBtr0330398[more]
mew7.636e-1224.13gene:FBgn0004456 transcript:FBtr0340190[more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga51.048e-1524.87integrin, alpha 5 (fibronectin receptor, alpha pol... [more]
itgav1.127e-1423.11integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616... [more]
itga81.154e-1426.05integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itga81.174e-1424.61integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itga3b1.194e-1431.10integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-05041... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA56.121e-1826.10integrin subunit alpha 5 [Source:NCBI gene;Acc:100... [more]
ITGA52.139e-1724.59integrin subunit alpha 5 [Source:NCBI gene;Acc:100... [more]
ITGA52.310e-1724.59integrin subunit alpha 5 [Source:NCBI gene;Acc:100... [more]
pycr18.565e-1726.92pyrroline-5-carboxylate reductase family, member 1... [more]
rab5b4.889e-1625.66RAB5B, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itgav2.093e-1627.23integrin alpha V [Source:MGI Symbol;Acc:MGI:96608][more]
Itga2b1.029e-1424.71integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601... [more]
Itga86.313e-1424.62integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442... [more]
Itga86.713e-1424.62integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442... [more]
Itga68.609e-1424.78integrin alpha 6 [Source:MGI Symbol;Acc:MGI:96605][more]
back to top
BLAST of Alpha-int-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06274|ITA5_XENLA1.041e-1725.84Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga... [more]
sp|P53708|ITA8_HUMAN1.051e-1624.62Integrin alpha-8 OS=Homo sapiens OX=9606 GN=ITGA8 ... [more]
sp|P06756|ITAV_HUMAN6.826e-1627.03Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV ... [more]
sp|P26009|ITA8_CHICK1.356e-1525.94Integrin alpha-8 OS=Gallus gallus OX=9031 GN=ITGA8... [more]
sp|P43406|ITAV_MOUSE1.464e-1527.23Integrin alpha-V OS=Mus musculus OX=10090 GN=Itgav... [more]
back to top
BLAST of Alpha-int-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8CUU50.000e+099.78Alpha-int-4 (Fragment) OS=Schmidtea mediterranea O... [more]
A0A3R7CGW92.335e-10125.42Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
H2KNX58.964e-10125.37Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A1S8WI911.047e-10025.40Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LBP22.979e-10025.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga2b1.119e-1727.30integrin alpha-IIb [Source:NCBI gene;Acc:103045206... [more]
itga51.677e-1727.04integrin subunit alpha 5 [Source:NCBI gene;Acc:103... [more]
itga84.126e-1624.38integrin subunit alpha 8 [Source:NCBI gene;Acc:103... [more]
itga6l1.375e-1532.09integrin alpha-6-like [Source:NCBI gene;Acc:103033... [more]
ITGA71.180e-1423.65integrin subunit alpha 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga89.135e-1723.30integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
ENSPMAT00000005763.12.904e-1423.31pep scaffold:Pmarinus_7.0:GL478250:6840:43285:-1 g... [more]
ITGA64.694e-1325.21integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
itga81.857e-1225.13integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
ITGA62.353e-1130.06integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-int-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489841.126e-1630.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-int-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGA72.384e-1624.86integrin subunit alpha 7 [Source:NCBI gene;Acc:101... [more]
itga6b8.506e-1532.74integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
itga6b8.683e-1533.33integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
itga6b9.528e-1532.74integrin alpha-6 [Source:NCBI gene;Acc:101167322][more]
itga52.847e-1427.06integrin alpha-5-like [Source:NCBI gene;Acc:101158... [more]
back to top
BLAST of Alpha-int-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018926.10.000e+099.46SMESG000018926.1[more]
SMESG000018926.13.307e-11399.21SMESG000018926.1[more]
SMESG000021746.12.774e-9526.49SMESG000021746.1[more]
SMESG000022733.17.697e-2922.61SMESG000022733.1[more]
SMESG000034289.17.809e-729.35SMESG000034289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034180 ID=SMED30034180|Name=Alpha-int-4|organism=Schmidtea mediterranea sexual|type=transcript|length=3559bp
CTAAATTGCCTGATTTATTTTAAAGAACAATAAACTCTACAGATGCATAT
TTGAAATGGAATTTTTTAAGGATGTTTTCATAATCTTTTATATAAATCTC
ATTTCTGCAAAATGGATTCCCGAATTAAATTTCCATCCAAATTTTGATCA
ATTTCAATACTATGAATCTGATTCATTTCATCAAATCTATTCCGCTTCTG
ATGGAGTTTTCCCAGCAAATTTTGAATGGCAAAGTATTGCTTCTACAACA
TTAAAATCGACCAACTCTTCTTATGTTGTCTTCGGAGGATCAAAGCACAT
AAGTGAAGATTCTACATCAGCATTTTACAGAGAATCATCGACAGTTATCT
TATGTGAATTAAAGCTTAATTCAACTTCTACGATACTTGATAAAGTGATT
TGTTCTCCCTTAAAAGCGGATAATAATAGTCGATATCTTGGTGCTACCGT
TAAAGCCATATCTCTTTCGAGTAATGAAATCGCAATCGTTTATTGTGATC
CATTGTGGCATGTACCGGATTCAAAGGAACCGAAACCAAATGGTAAATGT
TATTTATTACTCAAAAACGATAAACAAGAACAAACTCTTACAAGTATTGA
ATTTTGCAAACTTTCCGCAACATCATATAGCACATGCATGGGAGGATTTT
CTGTCGATCTGATGAGTATGAACAATCAAGTTAACGGAATTGAAATGCTA
GTTGGGATGCCACATATGATACCATTTGGAGGAGTTAAAATTATTAATAA
TCCATTTGGGAAACCAATTATAAGTCAACCACGAAATGGGCTAGGGAAAT
ATTATAATTTTGGATACTCTGTTGCTCTGACTAGTAATTCTGATGGATAT
GTTAGCTCACCATTAAGTGATCAGTATGGGCCAAATGTAACTAATATCAG
AGAGGATTTACAATTAACAAGTCCAGATAATATTCCTTTTAGCTCCTTTG
GAGTTACGTTGACTACTTTATCAATTTTTAAGGGTAAAAGATATGCAGTT
GTGATTGGAGCACCTTTTCATTCGGTAAAGTCAATTCAGAATGTTGGAAA
AGTTTATATTTTCTGTTCTTCAAATAAGAATAGAAGTGCTCCATCAGATT
TTCTTCATGGGAAAGAAAAAGATGAATTTTTTGGATACTTCTTGGCAAAT
ATTGGCGATATAAATGGAGATGGTAATCAGGATTTAGCAATAAGCTCGCC
ATTTTTAAGAAATGATGAAATAAAAGGTTTCGTAGCGCTATATACGATCA
ATGAAAATTGTGAAATGAAGCAGACACCTTATCAAATCTTAAAAAGTCAA
AAACCCAAGAACGCCGGCATATTTGGAATTGCAATCACTGGAGGATCAGA
CATGGATTTCAATGGCTGGCCTGATATAATTGTGTCCAGCACTCGATCCA
ATTCCATTGAAATGTACGCTTCTCGCCAACTGTATACTGCTAAATGTATA
TATTCTACTGACAGCAATTTGGAAGTTCAGCCCCTTTATATGTATGACAA
TATCACTATAACATTATCGCTATCTTTAGAAGACTTTATAAAGAATCAAT
ATATCGACATTAATTTTCTAAAACAATTAAAAGTTTTATCCCAAGTGAAA
ATCAATGACAATTCACAATTAAATCGATTTAAATTAATAACCGAACCAAT
TACGATGGAGTTCGATAGCGCTACCGGAATTTCTGTAACATTTACAATAA
TGTCATTGCAAAATGTTAAGGATATGAATTTAACAATACCGGTCACTATT
GGTTACCGGTTCGTTGAAAATTGTGAAAACCGCAAATGCAACAATTTGCT
ATTTCCTTTAATCAATTGGGAGAAATGCACAACTATAATACCGATTAAGA
AATACATTTGTTCAAATATTTTTATCTGCAATGCCGATATTGCCGCAGAG
TTGGTAGATAGGTTTGGAAATGAAGTGATTTATGGCTTTGATAAAAGTTA
TCATCGAACTTTGGAACTGAAAATTTACAACTATGGACCAACGGAAGGAA
AGGGTATTAATTTCCGAATCACAACATTTGAAAATTTAAGAATCAACAAA
ATCTCCACCACAGAGAGCAATTTTAAGGATTTAATTTCAACCAATCAAAC
GAAGGCAACTTGCAAATTAGAAAATTATGAAATCGATGCCAACGAATTCA
TAGCAATTGACATTGATCTTTATTTCATAGATTTCAAAGACTCCAGTAAA
ATGATATATGAAAATAATTTTGTTCTCGTAGAACTGTTTTCAGATGTAAC
TGATTCTAATCTAACAAATAATGTTGCTAAAATCAACTATATTTTCATTT
ATGAACCAAATATTTCTTTGTCAGCTTCCTCCAAGCAAGACACTGTGATA
GATTCTAGAAATCGATCTCAACCAATGAATTTAGGTCAACGGGTCACCAT
TGACATTATTGGACCTAGATTGTCACAAACTTTTATTATTGATAATATTG
GCAAAGCAGTCATCAATAATATTGTGGTTAGGATCAGTGTTCCACTTCAA
ACAAAAGAAAATTTATACATTCTCTATTTGTTTGATAAAATCAGAGGAGT
TAATCAGTCTCAAGTGGGATGGATGTCCATAGTACCCCACGCGGTAGTTG
GTGCTGAGAAATATCCATGTTCTCTTCCAAGTGAATTTGTGAATCCTTTA
AAAATTATTGGCTTTGAAACTCACGAATCCCACCTCAAAGATATTGATAA
AACTCCAGTAGATGGACTGCTTCATTTCATCAGAAAACGTTCTGCTAACC
AACCTTTTATAAATGCTTCGGCTAATGCAAATAAAATGCCACTGGGAAAA
ATGAACCGAATTCCAATTGAAAGTATAGAATGCAATCGTTCAGGGCAAGC
TTTGAAATTACCAATTTGTGGTGACATAACATGCGCAATTCCCTTTCTGC
CAGCCAATAAACAGGCTCGTATTCAAATTAACGCATGGCTCTATGCACAT
ACATTTTTCAAAAAAAAAATCTCTGACCTCAAGGTCTATTCAACAATATC
TGTGGATTTCACGAATATTCCAAAAGGTGTGAAACTAAGATTCCCAAGTC
CTGTTAGGCCCTATTCGCAATTTCAACAATTCATATTTAATAATCTAAAA
CTTAATATCGTCCACATAAAGCCATTATGGCCAATCATAGTTGGCATTGT
AATCGGCACATTAATACTAGCAATTCTAATCGTGGCATTCTATAAATGCG
GTTTTTTCAAGCGCAATAAACGCCGTCGTCATTTCCGTTCGAAAAAGGTA
AAAAAATATGATCCAATAATAGTGCATCCTGCTGACATTCAAACTGCCTC
TTCAATTACCACTGAAACGAGGTTTACGTCACATTCCGCTTTGATTGATA
GCACGAATTAATTTATTTTAATTAGTTTTTTTTAAATTACTGCGCTTTAT
AAAGTTGTCATATTTGTAATTGAGTTTAGACTGATTTTTGAATTATTCTA
TAAAGTTATTATTTACCAAATGATTCTTTTGAGAACTCTAAATTTATACG
CTTTGTTGTTTTTTGTTTAAATTTTCTGTGTGAGCATACAAGAATTACAT
TATTTTGAC
back to top

protein sequence of SMED30034180-orf-1

>SMED30034180-orf-1 ID=SMED30034180-orf-1|Name=SMED30034180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1102bp
MEFFKDVFIIFYINLISAKWIPELNFHPNFDQFQYYESDSFHQIYSASDG
VFPANFEWQSIASTTLKSTNSSYVVFGGSKHISEDSTSAFYRESSTVILC
ELKLNSTSTILDKVICSPLKADNNSRYLGATVKAISLSSNEIAIVYCDPL
WHVPDSKEPKPNGKCYLLLKNDKQEQTLTSIEFCKLSATSYSTCMGGFSV
DLMSMNNQVNGIEMLVGMPHMIPFGGVKIINNPFGKPIISQPRNGLGKYY
NFGYSVALTSNSDGYVSSPLSDQYGPNVTNIREDLQLTSPDNIPFSSFGV
TLTTLSIFKGKRYAVVIGAPFHSVKSIQNVGKVYIFCSSNKNRSAPSDFL
HGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINE
NCEMKQTPYQILKSQKPKNAGIFGIAITGGSDMDFNGWPDIIVSSTRSNS
IEMYASRQLYTAKCIYSTDSNLEVQPLYMYDNITITLSLSLEDFIKNQYI
DINFLKQLKVLSQVKINDNSQLNRFKLITEPITMEFDSATGISVTFTIMS
LQNVKDMNLTIPVTIGYRFVENCENRKCNNLLFPLINWEKCTTIIPIKKY
ICSNIFICNADIAAELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKG
INFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANEFIA
IDIDLYFIDFKDSSKMIYENNFVLVELFSDVTDSNLTNNVAKINYIFIYE
PNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGK
AVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVGWMSIVPHAVVGA
EKYPCSLPSEFVNPLKIIGFETHESHLKDIDKTPVDGLLHFIRKRSANQP
FINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPA
NKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPV
RPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGF
FKRNKRRRHFRSKKVKKYDPIIVHPADIQTASSITTETRFTSHSALIDST
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028994Integrin_alpha_N
IPR000413Integrin_alpha
IPR013519Int_alpha_beta-p
IPR013649Integrin_alpha-2
IPR018184Integrin_alpha_C_CS
IPR032695Integrin_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0008305integrin complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007229integrin-mediated signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000413Integrin alpha chainPRINTSPR01185INTEGRINAcoord: 1034..1053
score: 53.05
coord: 314..325
score: 32.93
coord: 422..446
score: 30.83
IPR013519Integrin alpha beta-propellorSMARTSM00191int_alpha_rptcoord: 294..351
e-value: 0.53
score: 19.3
coord: 419..471
e-value: 23.0
score: 9.0
coord: 355..409
e-value: 5.8E-6
score: 35.8
IPR013649Integrin alpha-2PFAMPF08441Integrin_alpha2coord: 726..875
e-value: 1.0E-8
score: 34.5
IPR028994Integrin alpha, N-terminalGENE3DG3DSA:2.130.10.130coord: 60..462
e-value: 5.4E-42
score: 146.4
NoneNo IPR availableGENE3DG3DSA:1.20.5.930coord: 1021..1063
e-value: 4.7E-13
score: 50.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.1530coord: 752..1000
e-value: 2.9E-24
score: 87.8
NoneNo IPR availablePANTHERPTHR23220INTEGRIN ALPHAcoord: 93..1061
NoneNo IPR availableSUPERFAMILYSSF69318Integrin alpha N-terminal domaincoord: 124..456
NoneNo IPR availableTMHMMTMhelixcoord: 1024..1046
IPR018184Integrin alpha chain, C-terminal cytoplasmic region, conserved sitePROSITEPS00242INTEGRIN_ALPHAcoord: 1046..1053
IPR032695Integrin domain superfamilySUPERFAMILYSSF69179Integrin domainscoord: 777..995