Methyltransferase-like protein 9

Overview
NameMethyltransferase-like protein 9
Smed IDSMED30034175
Length (bp)1056
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltransferase-like protein 9 (SMED30034175) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltransferase-like protein 9 (SMED30034175) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltransferase-like protein 9 (SMED30034175) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltransferase-like protein 9 (SMED30034175) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034175

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30034175h1SMcG0020628 dd_Smed_v4_3850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034175h1SMcG0020628 dd_Smed_v4_3850_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Match: METTL9 (methyltransferase like 9 [Source:HGNC Symbol;Acc:HGNC:24586])

HSP 1 Score: 233.032 bits (593), Expect = 1.761e-74
Identity = 125/308 (40.58%), Postives = 177/308 (57.47%), Query Frame = 3
Query:   99 YHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            + LRSPL ++L+ K  HQ          WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:    2 WTLRSPLTRSLYVKENHQ----------WYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 282          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Match: METTL9 (methyltransferase like 9 [Source:HGNC Symbol;Acc:HGNC:24586])

HSP 1 Score: 233.032 bits (593), Expect = 1.761e-74
Identity = 125/308 (40.58%), Postives = 177/308 (57.47%), Query Frame = 3
Query:   99 YHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            + LRSPL ++L+ K  HQ          WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:    2 WTLRSPLTRSLYVKENHQ----------WYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 282          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Match: METTL9 (methyltransferase like 9 [Source:HGNC Symbol;Acc:HGNC:24586])

HSP 1 Score: 233.032 bits (593), Expect = 1.761e-74
Identity = 125/308 (40.58%), Postives = 177/308 (57.47%), Query Frame = 3
Query:   99 YHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            + LRSPL ++L+ K  HQ          WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:    2 WTLRSPLTRSLYVKENHQ----------WYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 282          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Match: METTL9 (methyltransferase like 9 [Source:HGNC Symbol;Acc:HGNC:24586])

HSP 1 Score: 227.254 bits (578), Expect = 1.068e-71
Identity = 122/321 (38.01%), Postives = 180/321 (56.07%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHS------NASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL ++L+  +                + +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:   15 VWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 318          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Match: METTL9 (methyltransferase like 9 [Source:HGNC Symbol;Acc:HGNC:24586])

HSP 1 Score: 226.483 bits (576), Expect = 1.702e-71
Identity = 122/321 (38.01%), Postives = 179/321 (55.76%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHS------NASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL ++L+  +                + +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+                      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:   15 VWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN----------------GGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 317          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Celegans
Match: T03G11.6 (pep chromosome:WBcel235:X:5177519:5179210:-1 gene:WBGene00020199.1 transcript:T03G11.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T03G11.6)

HSP 1 Score: 160.614 bits (405), Expect = 2.081e-46
Identity = 96/284 (33.80%), Postives = 148/284 (52.11%), Query Frame = 3
Query:  180 EWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEM---KLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             WY     L S+V    F     D ET+QF+++    +  FF Q    L   IL+   S T  NG+   G+MF+ S +Q  + L +++E      +++LDLGAG+G+IT   +PFF  + ATE+S+ M+ RL  K   +L    W +    FD+++  NLLDR   P  LL+D+    R S+  +++++V PV  YV            EF P  +     P   + +A  R +     H + +V +PA + ++RWTRLPYLCEGD + S Y L D + +LK +
Sbjct:   15 HWYQPETSL-SDVAQNLFAASLPDGETQQFLDNSNKIASNFFWQTVRNLGVMILSTIYSKTDINGMTGFGNMFLFSENQFAKFLAIEKESWNSTDKKVLDLGAGNGDITEHMRPFFEHVYATELSSKMRNRLSWKGYNVLSALEWAETDVKFDLVTAFNLLDRHYSPGKLLNDLWNVARRSNCNVIVSLVLPVSHYV------------EFNP--NGRSTRPDNYLNVA-GRTYADHVHHMIVNVFKPANFEVLRWTRLPYLCEGDMNNSAYYLPDAIFLLKPI 282          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Fly
Match: CG5339 (gene:FBgn0034925 transcript:FBtr0072220)

HSP 1 Score: 145.206 bits (365), Expect = 1.598e-40
Identity = 105/318 (33.02%), Postives = 161/318 (50.63%), Query Frame = 3
Query:   99 YHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLL-----ELDEEMKLERLLDLGAGDGNITTKFQPFFHQL--------LATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVL 1013
            Y  R  LA+ +  K  + N   +    +WY    +L     S KF+ +  D  T  ++E     S   +T ++H LA+SIL +F++ T  NG L RGSMF+LS  Q R+LL     +     +   LLD+GAGDG I+ +      +L         ATE S  M+ RL++ +    +V T  D     ++I CLN+LDRC     LL DI   L P +G  ++A+V P   YVE+  +   +      P+L+N+    +          +E +   F+ +++E  GYR+  WT+ PYLCEGD  QSFY L D+++V+
Sbjct:    4 YRPRGTLARVIHAKFHNDNSLEDIDTRKWYCLNHELPPRFQS-KFVPLEPDATTVSWLERTKALSANIWTHLWHALARSILQFFMTQTDINGFLKRGSMFILSEEQFRKLLVAGGFQPASGQEPVTLLDIGAGDGEISLRVANTVSELSGSAGLRVFATEASWTMRDRLKKLN---FNVITEIDGLQNLELILCLNVLDRCFDSFKLLEDIHLALAP-NGRAVVALVLPYMHYVETNTSHLPL-----RPLLENNGRQAS----------FEEEAARFM-ELLENCGYRVEAWTKAPYLCEGDLHQSFYWLIDLIVVI 300          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Zebrafish
Match: mettl9 (methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE-061013-752])

HSP 1 Score: 241.891 bits (616), Expect = 1.503e-77
Identity = 138/333 (41.44%), Postives = 186/333 (55.86%), Query Frame = 3
Query:   51 RLIVFAFLIAF-------IGKM--GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            R +VF F + F       I KM  G ++RSPLA++LF  +    E ++    +WY     LL   VS  F++ + D+ET+ F++    KS W FTQ+YH L  SI +  IS TS NG L RGSMFV S  Q RRLL +  + + +R+LDLGAGDG +T      FH++ ATE+ST M+W L++K+  LL +  W      +D+ISCLNLLDRCD PL LL DI+  L P +G L+LA V P + YVE+                  S   P + + +   + WE Q  H    V    G  L   TRLPYLCEGD  + +YVL+D V +LK L
Sbjct:    2 RRLVFVFWLLFYVWFLLSIRKMWTGRYVRSPLARSLFMNMLSDTETADYGDQKWYRCCPDLLGESVSSVFVQSHLDEETQAFLQRSVEKSSWIFTQLYHSLFSSIFSPIISRTSINGFLGRGSMFVFSRDQFRRLLRIGPDWRAQRMLDLGAGDGGVTEVMGSHFHEVYATEVSTPMKWHLQRKNYSLLGIDEWQCTGLQYDLISCLNLLDRCDEPLKLLQDIRSALVPETGRLILAAVLPFQPYVET----------------GGSWVRPKQHIQVQ-GKSWEEQVTHLSTQVFPQVGLELQAVTRLPYLCEGDMYRDYYVLDDAVFILKPL 317          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Zebrafish
Match: mettl9 (methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE-061013-752])

HSP 1 Score: 205.297 bits (521), Expect = 3.770e-64
Identity = 103/224 (45.98%), Postives = 141/224 (62.95%), Query Frame = 3
Query:   96 GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVES 767
            G ++RSPLA++LF  +    E ++    +WY     LL   VS  F++ + D+ET+ F++    KS W FTQ+YH L  SI +  IS TS NG L RGSMFV S  Q RRLL +  + + +R+LDLGAGDG +T      FH++ ATE+ST M+W L++K+  LL +  W      +D+ISCLNLLDRCD PL LL DI+  L P +G L+LA V P + YVE+
Sbjct:    4 GRYVRSPLARSLFMNMLSDTETADYGDQKWYRCCPDLLGESVSSVFVQSHLDEETQAFLQRSVEKSSWIFTQLYHSLFSSIFSPIISRTSINGFLGRGSMFVFSRDQFRRLLRIGPDWRAQRMLDLGAGDGGVTEVMGSHFHEVYATEVSTPMKWHLQRKNYSLLGIDEWQCTGLQYDLISCLNLLDRCDEPLKLLQDIRSALVPETGRLILAAVLPFQPYVET 227          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Zebrafish
Match: mettl9 (methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE-061013-752])

HSP 1 Score: 148.288 bits (373), Expect = 2.209e-42
Identity = 82/199 (41.21%), Postives = 116/199 (58.29%), Query Frame = 3
Query:   51 RLIVFAFLIAF-------IGKM--GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPG 620
            R +VF F + F       I KM  G ++RSPLA++LF  +    E ++    +WY     LL   VS  F++ + D+ET+ F++    KS W FTQ+YH L  SI +  IS TS NG L RGSMFV S  Q RRLL +  + + +R+LDLGAGDG +T      FH++ ATE+ST M+W L++K+   +  S    +PG
Sbjct:    2 RRLVFVFWLLFYVWFLLSIRKMWTGRYVRSPLARSLFMNMLSDTETADYGDQKWYRCCPDLLGESVSSVFVQSHLDEETQAFLQRSVEKSSWIFTQLYHSLFSSIFSPIISRTSINGFLGRGSMFVFSRDQFRRLLRIGPDWRAQRMLDLGAGDGGVTEVMGSHFHEVYATEVSTPMKWHLQRKNYRRVVGSAEAAHPG 200          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Xenopus
Match: mettl9 (methyltransferase like 9 [Source:NCBI gene;Acc:493282])

HSP 1 Score: 232.261 bits (591), Expect = 9.695e-74
Identity = 132/331 (39.88%), Postives = 187/331 (56.50%), Query Frame = 3
Query:   48 CRLIVFAFLIAFIGKM--GYHLRSPLAKALFEKIQHQNEHSNA----SHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            C +I +   +A + KM  G +LRS L+++L+  +     HS A     + +WY    + LS+ +   F++ Y D  T+ F+     KS W   Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL++D E K  RLLDLGAGDG +T    P F ++  TEMS  M W+L++K   +L++  W      +DVISCLNLLDRC +P+TLL +++  L P+ G ++LA+V P   YVE+                      P+EVM +  T VWE Q +  L DV   AG+ +   TRLPYLCEGD    +YVL+D V VL+ +
Sbjct:    6 CWIISYLLCLAGLRKMWSGRYLRSHLSRSLYMNMM---SHSQAPYWDGNQQWYFCDTEKLSDCLRPVFIQSYLDHGTQTFLNRSIEKSGWLSIQLYHSFMSSVFSMFMSRTSINGLLGRGSMFVFSPEQFQRLLKIDPEWKSHRLLDLGAGDGEVTKVMSPHFEEIYVTEMSQTMIWQLQKKKYRVLNIDEWQSTGFQYDVISCLNLLDRCHQPVTLLKEMRSVLEPTRGRVILALVLPFHPYVEN----------------GGKWEKPSEVMEVTGT-VWEEQVNS-LADVFHVAGFAVEAVTRLPYLCEGDMYNDYYVLDDAVFVLRPI 315          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Mouse
Match: Mettl9 (methyltransferase like 9 [Source:MGI Symbol;Acc:MGI:1914862])

HSP 1 Score: 225.328 bits (573), Expect = 4.210e-71
Identity = 123/321 (38.32%), Postives = 182/321 (56.70%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHSNASHG------EWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL+++L+  +        A+ G      +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL ++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VL+ +
Sbjct:   15 VWLARRMWTLRSPLSRSLYVNMTSGPGGPAAAAGGGKDTHQWYVCNREKLCESLQSVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVVEAFTRLPYLCEGDMYNDYYVLDDAVFVLRPV 318          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Mouse
Match: Mettl9 (methyltransferase like 9 [Source:MGI Symbol;Acc:MGI:1914862])

HSP 1 Score: 149.058 bits (375), Expect = 1.731e-43
Identity = 72/139 (51.80%), Postives = 96/139 (69.06%), Query Frame = 3
Query:  351 ISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVES 767
            +S TS NGLL RGSMFV S  Q +RLL ++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+
Sbjct:    1 MSRTSINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGRVILALVLPFHPYVEN 139          
BLAST of Methyltransferase-like protein 9 vs. UniProt/SwissProt
Match: sp|Q5ZMH6|METL9_CHICK (Methyltransferase-like protein 9 OS=Gallus gallus OX=9031 GN=METTL9 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 4.364e-74
Identity = 126/310 (40.65%), Postives = 179/310 (57.74%), Query Frame = 3
Query:  102 HLRSPLAKALFEKIQHQNEHSNASHGE---WYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            +LRSPL+++L+  +   +       GE   WY    + LS  +   F++ Y D  T+ F+ +   KS W F Q+YH    SI + F+S TS NGLL RGSMFV S  Q +RLL+++ E K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLT+L D +  L P+ G ++LA+V P   YVE+               +      P+EV+ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:   29 YLRSPLSRSLYANMMGSHGPPAPGAGENHQWYVCNTEQLSESLQPIFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSIFSLFMSRTSINGLLGRGSMFVFSPEQFQRLLKINPEWKSHRLLDLGAGDGEVTKVMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTVLKDTRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEVLEIK-GHTWEEQVNS-LPEVFGKAGFAIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 321          
BLAST of Methyltransferase-like protein 9 vs. UniProt/SwissProt
Match: sp|Q9H1A3|METL9_HUMAN (Methyltransferase-like protein 9 OS=Homo sapiens OX=9606 GN=METTL9 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 5.128e-71
Identity = 122/321 (38.01%), Postives = 180/321 (56.07%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHS------NASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL ++L+  +                + +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:   15 VWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 318          
BLAST of Methyltransferase-like protein 9 vs. UniProt/SwissProt
Match: sp|Q0VCJ8|METL9_BOVIN (Methyltransferase-like protein 9 OS=Bos taurus OX=9913 GN=METTL9 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.541e-70
Identity = 122/321 (38.01%), Postives = 179/321 (55.76%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHS------NASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL ++L+  +                + +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL+++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W      +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VLK +
Sbjct:   15 VWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQKTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVEN---------------VGGKWDKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV 318          
BLAST of Methyltransferase-like protein 9 vs. UniProt/SwissProt
Match: sp|Q9EPL4|METL9_MOUSE (Methyltransferase-like protein 9 OS=Mus musculus OX=10090 GN=Mettl9 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.945e-70
Identity = 123/321 (38.32%), Postives = 182/321 (56.70%), Query Frame = 3
Query:   78 AFIGKMGYHLRSPLAKALFEKIQHQNEHSNASHG------EWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
             ++ +  + LRSPL+++L+  +        A+ G      +WY    + L   +   F++ Y D  T+ F+ +   KS W F Q+YH    S+ + F+S TS NGLL RGSMFV S  Q +RLL ++ + K  RLLDLGAGDG +T    P F ++ ATE+S  M W+L++K   +L ++ W +    +DVISCLNLLDRCD+PLTLL DI+  L P+ G ++LA+V P   YVE+               +      P+E++ +     WE Q +  L +V   AG+ +  +TRLPYLCEGD    +YVL+D V VL+ +
Sbjct:   15 VWLARRMWTLRSPLSRSLYVNMTSGPGGPAAAAGGGKDTHQWYVCNREKLCESLQSVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGRVILALVLPFHPYVEN---------------VGGKWEKPSEILEIKGQN-WEEQVNS-LPEVFRKAGFVVEAFTRLPYLCEGDMYNDYYVLDDAVFVLRPV 318          
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Match: A0A068WGV8 (Methyltransferase9 OS=Echinococcus granulosus OX=6210 GN=EgrG_000461000 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 2.059e-110
Identity = 158/330 (47.88%), Postives = 217/330 (65.76%), Query Frame = 3
Query:   51 RLIVFAFLIAFIGKMGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPG--------YFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLK 1016
            R       +A I  M   L SP+A+ L+EK +H  EH  ++H  WY  R  LLS    ++F+  +QD+ET QF++ CF +SDWFFTQ+YH +++SILT F++ TS NGLLNRGSMFV SS+  R LL+ DE  K  +LLDLGAGDG +T +  P F ++  TE+S  M+WRLRQ +  +L+V  W   P          +DV++CLNLLDRC  PLTLL  ++  L P++G L+LA+VFP+ QYVE+                  + + P E+M ++ +R WEVQFD FL +V++PAG+ L+RWTR+PYLCEGDFS+SFY LNDVVM++K
Sbjct:   13 RFFALPIFVAVISGMAIKLHSPIARLLYEKFEHTQEHLESTHEYWYTVRSNLLSKYAMDRFVRAHQDEETTQFLKSCFDRSDWFFTQLYHTISRSILTCFMTLTSCNGLLNRGSMFVFSSTLFRYLLDADENWKAPKLLDLGAGDGRVTMRMAPMFDEVYVTEISPVMRWRLRQANFTVLEVEEWDKAPAEAGATTARQYDVVACLNLLDRCASPLTLLRRMRAVLTPTTGRLVLALVFPLTQYVET-----------------TAKNEPLEMMEVSKSRAWEVQFDSFLTNVLQPAGFDLIRWTRVPYLCEGDFSRSFYSLNDVVMIVK 325          
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Match: W6UH69 (Methyltransferase-like protein 9 OS=Echinococcus granulosus OX=6210 GN=EGR_04768 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 2.871e-110
Identity = 158/330 (47.88%), Postives = 217/330 (65.76%), Query Frame = 3
Query:   51 RLIVFAFLIAFIGKMGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPG--------YFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLK 1016
            R       +A I  M   L SP+A+ L+EK +H  EH  ++H  WY  R  LLS    ++F+  +QD+ET QF++ CF +SDWFFTQ+YH +++SILT F++ TS NGLLNRGSMFV SS+  R LL+ DE  K  +LLDLGAGDG +T +  P F ++  TE+S  M+WRLRQ +  +L+V  W   P          +DV++CLNLLDRC  PLTLL  ++  L P++G L+LA+VFP+ QYVE+                  + + P E+M ++ +R WEVQFD FL +V++PAG+ L+RWTR+PYLCEGDFS+SFY LNDVVM++K
Sbjct:   23 RFFALPIFVAVISGMAIKLHSPIARLLYEKFEHTQEHLESTHEYWYTVRSNLLSKYAMDRFVRAHQDEETTQFLKSCFDRSDWFFTQLYHTISRSILTCFMTLTSCNGLLNRGSMFVFSSTLFRYLLDADENWKAPKLLDLGAGDGRVTMRMAPMFDEVYVTEISPVMRWRLRQANFTVLEVEEWDKAPAEAGATTARQYDVVACLNLLDRCASPLTLLRRMRAVLTPTTGRLVLALVFPLTQYVET-----------------TAKNEPLEMMEVSKSRAWEVQFDSFLTNVLQPAGFDLIRWTRVPYLCEGDFSRSFYSLNDVVMIVK 335          
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Match: A0A068Y522 (Methyltransferase9 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000461000 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 4.301e-110
Identity = 158/330 (47.88%), Postives = 218/330 (66.06%), Query Frame = 3
Query:   51 RLIVFAFLIAFIGKMGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPG--------YFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLK 1016
            R    +  +A I  M   L SP+A+ L+EK +H  +H  ++H  WY  R  LLS    ++F+  +QD+ET QF++ CF KSDWFFTQ+YH +++SILT F++ TS NGLLNRGSMFV SS+  R LL+ DE  K  +LLDLGAGDG +T +  P F ++  TE+S  M+WRLRQ +  +L+V  W   P          +DV++CLNLLDRC  PLTLL  ++  L P++G L+LA+VFP+ QYVE+                  + + P E+M ++ +R WEVQFD FL +V++PAG+ L+RWTR+PYLCEGDFS+SFY LNDVVM++K
Sbjct:   13 RFFALSIFVAVISGMAIKLHSPIAQLLYEKFEHTQDHLESTHEYWYTVRSNLLSKYAMDRFVRAHQDEETTQFLKSCFDKSDWFFTQLYHTISRSILTCFMTLTSCNGLLNRGSMFVFSSALFRYLLDADENWKAPKLLDLGAGDGRVTMRMAPMFDEVYVTEISPVMRWRLRQANFTVLEVEEWDKAPAEVGATTARQYDVVACLNLLDRCASPLTLLRRMRAVLTPTTGRLVLALVFPLTQYVET-----------------TAKNEPLEMMEVSKSRAWEVQFDSFLTNVLQPAGFDLIRWTRVPYLCEGDFSRSFYSLNDVVMIVK 325          
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Match: A0A183SQC8 (Methyltransferase-like protein 9 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS6426 PE=4 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 7.161e-110
Identity = 161/321 (50.16%), Postives = 215/321 (66.98%), Query Frame = 3
Query:   93 MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTW-------------PDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLK 1016
            M   LRSPLA+ ++EK +H  EH ++ H  WY  R + LS  + + F++  QD+ET  F++ C+ KSDWFFTQ+YH ++KSILTWF++ TSANGLLNRGSMFV+S+SQ RRLL +++    +RLLDLGAGDG +T K  P F ++  TEMS  M+WRL Q +  +LDV  W             P  P Y DVISCLNLLDRC  PLTLL  I++ L+P SG+L+LA+VFP++QYVE                     H P E+M ++ +RVWEVQF  F+ +V+ P+GY L+ W+R+PY+CEGD ++SFY LNDVVM LK
Sbjct:    1 MAVKLRSPLARMIYEKFEHAQEHMHSHHEYWYNIRNEYLSTELLKIFVQSEQDEETTDFLQTCYEKSDWFFTQLYHSISKSILTWFMTVTSANGLLNRGSMFVISTSQFRRLLGVNDHWHAKRLLDLGAGDGKVTAKMAPLFDEVYTTEMSPVMRWRLNQANFTVLDVDKWDQPPEACDTLTAIPAQPQY-DVISCLNLLDRCSTPLTLLRRIRKVLKPGSGLLVLALVFPLKQYVE-------------------YGHKPIELMEVSASRVWEVQFSSFVTNVLHPSGYELLAWSRVPYICEGDLARSFYSLNDVVMTLK 301          
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Match: A0A0X3PSH1 (Methyltransferase-like protein 9 OS=Schistocephalus solidus OX=70667 GN=METL9 PE=4 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 2.292e-109
Identity = 163/321 (50.78%), Postives = 217/321 (67.60%), Query Frame = 3
Query:   93 MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTW-------------PDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLK 1016
            M   LRSPLA+ ++EK +H  EH ++ H  WY  R + LS  + + F++  QD+ET  F++ C+ KSDWFFTQ+YH ++KSILTWF++ TSANGLLNRGSMFV+S+SQ RRLL +++    +RLLDLGAGDG +T K  P F ++  TEMS  M+WRL Q +  +LDV  W             P  P Y DVISCLNLLDRC  PLTLL  I++ L+P SG+L+LA+VFP++QYVE        FV           H P E+M ++ +RVWEVQF  F+ +V+ P+GY L+ W+R+PY+CEGD ++SFY LNDVVM LK
Sbjct:   25 MAVKLRSPLARMIYEKFEHAQEHMHSHHEYWYNIRNEYLSTELLKIFVQSEQDEETTDFLQTCYEKSDWFFTQLYHSISKSILTWFMTVTSANGLLNRGSMFVISTSQFRRLLGVNDHWHAKRLLDLGAGDGKVTAKMAPLFDEVYTTEMSPVMRWRLNQANFTVLDVDKWDQPPEACDTLTAIPAQPQY-DVISCLNLLDRCCTPLTLLRRIRKVLKPGSGLLVLALVFPLKQYVE--------FV---------DGHKPIELMEVSASRVWEVQFSSFVTNVLHPSGYELLAWSRVPYICEGDLARSFYSLNDVVMTLK 327          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Cavefish
Match: mettl9 (methyltransferase like 9 [Source:NCBI gene;Acc:103025642])

HSP 1 Score: 236.498 bits (602), Expect = 1.582e-75
Identity = 132/324 (40.74%), Postives = 185/324 (57.10%), Query Frame = 3
Query:   54 LIVFAFLIAFIGKM--GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKA 1019
            ++  A L+A   +M  G ++RSPLA+A    +    E +     EWY     +L   +   F++   D +T+ F+E+   KS W FTQ+YH    +I +  IS TS NG L RGSMFV S  Q R LL++D + K ERLLDLGAGDG IT      F ++ ATE+S  M+W+L++K+ ++L +  W      +D+ISCLNLLDRCD PL LL DIK+ L P SG ++LAVV P   YVE    +   +V             P E + +   + WE Q  +   +V +  G+ +   TRLPYLCEGD +Q +YVL+D V VL+A
Sbjct:   11 VLYVAVLLAARRRMWSGKYVRSPLARAAIMNMVTDTEFTGPDFQEWYRCCPDMLGEKIRPLFVQSNLDTDTQTFLENSVEKSGWLFTQLYHSFFSTIFSPIISRTSINGFLGRGSMFVFSLDQFRNLLQIDSDWKGERLLDLGAGDGGITEVMGSHFREVYATEVSPPMKWQLQRKNYKVLAIDEWQKTGFQYDLISCLNLLDRCDDPLELLGDIKKALVPGSGRMILAVVLPFHPYVE----IGGRWV------------RPKEQLHVK-GKTWEEQVTNLSEEVFQKIGFEVEAVTRLPYLCEGDMNQDYYVLDDAVFVLRA 317          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Cavefish
Match: mettl9 (methyltransferase like 9 [Source:NCBI gene;Acc:103025642])

HSP 1 Score: 236.498 bits (602), Expect = 1.582e-75
Identity = 132/324 (40.74%), Postives = 185/324 (57.10%), Query Frame = 3
Query:   54 LIVFAFLIAFIGKM--GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKA 1019
            ++  A L+A   +M  G ++RSPLA+A    +    E +     EWY     +L   +   F++   D +T+ F+E+   KS W FTQ+YH    +I +  IS TS NG L RGSMFV S  Q R LL++D + K ERLLDLGAGDG IT      F ++ ATE+S  M+W+L++K+ ++L +  W      +D+ISCLNLLDRCD PL LL DIK+ L P SG ++LAVV P   YVE    +   +V             P E + +   + WE Q  +   +V +  G+ +   TRLPYLCEGD +Q +YVL+D V VL+A
Sbjct:   11 VLYVAVLLAARRRMWSGKYVRSPLARAAIMNMVTDTEFTGPDFQEWYRCCPDMLGEKIRPLFVQSNLDTDTQTFLENSVEKSGWLFTQLYHSFFSTIFSPIISRTSINGFLGRGSMFVFSLDQFRNLLQIDSDWKGERLLDLGAGDGGITEVMGSHFREVYATEVSPPMKWQLQRKNYKVLAIDEWQKTGFQYDLISCLNLLDRCDDPLELLGDIKKALVPGSGRMILAVVLPFHPYVE----IGGRWV------------RPKEQLHVK-GKTWEEQVTNLSEEVFQKIGFEVEAVTRLPYLCEGDMNQDYYVLDDAVFVLRA 317          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Sea Lamprey
Match: mettl9 (methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE-061013-752])

HSP 1 Score: 199.134 bits (505), Expect = 1.071e-61
Identity = 121/315 (38.41%), Postives = 169/315 (53.65%), Query Frame = 3
Query:   96 GYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVS--EKFMEMYQDDETKQFIEDCFTKSD-WFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWP---DYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            G +LR PL ++L+     +   +     E  A        ++   +   E++Q       IE    K D WF T + H L       +      N +L RGSMFVLS+ Q RRLL + +  + + LLDLGAGDG +T      F Q+  TE+S  MQWRLR++D  +L V+ W    D P  +D++SCLNLLDRC+RPLTLL ++++ LRP SG LLLAVV P R YVE                       P+E +P+     WE Q +  + DV+EP G+++  +TR+PYLCEGD     YVL+D V+VLK +
Sbjct:   28 GRYLRKPLTRSLYMSAMGRVGLTGTHEDEEMAGTRSKHGEILQIFKVICELFQLCVISNAIE---RKGDRWFITIMAHLLPPQQRCPWSGGKGLNPVLGRGSMFVLSAEQFRRLLGIPDSWRADSLLDLGAGDGEVTAIMGAHFKQVFVTEVSPTMQWRLRKRDFTVLGVTEWNIVYDRP--YDLVSCLNLLDRCERPLTLLREVRQVLRPGSGRLLLAVVLPYRPYVER----------------GGRWEQPSECVPVHGDS-WEEQLNSLVIDVLEPNGFQVESFTRVPYLCEGDLYNDHYVLDDAVLVLKPV 320          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Nematostella
Match: EDO37060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS8])

HSP 1 Score: 227.639 bits (579), Expect = 4.681e-73
Identity = 118/281 (41.99%), Postives = 165/281 (58.72%), Query Frame = 3
Query:  180 EWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            +WY   +  L   +  KF++   DD  ++F+++C+ K+D FFTQ    + K I   F+S T+ NG+LNRGSM + S+ Q R LL +D++ K  +LLDLGAGDG +T    P F ++  TE S +M+WRL  K   +LD+  W      +DVI CLNLLDRC +P TLL+ +K  L+P +G +++AVV P                  F P +DN   SPTE++ +     WE Q    + DV  PAGY + R+TRLPYLCEGD   SFY L+D V VLK +
Sbjct:   16 QWYECNVSDLPFELQTKFLQEGLDDGGRKFLQNCYDKTDAFFTQFGQMVFKGIFNLFMSVTTINGILNRGSMHIFSAQQFRSLLGVDDKWKANKLLDLGAGDGKVTEVMAPHFKEVYVTEQSVSMRWRLGWKGYTVLDIDDWSSAKESYDVIGCLNLLDRCAKPRTLLAGMKHALKPETGRVIIAVVLP------------------FNPCVDNV-ISPTELITVV-GETWEEQVISLVEDVFTPAGYEVERFTRLPYLCEGDLYDSFYSLSDTVFVLKPV 276          
BLAST of Methyltransferase-like protein 9 vs. Ensembl Medaka
Match: mettl9 (methyltransferase like 9 [Source:NCBI gene;Acc:101167494])

HSP 1 Score: 221.476 bits (563), Expect = 1.792e-69
Identity = 127/321 (39.56%), Postives = 180/321 (56.07%), Query Frame = 3
Query:   66 AFLIAFIGKM--GYHLRSPLAKALFEKIQHQNEHSNASHG-EWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKA 1019
            AFL++ I +M    H RSPL ++L   + +++E S A    EWY     LL   V   F++ + D +T  F+     KS W FTQ+YH L  ++L+  +S TS NG+L RGSMFV SS Q ++LL +  +   ERLLDLGAGDG +T      F Q+ ATE+S  M+W L++++ ++L +  W      +D+ISCLNLLDRC+ PL LL +I++ L P +G L+LA V P + YVE                +      P E + +   + WE Q      +V    G+ +   TRLPYLCEGD    +YVL+D V VLKA
Sbjct:   20 AFLLS-IRRMWTAKHARSPLVRSLVLNMVNEHEASGARETHEWYRCCPDLLGESVRPLFIQSHLDSDTTDFLNRSAEKSGWLFTQLYHSLVSTVLSPVLSRTSINGVLGRGSMFVFSSEQFQQLLRIGPDWTAERLLDLGAGDGGVTEVMGVHFRQVFATEVSVPMKWHLQRRNYKVLGIDEWQHVGFQYDLISCLNLLDRCEDPLHLLREIRKALVPKTGRLVLAAVLPFQPYVE----------------VGGKWERPKEHLKVK-GKTWEEQVTDLSSEVFPRVGFEVEAVTRLPYLCEGDMYNDYYVLDDAVFVLKA 322          
BLAST of Methyltransferase-like protein 9 vs. Planmine SMEST
Match: SMESG000019782.1 (SMESG000019782.1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 292/310 (94.19%), Postives = 293/310 (94.52%), Query Frame = 3
Query:   93 MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 1022
            MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVE                 +NSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL
Sbjct:    1 MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEMYQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGSMFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEMSTAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDIKRRLRPSSGILLLAVVFPVRQYVE-----------------NNSDHSPTEVMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVLNDVVMVLKAL 293          
The following BLAST results are available for this feature:
BLAST of Methyltransferase-like protein 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
METTL91.761e-7440.58methyltransferase like 9 [Source:HGNC Symbol;Acc:H... [more]
METTL91.761e-7440.58methyltransferase like 9 [Source:HGNC Symbol;Acc:H... [more]
METTL91.761e-7440.58methyltransferase like 9 [Source:HGNC Symbol;Acc:H... [more]
METTL91.068e-7138.01methyltransferase like 9 [Source:HGNC Symbol;Acc:H... [more]
METTL91.702e-7138.01methyltransferase like 9 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T03G11.62.081e-4633.80pep chromosome:WBcel235:X:5177519:5179210:-1 gene:... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG53391.598e-4033.02gene:FBgn0034925 transcript:FBtr0072220[more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mettl91.503e-7741.44methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
mettl93.770e-6445.98methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
mettl92.209e-4241.21methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl99.695e-7439.88methyltransferase like 9 [Source:NCBI gene;Acc:493... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mettl94.210e-7138.32methyltransferase like 9 [Source:MGI Symbol;Acc:MG... [more]
Mettl91.731e-4351.80methyltransferase like 9 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q5ZMH6|METL9_CHICK4.364e-7440.65Methyltransferase-like protein 9 OS=Gallus gallus ... [more]
sp|Q9H1A3|METL9_HUMAN5.128e-7138.01Methyltransferase-like protein 9 OS=Homo sapiens O... [more]
sp|Q0VCJ8|METL9_BOVIN1.541e-7038.01Methyltransferase-like protein 9 OS=Bos taurus OX=... [more]
sp|Q9EPL4|METL9_MOUSE2.945e-7038.32Methyltransferase-like protein 9 OS=Mus musculus O... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WGV82.059e-11047.88Methyltransferase9 OS=Echinococcus granulosus OX=6... [more]
W6UH692.871e-11047.88Methyltransferase-like protein 9 OS=Echinococcus g... [more]
A0A068Y5224.301e-11047.88Methyltransferase9 OS=Echinococcus multilocularis ... [more]
A0A183SQC87.161e-11050.16Methyltransferase-like protein 9 OS=Schistocephalu... [more]
A0A0X3PSH12.292e-10950.78Methyltransferase-like protein 9 OS=Schistocephalu... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mettl91.582e-7540.74methyltransferase like 9 [Source:NCBI gene;Acc:103... [more]
mettl91.582e-7540.74methyltransferase like 9 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl91.071e-6138.41methyltransferase like 9 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO370604.681e-7341.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl91.792e-6939.56methyltransferase like 9 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Methyltransferase-like protein 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000019782.10.000e+094.19SMESG000019782.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034175 ID=SMED30034175|Name=Methyltransferase-like protein 9|organism=Schmidtea mediterranea sexual|type=transcript|length=1056bp
ATATTTTATTTTTAATTAATTAATTATTAAATTAATAATATTAAAATTGT
AGGCTTATAGTATTTGCTTTCTTAATTGCTTTTATAGGCAAAATGGGTTA
TCATTTAAGAAGTCCGTTAGCAAAAGCCTTATTTGAAAAAATACAACATC
AGAACGAGCATTCAAACGCATCACACGGAGAATGGTATGCAGCAAGACTA
AAATTGCTATCAAATGTCGTTTCAGAAAAGTTTATGGAAATGTATCAAGA
CGATGAAACCAAACAATTTATTGAGGATTGTTTTACAAAATCAGATTGGT
TTTTCACCCAGATTTATCATGGATTAGCAAAATCTATTTTAACATGGTTC
ATTTCCGCTACATCAGCAAACGGATTGCTTAATCGGGGATCGATGTTCGT
TTTGTCGAGTTCTCAAATCAGGCGATTGCTGGAATTGGACGAGGAGATGA
AATTGGAGCGGCTGCTGGATTTGGGAGCTGGAGATGGGAATATCACAACT
AAGTTTCAGCCGTTTTTCCATCAATTGTTGGCAACCGAGATGTCGACGGC
GATGCAGTGGAGATTGCGGCAGAAGGATATCGAGCTGCTCGACGTCTCCA
CTTGGCCCGATTATCCCGGCTATTTCGATGTGATCTCTTGCCTGAATCTG
CTGGACCGATGCGATCGGCCTCTCACCTTGCTCAGCGACATCAAGCGCCG
GTTGCGTCCATCTAGCGGGATCCTGCTGCTTGCGGTTGTGTTTCCGGTCC
GACAATATGTCGAGAGTGAGCGAGCGGTGGCCTCGATATTTGTATGTGAA
TTTGTACCGGTTCTAGACAATTCCGACCATTCCCCCACTGAGGTGATGCC
CTTAGCACCGACCCGGGTCTGGGAGGTTCAGTTCGATCATTTCCTGCGTG
ACGTCATCGAGCCGGCCGGCTATCGGCTGGTGCGGTGGACTCGACTGCCG
TATTTGTGCGAGGGCGATTTCTCCCAGTCCTTCTATGTGCTGAATGACGT
CGTTATGGTTTTGAAGGCTCTCTAACTGCGGTGACCTTGAATAAATTGAT
TTTCAC
back to top

protein sequence of SMED30034175-orf-1

>SMED30034175-orf-1 ID=SMED30034175-orf-1|Name=SMED30034175-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MGYHLRSPLAKALFEKIQHQNEHSNASHGEWYAARLKLLSNVVSEKFMEM
YQDDETKQFIEDCFTKSDWFFTQIYHGLAKSILTWFISATSANGLLNRGS
MFVLSSSQIRRLLELDEEMKLERLLDLGAGDGNITTKFQPFFHQLLATEM
STAMQWRLRQKDIELLDVSTWPDYPGYFDVISCLNLLDRCDRPLTLLSDI
KRRLRPSSGILLLAVVFPVRQYVESERAVASIFVCEFVPVLDNSDHSPTE
VMPLAPTRVWEVQFDHFLRDVIEPAGYRLVRWTRLPYLCEGDFSQSFYVL
NDVVMVLKAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR029063SAM-dependent_MTases
IPR007884DREV_MeTrfase
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007884DREV methyltransferasePFAMPF05219DREVcoord: 31..308
e-value: 2.1E-75
score: 253.2
IPR007884DREV methyltransferasePANTHERPTHR12890DREV PROTEINcoord: 3..309
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 103..288
e-value: 1.3E-13
score: 52.6
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 123..217
e-value: 1.676E-5
score: 41.2615
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 121..300