Dyslexia-associated protein KIAA0319-like protein

Overview
NameDyslexia-associated protein KIAA0319-like protein
Smed IDSMED30034174
Length (bp)1402
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dyslexia-associated protein KIAA0319-like protein (SMED30034174) t-SNE clustered cells

Violin plots show distribution of expression levels for Dyslexia-associated protein KIAA0319-like protein (SMED30034174) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034174

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30034174h1SMcG0017871 SmedASXL_013864SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30034174h1SMcG0017871 dd_Smed_v4_13478_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 168.318 bits (425), Expect = 3.785e-46
Identity = 95/328 (28.96%), Postives = 169/328 (51.52%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            + W++  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVV+ LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +      F  Q+ +++        L   I+  K  P T  +  + + + ++        IF    +  +L+  +      F+ F  +++N++ C  +C +HG+CD  T++CICDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L
Sbjct:   69 YLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQ----IFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-RDGDSNCEWSVLYVIIATFVIVVALGIL 384          

HSP 2 Score: 53.9138 bits (128), Expect = 4.628e-7
Identity = 35/131 (26.72%), Postives = 62/131 (47.33%), Query Frame = 1
Query:  262 LKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD+K++ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:    1 MQEGDYTYQLTVTDTIGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLW-EKTQGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 127          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 167.933 bits (424), Expect = 3.072e-44
Identity = 95/333 (28.53%), Postives = 171/333 (51.35%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYIL 1179
            + W++  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVV+ LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +      F  Q+ +++        L   I+  K  P T  +  + + + ++        IF    +  +L+  +      F+ F  +++N++ C  +C +HG+CD  T++CICDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L   ++
Sbjct:  632 YLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQ----IFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-RDGDSNCEWSVLYVIIATFVIVVALGILSWTVI 952          

HSP 2 Score: 65.855 bits (159), Expect = 9.455e-11
Identity = 44/160 (27.50%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F L  +D  ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  441 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVD--SDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENN 596          

HSP 3 Score: 55.8398 bits (133), Expect = 1.601e-7
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD+K++ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  556 TPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLW-EKTQGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 690          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 167.933 bits (424), Expect = 3.073e-44
Identity = 95/333 (28.53%), Postives = 171/333 (51.35%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYIL 1179
            + W++  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVV+ LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +      F  Q+ +++        L   I+  K  P T  +  + + + ++        IF    +  +L+  +      F+ F  +++N++ C  +C +HG+CD  T++CICDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L   ++
Sbjct:  632 YLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQ----IFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-RDGDSNCEWSVLYVIIATFVIVVALGILSWTVI 952          

HSP 2 Score: 65.855 bits (159), Expect = 9.390e-11
Identity = 44/160 (27.50%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F L  +D  ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  441 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVD--SDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENN 596          

HSP 3 Score: 55.8398 bits (133), Expect = 1.511e-7
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD+K++ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  556 TPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLW-EKTQGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 690          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 149.828 bits (377), Expect = 1.945e-39
Identity = 97/362 (26.80%), Postives = 178/362 (49.17%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRR--KLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILC 1197
             P+E   L   S+        + W+ + GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V++LP  S+ L G  S DD++++ Y WI D  +PA  +++  S +   L L NL  G+Y F L V D +G  D D  T+ V+ D     ++E+ L   +   +         Q+ +++  ++ + +++++ +R   D  T   +IVFY       Q+R   K++ +A     L   +  +  +  +F V+++++  C   C  HG+CD  T++CIC   WM NL    +  D  ++C+ +IFYV    +++  TL +L      + I C
Sbjct:   48 FPVESATLDGSSSSDDHGIVFYHWEHVRGPSAVEMENIDKAIATVTGLQVGTYHFRLTVKDQQGLSS--TSTLTVAVKKENNSPPRARAGGRHVLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQPDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLL--NVLDSDIKVQKIRAHSDLST---VIVFY------VQSRPPFKVLKAAEVARNLHMRLSKEKADFLLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYI-WDGESNCEWSIFYV----TVLAFTLIVLTGGFTWLCICC 391          

HSP 2 Score: 58.9214 bits (141), Expect = 1.119e-8
Identity = 35/132 (26.52%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  262 LKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
            ++ G Y F +K+   ++    + ++ + +   +N  P A AG +  +I P  S  L G +S DD  ++ Y W   V  P+ +E+   ++++    +  L  G Y F+L V+D +GL     +T+ VK++ N+
Sbjct:    1 MQEGDYTFQLKVTD-SSRQQSTAVVTVIVQPENNRPPVAVAGPDKELIFPVESATLDGSSSSDDHGIVFYHW-EHVRGPSAVEM--ENIDKAIATVTGLQVGTYHFRLTVKDQQGLSSTSTLTVAVKKENNS 128          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 147.902 bits (372), Expect = 1.782e-37
Identity = 93/341 (27.27%), Postives = 172/341 (50.44%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRR--KLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILC 1197
            + W+ + GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V++LP  S+ L G  S DD++++ Y WI D  +PA  +++  S +   L L NL  G+Y F L V D +G  D D  T+ V+ D     ++E+ L   +   +         Q+ +++  ++ + +++++ +R   D  T   +IVFY       Q+R   K++ +A     L   +  +  +  +F V+++++  C   C  HG+CD  T++CIC   WM NL    +  D  ++C+ +IFYV    +++  TL +L      + I C
Sbjct:  613 YHWEHVRGPSAVEMENIDKAIATVTGLQVGTYHFRLTVKDQQGLSS--TSTLTVAVKKENNSPPRARAGGRHVLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQPDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLL--NVLDSDIKVQKIRAHSDLST---VIVFY------VQSRPPFKVLKAAEVARNLHMRLSKEKADFLLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYI-WDGESNCEWSIFYV----TVLAFTLIVLTGGFTWLCICC 935          

HSP 2 Score: 68.1662 bits (165), Expect = 1.702e-11
Identity = 52/186 (27.96%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  106 LQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI---DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            LQ   LPL    +    +   +    + W++I GP      S  +PV  ++NL  G Y F + +   D   NS+  + I+     ++ +  P ANAG N  + LP+ S+ L+G  S DD +++ Y+W     +  G  ++   V  P L L  +  G Y F+L V D    Q    +T+ V+ + N
Sbjct:  397 LQELTLPLTSALIDGSQSTDDTEIVSYHWEEINGPFIEEKTSVDSPVLRLSNLDPGNYSFRLTVTDSDGATNSTTAALIVN----NAVDYPPVANAGPNHTITLPQNSITLNGNQSSDDHQIVLYEWSLGPGS-EGKHVVMQGVQTPYLHLSAMQEGDYTFQLKVTDSSRQQSTAVVTVIVQPENN 577          

HSP 3 Score: 58.9214 bits (141), Expect = 1.398e-8
Identity = 36/140 (25.71%), Postives = 71/140 (50.71%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
             P   ++ ++ G Y F +K+   ++    + ++ + +   +N  P A AG +  +I P  S  L G +S DD  ++ Y W   V  P+ +E+   ++++    +  L  G Y F+L V+D +GL     +T+ VK++ N+
Sbjct:  537 TPYLHLSAMQEGDYTFQLKVTD-SSRQQSTAVVTVIVQPENNRPPVAVAGPDKELIFPVESATLDGSSSSDDHGIVFYHW-EHVRGPSAVEM--ENIDKAIATVTGLQVGTYHFRLTVKDQQGLSSTSTLTVAVKKENNS 672          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Fly
Match: CG7565 (gene:FBgn0035833 transcript:FBtr0076738)

HSP 1 Score: 152.91 bits (385), Expect = 1.962e-39
Identity = 104/343 (30.32%), Postives = 164/343 (47.81%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFY-----GIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILC 1197
            + WKQ+ GP+N  +L   + +A  T+L +G Y F + +   NN++  +    + I    N  P ANAGG+  V LP T++  +G  S+DD  V++Y W  D H+ A   I+ ++  EP +IL NL  G Y F L V D +GL   D +++ V+ D    N+++M L   +     + L +   ++ L++         +I++  LK D  T   ++VFY     G   D  Q  R+           LR  +  D +I     V I +  C   C  HG C+  TR CIC+ FWM +      +++  A+CD +I YV  VG  +I+   LL      I   C
Sbjct:  655 YLWKQLSGPNNAVILKSNSSIANATSLTLGLYEFELTVADENNNTA-TDTTWVKIVQERNAAPIANAGGDHTVTLPATAIYFNGSKSWDDLAVVKYLWTRDEHSLAAGVIVADTDKEPVMILTNLVQGRYVFTLTVSDDQGLTSSDTVSVNVRRDPKLLNLVQMTLPMGISVLVQSELDSVVQKLQLLLGDEN-----KIQVRELKYDLHTDATVLVFYVNDGQGKALDGLQVERQ-----------LRTQLQKDASILGAFAVDIRTSVCQSDCSGHGSCNPITRACICEAFWMPSAGYFFNNQE--ANCDWSILYVF-VG--VIVGCLLLSGVFWGIACAC 975          

HSP 2 Score: 65.4698 bits (158), Expect = 5.762e-11
Identity = 54/192 (28.12%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  124 PLEKIYLHPGSNLIPSSNAK--------FKWKQIMGPHNLS-VLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIE 672
            P E+I   P +N I   +          + W+ I GP     VL + N + +      G Y F + +   NN +  S    I +   ++  P ANAG  V++ LP  +V L+G  S DD +++ ++W  D  + A    + N+   P + L NL  G+Y F L V D  G     K+ + VK   N+  + E
Sbjct:  437 PREQIIRQPTTNAILDGSTSTDDDKITNWHWEVISGPIGYQPVLPEVNTLQLDLT-SPGNYTFKLTVTDSNNVT-NSTTATIAVLKETDYAPVANAGDAVILYLPNNNVTLNGTASSDDHEIVAWEWTKDASDEAKAVDMQNT-RTPYVQLSNLEEGMYTFVLKVTDGSGQSSTAKVHVFVKPPTNSPPVAE 625          

HSP 3 Score: 53.5286 bits (127), Expect = 3.494e-7
Identity = 39/139 (28.06%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  241 PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
            P   ++NL+ G Y F++K+   +  S  +++  + +   +N  P A AG N    LP   V L+G +S DD  +  Y W   +  P    IL ++ +  N    +L+ G+Y+F+L V D       D   + + ++RNA
Sbjct:  580 PYVQLSNLEEGMYTFVLKVTDGSGQSSTAKV-HVFVKPPTNSPPVAEAGSNTTTSLPINWVLLNGSDSKDDIGIKSYLW-KQLSGPNNAVILKSNSSIANAT--SLTLGLYEFELTVADENNNTATDTTWVKIVQERNA 714          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 123.635 bits (309), Expect = 1.219e-29
Identity = 84/347 (24.21%), Postives = 164/347 (47.26%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITL 1155
            LP++   L  G +        + WK+  GP  + + +    VA +T L+ G Y+F++ + D+ N  S  S  + + + + ++  P A    +  + LP  +  L G  S DD+  + Y W  + ++PA  ++L +S ++  L L NL  G Y F L V D +G    D   + V+ D   ++++E++L   +   S      +  QV +++   + + ++ I+ +    +  T L  +V  G          +   +  S+   LR       N F+ F   +++++ C  +C  HG CD  TR+C+C  FWM NL++     D+ ++C+ ++ YV     +I++ +
Sbjct:  527 LPVDHTTLDGGKSTDDQKIVTYHWKKTKGPEGVKLDNAETVVATVTGLQEGEYIFMLTVTDERNLES--SDTVSVIVREENDQPPVAKVVSSPPITLPVRTAVLDGSRSSDDKGSISYLWTREENSPAAGDVLNHSDHQAVLFLGNLVEGKYSFTLTVTDSKGKTSSDSGVVDVRPDVYERDLVELILEVAVAQVSRRQKDMYIRQVGVLL--GVLDSDITIREISAFNEHSTRLVFLVSGGPG--------RPPLTGHSVAMELRNKFRKQKNEFLIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYF-GDAESNCEWSVLYVTIASFMIVVAI 860          

HSP 2 Score: 65.4698 bits (158), Expect = 7.743e-11
Identity = 50/179 (27.93%), Postives = 79/179 (44.13%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR------IIQINIYDS----------------SNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP      S    +  +TNL  G Y F     +F+ SS  S+      ++ + + DS                ++ +P ANAG N V+ LP   + L+G  S DD   L Y+W     +  G  +    V  P L L  +  G Y F+L V D  G QD  ++T+ V+ + N
Sbjct:  340 WHWEEVKGPLREEKASGDTDILTLTNLVPGNYTF-----RFDYSSSTSQHVCSPQLLILTVTDSDGAQNSTQAMLLVNKATDYRPTANAGPNQVITLPHNYITLNGNQSTDDHDNLSYEWSLSPES-KGKVVEMQGVRTPTLQLSAMQEGDYTFELTVTDSSGQQDTTQVTVIVQPENN 512          

HSP 3 Score: 50.0618 bits (118), Expect = 6.148e-6
Identity = 36/151 (23.84%), Postives = 70/151 (46.36%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINI--YDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLS 684
             P   ++ ++ G Y F + +    +SS +    Q+ +     +N  P A+AG +  + LP     L G  S DD+K++ Y W      P G+++  ++       +  L  G Y F L V D   L+  D +++ V+E+ +   + +++ S
Sbjct:  472 TPTLQLSAMQEGDYTFELTV---TDSSGQQDTTQVTVIVQPENNQPPVADAGPDKELTLPVDHTTLDGGKSTDDQKIVTYHW-KKTKGPEGVKL--DNAETVVATVTGLQEGEYIFMLTVTDERNLESSDTVSVIVREENDQPPVAKVVSS 616          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Match: CT485618.1 (pep chromosome:GRCz11:CHR_ALT_CTG16_1_18:36918990:36930839:1 gene:ENSDARG00000110313.1 transcript:ENSDART00000187692.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT485618.1)

HSP 1 Score: 119.783 bits (299), Expect = 5.761e-29
Identity = 88/359 (24.51%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIF-MFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKI 1191
            LP+  I L+   +    + ++++W  I GP  L +      VA+ T L+ G Y   L  +D+   +   S ++ + + ++ ++   A+A G+  + LP  S+ L G  S      + + W+ D  +PA  ++L  S +E +L L NL  G Y F+L V D++G       T+ V+ D   +  +E+ L  ++   S         Q+  ++   + + ++ +K +  + D    ++ +  + +           +     L +LLR  +L + + F +F V++++++ C   C   G CD  T+ C CDP WM N   + LD D  ++CD ++ YV ++   + I   L+ R+ L +KI
Sbjct:   47 LPVNSITLNGSGSTDDQAISRYQWDVISGPPGLKMKDANKAVAIATGLRSGIYKLKLTVVDEQGETD--SAVLSVTVKEAKSLPLVAHASGSHTLTLPNNSLVLRGSVSNSGPANVSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVRPDTREQEEVELELQVSVAQVSQQQRDTVIRQLAALL--HVLDSDIALKALHGQSD----ISTVFRFSVQGPDG------LIPGPKLARLLRNQLLREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFLD-DGESNCDWSVLYV-TISCFVTIIFILVYRHSLQLKI 389          

HSP 2 Score: 65.0846 bits (157), Expect = 6.604e-11
Identity = 59/198 (29.80%), Postives = 93/198 (46.97%), Query Frame = 1
Query:  262 LKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHD 855
            L+ G Y F + +   +     S  I + +   +N  P A  G ++ ++LP  S+ L+G  S DD+ + RYQW   +  P GL++     N+   I   L  GIYK KL V D +G  D   +++TVKE ++   ++     ++     +NSL    S     VS S P  N+    VR ++ P  G    V YG  H+
Sbjct:    1 LEEGQYTFQLTVTD-SRGQQDSDTISVTVL-PANRAPVALTGPDIQLLLPVNSITLNGSGSTDDQAISRYQWDV-ISGPPGLKM--KDANKAVAIATGLRSGIYKLKLTVVDEQGETDSAVLSVTVKEAKSLP-LVAHASGSHTLTLPNNSLVLRGS-----VSNSGP-ANVSFLWVRDEQSPAAG---DVLYGSDHE 183          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 118.627 bits (296), Expect = 6.564e-28
Identity = 81/334 (24.25%), Postives = 158/334 (47.31%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIF 1116
            LP++   L  G +        + WK+  GP  + + +    VA +T L+ G Y+F++ + D+ N  S  S  + + + + ++  P A    +  + LP  +  L G  S DD+  + Y W  + ++PA  ++L +S ++  L L NL  G Y F L V D +G    D   + V+ D   ++++E++L   +   S      +  QV +++   + + ++ I+ +    +  T L  +V  G          +   +  S+   LR       N F+ F   +++++ C  +C  HG CD  TR+C+C  FWM NL++     D+ ++C+ +++
Sbjct:  378 LPVDHTTLDGGKSTDDQKIVTYHWKKTKGPEGVKLDNAETVVATVTGLQEGEYIFMLTVTDERNLES--SDTVSVIVREENDQPPVAKVVSSPPITLPVRTAVLDGSRSSDDKGSISYLWTREENSPAAGDVLNHSDHQAVLFLGNLVEGKYSFTLTVTDSKGKTSSDSGVVDVRPDVYERDLVELILEVAVAQVSRRQKDMYIRQVGVLL--GVLDSDITIREISAFNEHSTRLVFLVSGGPG--------RPPLTGHSVAMELRNKFRKQKNEFLIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYF-GDAESNCEGSLY 698          

HSP 2 Score: 72.0182 bits (175), Expect = 6.590e-13
Identity = 44/157 (28.03%), Postives = 76/157 (48.41%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP      S    +  +TNL  G Y F + +   + +   ++ + + +  +++ +P ANAG N V+ LP   + L+G  S DD   L Y+W     +  G  +    V  P L L  +  G Y F+L V D  G QD  ++T+ V+ + N
Sbjct:  209 WHWEEVKGPLREEKASGDTDILTLTNLVPGNYTFSLTVTDSDGAQNSTQAMLL-VNKATDYRPTANAGPNQVITLPHNYITLNGNQSTDDHDNLSYEWSLSPES-KGKVVEMQGVRTPTLQLSAMQEGDYTFELTVTDSSGQQDTTQVTVIVQPENN 363          

HSP 3 Score: 49.6766 bits (117), Expect = 6.987e-6
Identity = 36/150 (24.00%), Postives = 70/150 (46.67%), Query Frame = 1
Query:  241 PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINI--YDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLS 684
            P   ++ ++ G Y F + +    +SS +    Q+ +     +N  P A+AG +  + LP     L G  S DD+K++ Y W      P G+++  ++       +  L  G Y F L V D   L+  D +++ V+E+ +   + +++ S
Sbjct:  324 PTLQLSAMQEGDYTFELTV---TDSSGQQDTTQVTVIVQPENNQPPVADAGPDKELTLPVDHTTLDGGKSTDDQKIVTYHW-KKTKGPEGVKL--DNAETVVATVTGLQEGEYIFMLTVTDERNLESSDTVSVIVREENDQPPVAKVVSS 467          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 113.235 bits (282), Expect = 4.354e-26
Identity = 86/361 (23.82%), Postives = 169/361 (46.81%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIF-MFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILC 1197
            LP+  I L+   +    + ++++W  + GP  L +      VA+ T L+ G Y   L  +D+   +   S ++ I + ++ ++   A+A G+  + LP  S+ L G  S      + + W+ D  +PA  ++L  S +E +L L NL  G Y F+L V D++G       T+ V+ D   +  +E+ L  ++   S         Q+  ++   + + ++ +K +  + D    ++ +  + +           +     L +LLR  +L + + F +F V++++++ C   C   G CD  T+ C CDP WM N   + +D D  ++CD ++ YV        I+ F+   +IL +  +C
Sbjct:  610 LPVNSITLNGSGSTDDQAISRYQWDVMSGPPGLKMKDANKAVAIATGLRSGIYKLKLTVVDEQGETD--SAVLSITVKEAKSLPLVAHASGSHTLTLPNNSLVLRGSVSNSGPANVSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVRPDPREREEVELELQVSVAQVSQQQRDTVIRQLAALL--HVLDSDIALKALHGQSD----ISTVFRFSVQGPDG------LIPGPKLARLLRNQLLREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFID-DGESNCDWSVLYV-------TISCFVTIIFILSVSWIC 948          

HSP 2 Score: 68.5514 bits (166), Expect = 9.510e-12
Identity = 59/202 (29.21%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  250 VITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHD 855
            ++++L+ G Y F + +   +     S  I + +   +N  P A  G ++ ++LP  S+ L+G  S DD+ + RYQW   +  P GL++     N+   I   L  GIYK KL V D +G  D   +++TVKE ++   ++     ++     +NSL    S     VS S P  N+    VR ++ P  G    V YG  H+
Sbjct:  560 LVSDLEEGQYTFQLTVTD-SRGQQDSDTISVTVL-PANRAPVAVTGPDIQLLLPVNSITLNGSGSTDDQAISRYQWDV-MSGPPGLKM--KDANKAVAIATGLRSGIYKLKLTVVDEQGETDSAVLSITVKEAKSLP-LVAHASGSHTLTLPNNSLVLRGS-----VSNSGP-ANVSFLWVRDEQSPAAG---DVLYGSDHE 746          

HSP 3 Score: 60.4622 bits (145), Expect = 3.103e-9
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            + WK++ GP          PV  + NL  G Y F + + D    S   +  ++++I    +  P A AG + V+ LP   + L G  S DD+ +  Y W     +P   ++    V    L++ +L  G Y F+L V D  G QD D +++TV
Sbjct:  442 YLWKKVDGPFWTPEGPVNKPVLQLKNLLPGEYTFELTVSDSEGLSDSSTATLRVSI--PKDEPPLARAGTDRVITLPLNHLTLWGNQSTDDQAITSYLWTLHPSSPT-RKVTMQDVRSAFLLVSDLEEGQYTFQLTVTDSRGQQDSDTISVTV 591          

HSP 4 Score: 50.447 bits (119), Expect = 3.913e-6
Identity = 47/156 (30.13%), Postives = 64/156 (41.03%), Query Frame = 1
Query:  199 IMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQL---------SGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            + G HN SV        +++ L  G Y   V +         S  + ++  +  N  PKA       V+LP++   L         +G  S DD  ++ Y W   V  P         VN+P L L NL PG Y F+L V D EGL D    TL V
Sbjct:  358 MEGQHNKSV--------ILSELSEGVYAVRVIVKAHQAYGEGSVDLTVHPAEKINKPPKA-------VVLPKSQDVLFKKDSVLIINGSESMDDAGIVSYLW-KKVDGP--FWTPEGPVNKPVLQLKNLLPGEYTFELTVSDSEGLSDSSTATLRV 495          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 112.849 bits (281), Expect = 5.217e-26
Identity = 86/361 (23.82%), Postives = 169/361 (46.81%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIF-MFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILC 1197
            LP+  I L+   +    + ++++W  + GP  L +      VA+ T L+ G Y   L  +D+   +   S ++ I + ++ ++   A+A G+  + LP  S+ L G  S      + + W+ D  +PA  ++L  S +E +L L NL  G Y F+L V D++G       T+ V+ D   +  +E+ L  ++   S         Q+  ++   + + ++ +K +  + D    ++ +  + +           +     L +LLR  +L + + F +F V++++++ C   C   G CD  T+ C CDP WM N   + +D D  ++CD ++ YV        I+ F+   +IL +  +C
Sbjct:  610 LPVNSITLNGSGSTDDQAISRYQWDVMSGPPGLKMKDANKAVAIATGLRSGIYKLKLTVVDEQGETD--SAVLSITVKEAKSLPLVAHASGSHTLTLPNNSLVLRGSVSNSGPANVSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVRPDPREREEVELELQVSVAQVSQQQRDTVIRQLAALL--HVLDSDIALKALHGQSD----ISTVFRFSVQGPDG------LIPGPKLARLLRNQLLREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFID-DGESNCDWSVLYV-------TISCFVTIIFILSVSWIC 948          

HSP 2 Score: 68.1662 bits (165), Expect = 1.260e-11
Identity = 59/202 (29.21%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  250 VITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHD 855
            ++++L+ G Y F + +   +     S  I + +   +N  P A  G ++ ++LP  S+ L+G  S DD+ + RYQW   +  P GL++     N+   I   L  GIYK KL V D +G  D   +++TVKE ++   ++     ++     +NSL    S     VS S P  N+    VR ++ P  G    V YG  H+
Sbjct:  560 LVSDLEEGQYTFQLTVTD-SRGQQDSDTISVTVL-PANRAPVAVTGPDIQLLLPVNSITLNGSGSTDDQAISRYQWDV-MSGPPGLKM--KDANKAVAIATGLRSGIYKLKLTVVDEQGETDSAVLSITVKEAKSLP-LVAHASGSHTLTLPNNSLVLRGS-----VSNSGP-ANVSFLWVRDEQSPAAG---DVLYGSDHE 746          

HSP 3 Score: 60.4622 bits (145), Expect = 2.965e-9
Identity = 44/153 (28.76%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            + WK++ GP          PV  + NL  G Y F + + D    S   +  ++++I    +  P A AG + V+ LP   + L G  S DD+ +  Y W     +P   ++    V    L++ +L  G Y F+L V D  G QD D +++TV
Sbjct:  442 YLWKKVDGPFWTPEGPVNKPVLQLKNLLPGEYTFELTVSDSEGLSDSSTATLRVSI--PKDEPPLARAGTDRVITLPLNHLTLWGNQSTDDQAITSYLWTLHPSSPT-RKVTMQDVRSAFLLVSDLEEGQYTFQLTVTDSRGQQDSDTISVTV 591          

HSP 4 Score: 50.447 bits (119), Expect = 4.272e-6
Identity = 47/156 (30.13%), Postives = 64/156 (41.03%), Query Frame = 1
Query:  199 IMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQL---------SGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            + G HN SV        +++ L  G Y   V +         S  + ++  +  N  PKA       V+LP++   L         +G  S DD  ++ Y W   V  P         VN+P L L NL PG Y F+L V D EGL D    TL V
Sbjct:  358 MEGQHNKSV--------ILSELSEGVYAVRVIVKAHQAYGEGSVDLTVHPAEKINKPPKA-------VVLPKSQDVLFKKDSVLIINGSESMDDAGIVSYLW-KKVDGP--FWTPEGPVNKPVLQLKNLLPGEYTFELTVSDSEGLSDSSTATLRV 495          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 162.54 bits (410), Expect = 1.233e-42
Identity = 103/349 (29.51%), Postives = 172/349 (49.28%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR-IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +      + + W++  GP  + + +  +  A ++ L++G Y F + +   +   L+S+  + + + +  N  P A   GNVV+ LP  + +L G  SFDD+ ++ YQW  D  +PA  E+L  S     L L NL  GIY F L V D +G  D D+ T+ VK D    N++EM+L  N+ + +      F  Q+ +++     +I +Q KI +           +VFY  +    QT +     AS+L   L     D     +F  ++I++  C  +C  HG+C+  T++CICDPFWM NL       D  ++CD ++ YVI    + ++ L LL
Sbjct:  339 LPVDSTTLDGSRSTDDQGISSYLWEKTKGPDGVKITNSNSSTATVSGLQVGTYEFTLTVK--DERDLQSQSTVSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVKPDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLLGVLDSDIIVQ-KIQQYTEQSTK----VVFYVQNQPPHQTLKGYQV-ASTLRNELHKQQSD---FLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFG-DGESNCDWSVLYVIISSFVFVVALGLL 675          

HSP 2 Score: 70.8626 bits (172), Expect = 2.139e-12
Identity = 49/183 (26.78%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAG-LEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q   LP    ++    +        + W+++ GP     ++   PV  ++NL  G Y F + +   ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  ++ Y+W     +    +E+ G  V   NL L  L  G Y F L V D  G Q   ++T+ V+ + N
Sbjct:  145 QEISLPTTSTFIDGSQSTDDEKIVSYYWEELKGPLREEKVTAETPVLKLSNLVPGNYTFRLTVTD-SDGAQNSTTANLTVSKAVDYPPVANAGANQVITLPKNSIVLFGNLSTDDHGIVSYEWSLSPSSKGNVMEMQG--VRTANLQLSALQEGDYTFHLTVTDSAGQQSTSEVTVIVQPENN 324          

HSP 3 Score: 54.6842 bits (130), Expect = 2.374e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ L+ G Y F + +         S +  I +   +N  P+A+AG +  + LP  S  L G  S DD+ +  Y W      P G++I  +  N     +  L  G Y+F L V+D   LQ +  +++ V+E+ N
Sbjct:  289 LSALQEGDYTFHLTVTDSAGQQSTSEVTVI-VQPENNKPPEADAGPDKELTLPVDSTTLDGSRSTDDQGISSYLW-EKTKGPDGVKITNS--NSSTATVSGLQVGTYEFTLTVKDERDLQSQSTVSVIVREEIN 418          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 162.54 bits (410), Expect = 1.666e-42
Identity = 103/349 (29.51%), Postives = 172/349 (49.28%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR-IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +      + + W++  GP  + + +  +  A ++ L++G Y F + +   +   L+S+  + + + +  N  P A   GNVV+ LP  + +L G  SFDD+ ++ YQW  D  +PA  E+L  S     L L NL  GIY F L V D +G  D D+ T+ VK D    N++EM+L  N+ + +      F  Q+ +++     +I +Q KI +           +VFY  +    QT +     AS+L   L     D     +F  ++I++  C  +C  HG+C+  T++CICDPFWM NL       D  ++CD ++ YVI    + ++ L LL
Sbjct:  505 LPVDSTTLDGSRSTDDQGISSYLWEKTKGPDGVKITNSNSSTATVSGLQVGTYEFTLTVK--DERDLQSQSTVSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVKPDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLLGVLDSDIIVQ-KIQQYTEQSTK----VVFYVQNQPPHQTLKGYQV-ASTLRNELHKQQSD---FLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFG-DGESNCDWSVLYVIISSFVFVVALGLL 841          

HSP 2 Score: 71.633 bits (174), Expect = 1.415e-12
Identity = 49/183 (26.78%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAG-LEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q   LP    ++    +        + W+++ GP     ++   PV  ++NL  G Y F + +   ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  ++ Y+W     +    +E+ G  V   NL L  L  G Y F L V D  G Q   ++T+ V+ + N
Sbjct:  311 QEISLPTTSTFIDGSQSTDDEKIVSYYWEELKGPLREEKVTAETPVLKLSNLVPGNYTFRLTVTD-SDGAQNSTTANLTVSKAVDYPPVANAGANQVITLPKNSIVLFGNLSTDDHGIVSYEWSLSPSSKGNVMEMQG--VRTANLQLSALQEGDYTFHLTVTDSAGQQSTSEVTVIVQPENN 490          

HSP 3 Score: 55.4546 bits (132), Expect = 1.738e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ L+ G Y F + +         S +  I +   +N  P+A+AG +  + LP  S  L G  S DD+ +  Y W      P G++I  +  N     +  L  G Y+F L V+D   LQ +  +++ V+E+ N
Sbjct:  455 LSALQEGDYTFHLTVTDSAGQQSTSEVTVI-VQPENNKPPEADAGPDKELTLPVDSTTLDGSRSTDDQGISSYLW-EKTKGPDGVKITNS--NSSTATVSGLQVGTYEFTLTVKDERDLQSQSTVSVIVREEIN 584          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 162.54 bits (410), Expect = 1.716e-42
Identity = 103/349 (29.51%), Postives = 172/349 (49.28%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR-IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +      + + W++  GP  + + +  +  A ++ L++G Y F + +   +   L+S+  + + + +  N  P A   GNVV+ LP  + +L G  SFDD+ ++ YQW  D  +PA  E+L  S     L L NL  GIY F L V D +G  D D+ T+ VK D    N++EM+L  N+ + +      F  Q+ +++     +I +Q KI +           +VFY  +    QT +     AS+L   L     D     +F  ++I++  C  +C  HG+C+  T++CICDPFWM NL       D  ++CD ++ YVI    + ++ L LL
Sbjct:  516 LPVDSTTLDGSRSTDDQGISSYLWEKTKGPDGVKITNSNSSTATVSGLQVGTYEFTLTVK--DERDLQSQSTVSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVKPDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLLGVLDSDIIVQ-KIQQYTEQSTK----VVFYVQNQPPHQTLKGYQV-ASTLRNELHKQQSD---FLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFG-DGESNCDWSVLYVIISSFVFVVALGLL 852          

HSP 2 Score: 71.2478 bits (173), Expect = 1.726e-12
Identity = 49/183 (26.78%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAG-LEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q   LP    ++    +        + W+++ GP     ++   PV  ++NL  G Y F + +   ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  ++ Y+W     +    +E+ G  V   NL L  L  G Y F L V D  G Q   ++T+ V+ + N
Sbjct:  322 QEISLPTTSTFIDGSQSTDDEKIVSYYWEELKGPLREEKVTAETPVLKLSNLVPGNYTFRLTVTD-SDGAQNSTTANLTVSKAVDYPPVANAGANQVITLPKNSIVLFGNLSTDDHGIVSYEWSLSPSSKGNVMEMQG--VRTANLQLSALQEGDYTFHLTVTDSAGQQSTSEVTVIVQPENN 501          

HSP 3 Score: 55.4546 bits (132), Expect = 1.587e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ L+ G Y F + +         S +  I +   +N  P+A+AG +  + LP  S  L G  S DD+ +  Y W      P G++I  +  N     +  L  G Y+F L V+D   LQ +  +++ V+E+ N
Sbjct:  466 LSALQEGDYTFHLTVTDSAGQQSTSEVTVI-VQPENNKPPEADAGPDKELTLPVDSTTLDGSRSTDDQGISSYLW-EKTKGPDGVKITNS--NSSTATVSGLQVGTYEFTLTVKDERDLQSQSTVSVIVREEIN 595          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 162.54 bits (410), Expect = 1.800e-42
Identity = 103/349 (29.51%), Postives = 172/349 (49.28%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR-IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +      + + W++  GP  + + +  +  A ++ L++G Y F + +   +   L+S+  + + + +  N  P A   GNVV+ LP  + +L G  SFDD+ ++ YQW  D  +PA  E+L  S     L L NL  GIY F L V D +G  D D+ T+ VK D    N++EM+L  N+ + +      F  Q+ +++     +I +Q KI +           +VFY  +    QT +     AS+L   L     D     +F  ++I++  C  +C  HG+C+  T++CICDPFWM NL       D  ++CD ++ YVI    + ++ L LL
Sbjct:  548 LPVDSTTLDGSRSTDDQGISSYLWEKTKGPDGVKITNSNSSTATVSGLQVGTYEFTLTVK--DERDLQSQSTVSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVKPDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLLGVLDSDIIVQ-KIQQYTEQSTK----VVFYVQNQPPHQTLKGYQV-ASTLRNELHKQQSD---FLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFG-DGESNCDWSVLYVIISSFVFVVALGLL 884          

HSP 2 Score: 71.633 bits (174), Expect = 1.341e-12
Identity = 49/183 (26.78%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAG-LEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q   LP    ++    +        + W+++ GP     ++   PV  ++NL  G Y F + +   ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  ++ Y+W     +    +E+ G  V   NL L  L  G Y F L V D  G Q   ++T+ V+ + N
Sbjct:  354 QEISLPTTSTFIDGSQSTDDEKIVSYYWEELKGPLREEKVTAETPVLKLSNLVPGNYTFRLTVTD-SDGAQNSTTANLTVSKAVDYPPVANAGANQVITLPKNSIVLFGNLSTDDHGIVSYEWSLSPSSKGNVMEMQG--VRTANLQLSALQEGDYTFHLTVTDSAGQQSTSEVTVIVQPENN 533          

HSP 3 Score: 55.4546 bits (132), Expect = 1.774e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ L+ G Y F + +         S +  I +   +N  P+A+AG +  + LP  S  L G  S DD+ +  Y W      P G++I  +  N     +  L  G Y+F L V+D   LQ +  +++ V+E+ N
Sbjct:  498 LSALQEGDYTFHLTVTDSAGQQSTSEVTVI-VQPENNKPPEADAGPDKELTLPVDSTTLDGSRSTDDQGISSYLW-EKTKGPDGVKITNS--NSSTATVSGLQVGTYEFTLTVKDERDLQSQSTVSVIVREEIN 627          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 162.155 bits (409), Expect = 2.044e-42
Identity = 103/349 (29.51%), Postives = 172/349 (49.28%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR-IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +      + + W++  GP  + + +  +  A ++ L++G Y F + +   +   L+S+  + + + +  N  P A   GNVV+ LP  + +L G  SFDD+ ++ YQW  D  +PA  E+L  S     L L NL  GIY F L V D +G  D D+ T+ VK D    N++EM+L  N+ + +      F  Q+ +++     +I +Q KI +           +VFY  +    QT +     AS+L   L     D     +F  ++I++  C  +C  HG+C+  T++CICDPFWM NL       D  ++CD ++ YVI    + ++ L LL
Sbjct:  478 LPVDSTTLDGSRSTDDQGISSYLWEKTKGPDGVKITNSNSSTATVSGLQVGTYEFTLTVK--DERDLQSQSTVSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVKPDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLLGVLDSDIIVQ-KIQQYTEQSTK----VVFYVQNQPPHQTLKGYQV-ASTLRNELHKQQSD---FLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFG-DGESNCDWSVLYVIISSFVFVVALGLL 814          

HSP 2 Score: 71.2478 bits (173), Expect = 1.696e-12
Identity = 49/183 (26.78%), Postives = 83/183 (45.36%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAG-LEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q   LP    ++    +        + W+++ GP     ++   PV  ++NL  G Y F + +   ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  ++ Y+W     +    +E+ G  V   NL L  L  G Y F L V D  G Q   ++T+ V+ + N
Sbjct:  284 QEISLPTTSTFIDGSQSTDDEKIVSYYWEELKGPLREEKVTAETPVLKLSNLVPGNYTFRLTVTD-SDGAQNSTTANLTVSKAVDYPPVANAGANQVITLPKNSIVLFGNLSTDDHGIVSYEWSLSPSSKGNVMEMQG--VRTANLQLSALQEGDYTFHLTVTDSAGQQSTSEVTVIVQPENN 463          

HSP 3 Score: 55.4546 bits (132), Expect = 1.800e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ L+ G Y F + +         S +  I +   +N  P+A+AG +  + LP  S  L G  S DD+ +  Y W      P G++I  +  N     +  L  G Y+F L V+D   LQ +  +++ V+E+ N
Sbjct:  428 LSALQEGDYTFHLTVTDSAGQQSTSEVTVI-VQPENNKPPEADAGPDKELTLPVDSTTLDGSRSTDDQGISSYLW-EKTKGPDGVKITNS--NSSTATVSGLQVGTYEFTLTVKDERDLQSQSTVSVIVREEIN 557          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 168.703 bits (426), Expect = 1.354e-44
Identity = 95/328 (28.96%), Postives = 168/328 (51.22%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            + W+Q  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVVV LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +         Q+ +++        L   I+  K  P T  +  + + + +D        +F    +  +L+  +      F+ F  ++I+++ C  +C +HG+CD  T++C+CDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L
Sbjct:  631 YLWEQSRGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMLFFVQNDPPHQ----LFKGHEVAAMLKSELQKQKADFLIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQL-RDGDSNCEWSVLYVIIASFVIVVALGIL 946          

HSP 2 Score: 67.3958 bits (163), Expect = 2.073e-11
Identity = 46/162 (28.40%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF---LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F   +V  D   NS+  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  440 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTTAS----LTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVIVQPENN 595          

HSP 3 Score: 55.8398 bits (133), Expect = 8.850e-8
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD++V+ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  555 TPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSTDDQRVVSYLW-EQSRGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 689          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 168.318 bits (425), Expect = 1.773e-44
Identity = 95/328 (28.96%), Postives = 168/328 (51.22%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            + W+Q  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVVV LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +         Q+ +++        L   I+  K  P T  +  + + + +D        +F    +  +L+  +      F+ F  ++I+++ C  +C +HG+CD  T++C+CDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L
Sbjct:  631 YLWEQSRGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMLFFVQNDPPHQ----LFKGHEVAAMLKSELQKQKADFLIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQL-RDGDSNCEWSVLYVIIASFVIVVALGIL 946          

HSP 2 Score: 67.781 bits (164), Expect = 1.855e-11
Identity = 46/162 (28.40%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF---LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F   +V  D   NS+  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  440 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTTAS----LTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVIVQPENN 595          

HSP 3 Score: 56.225 bits (134), Expect = 7.838e-8
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD++V+ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  555 TPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSTDDQRVVSYLW-EQSRGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 689          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 168.318 bits (425), Expect = 1.773e-44
Identity = 95/328 (28.96%), Postives = 168/328 (51.22%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            + W+Q  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVVV LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +         Q+ +++        L   I+  K  P T  +  + + + +D        +F    +  +L+  +      F+ F  ++I+++ C  +C +HG+CD  T++C+CDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L
Sbjct:  631 YLWEQSRGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMLFFVQNDPPHQ----LFKGHEVAAMLKSELQKQKADFLIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQL-RDGDSNCEWSVLYVIIASFVIVVALGIL 946          

HSP 2 Score: 67.781 bits (164), Expect = 1.855e-11
Identity = 46/162 (28.40%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF---LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F   +V  D   NS+  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  440 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTTAS----LTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVIVQPENN 595          

HSP 3 Score: 56.225 bits (134), Expect = 7.838e-8
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD++V+ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  555 TPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSTDDQRVVSYLW-EQSRGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 689          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Match: D130043K22Rik (RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:MGI:3036268])

HSP 1 Score: 151.369 bits (381), Expect = 8.833e-39
Identity = 88/314 (28.03%), Postives = 164/314 (52.23%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYV 1122
            + W+ I GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V+ILP  S+ L G  S DDR ++ Y WI D  +PA  +++G S +   L L NL  G+Y F LLV D +G  D D  T+ V  D     ++E++L   ++  +    +    Q+ ++++     ++  +K+++++        +IVFY     ++ +  K++ +A+    L + +  +     +F V+++++  C   C  HG+CD  T++CIC   WM NL    +  D  ++C+ ++FYV
Sbjct:  667 YHWEHIRGPSAVEMENVDKAIATVTGLQVGIYHFRLTVRDQQGLSS--TSTLTVAVKKENNSPPRAQAGGRHVLILPNNSITLDGSRSTDDRGIVSYLWIRDGQSPAAGDVIGGSDHRAALQLTNLVEGVYTFHLLVTDSQGASDSDAATVEVLPDPKKDGLVELILQVGVEQLTEQQKETLVRQLAVLLNV----LDSDVKVLKIQAHTDVS-TVIVFY----VQSGSPFKVLRAAAVARNLHKRLSKEKEAFLLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYM-WDGESNCEWSVFYV 968          

HSP 2 Score: 75.8702 bits (185), Expect = 4.512e-14
Identity = 50/162 (30.86%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI---DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGL--EILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP          P+  ++NL  G Y F + I   D   NS+  S +I+    D+ +  P ANAG N  + LP+ ++ L+G  S DD +++ Y+W A    P G   E++      P L L  L  G Y F+L+V D  G Q    + +TV+ + N
Sbjct:  477 YHWEEVDGPFLGEEFPADTPILRLSNLVPGNYTFRLTITDSDGATNSTTASLVIR----DAVDYPPVANAGPNQTITLPQNTIILNGNQSSDDHQIVLYEWFA---GPGGESKEMVMQGAQTPYLHLSELQEGEYTFQLMVTDSSGQQSTALVAVTVQAENN 631          

HSP 3 Score: 59.3066 bits (142), Expect = 8.252e-9
Identity = 39/141 (27.66%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
             P   ++ L+ G Y F L+  D     S  + ++ + +   +N  P A AG +  ++ P  S  L G  S DD  ++ Y W   +  P+ +E+   +V++    +  L  GIY F+L V D +GL     +T+ VK++ N+
Sbjct:  591 TPYLHLSELQEGEYTFQLMVTDSSGQQS--TALVAVTVQAENNQAPVAVAGPDKELVFPVQSATLDGSRSSDDHGIVCYHW-EHIRGPSAVEM--ENVDKAIATVTGLQVGIYHFRLTVRDQQGLSSTSTLTVAVKKENNS 726          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Match: D130043K22Rik (RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:MGI:3036268])

HSP 1 Score: 75.0998 bits (183), Expect = 8.059e-14
Identity = 50/162 (30.86%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI---DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGL--EILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP          P+  ++NL  G Y F + I   D   NS+  S +I+    D+ +  P ANAG N  + LP+ ++ L+G  S DD +++ Y+W A    P G   E++      P L L  L  G Y F+L+V D  G Q    + +TV+ + N
Sbjct:  477 YHWEEVDGPFLGEEFPADTPILRLSNLVPGNYTFRLTITDSDGATNSTTASLVIR----DAVDYPPVANAGPNQTITLPQNTIILNGNQSSDDHQIVLYEWFA---GPGGESKEMVMQGAQTPYLHLSELQEGEYTFQLMVTDSSGQQSTALVAVTVQAENN 631          

HSP 2 Score: 70.8626 bits (172), Expect = 1.727e-12
Identity = 37/107 (34.58%), Postives = 59/107 (55.14%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPA 501
            + W+ I GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V+ILP  S+ L G  S DDR ++ Y WI D  +PA
Sbjct:  667 YHWEHIRGPSAVEMENVDKAIATVTGLQVGIYHFRLTVRDQQGLSS--TSTLTVAVKKENNSPPRAQAGGRHVLILPNNSITLDGSRSTDDRGIVSYLWIRDGQSPA 771          

HSP 3 Score: 58.151 bits (139), Expect = 1.657e-8
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 1
Query:  253 ITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
            ++ L+ G Y F L+  D     S  + ++ + +   +N  P A AG +  ++ P  S  L G  S DD  ++ Y W   +  P+ +E+   +V++    +  L  GIY F+L V D +GL     +T+ VK++ N+
Sbjct:  596 LSELQEGEYTFQLMVTDSSGQQS--TALVAVTVQAENNQAPVAVAGPDKELVFPVQSATLDGSRSSDDHGIVCYHW-EHIRGPSAVEM--ENVDKAIATVTGLQVGIYHFRLTVRDQQGLSSTSTLTVAVKKENNS 726          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Match: sp|Q8K135|K319L_MOUSE (Dyslexia-associated protein KIAA0319-like protein OS=Mus musculus OX=10090 GN=Kiaa0319l PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 9.472e-44
Identity = 95/328 (28.96%), Postives = 168/328 (51.22%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            + W+Q  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVVV LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +         Q+ +++        L   I+  K  P T  +  + + + +D        +F    +  +L+  +      F+ F  ++I+++ C  +C +HG+CD  T++C+CDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L
Sbjct:  631 YLWEQSRGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMLFFVQNDPPHQ----LFKGHEVAAMLKSELQKQKADFLIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQL-RDGDSNCEWSVLYVIIASFVIVVALGIL 946          

HSP 2 Score: 67.3958 bits (163), Expect = 1.450e-10
Identity = 46/162 (28.40%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF---LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F   +V  D   NS+  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  440 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTTAS----LTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVIVQPENN 595          

HSP 3 Score: 55.8398 bits (133), Expect = 6.190e-7
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD++V+ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  555 TPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSTDDQRVVSYLW-EQSRGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 689          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Match: sp|Q5RFR6|K319L_PONAB (Dyslexia-associated protein KIAA0319-like protein OS=Pongo abelii OX=9601 GN=Kiaa0319l PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.022e-43
Identity = 95/333 (28.53%), Postives = 171/333 (51.35%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYIL 1179
            + W++  GP  + + +  + +A +T L++G YVF + +    N   +S +  + + +  N  P A   GNVV+ LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +      F  Q+ +++        L   I+  K  P T  +  + + + ++        IF    +  +L+  +      F+ F  ++IN++ C  +C +HG+CD  T++CICDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L   ++
Sbjct:  632 YLWEKTQGPDGVQLENANSSIATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQ----IFKGHEVAAMLKSELRKQKADFLIFRALEINTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-RDGESNCEWSVLYVIIATFVIVVALGILSWTVI 952          

HSP 2 Score: 65.855 bits (159), Expect = 4.540e-10
Identity = 44/160 (27.50%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F L  +D  ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  441 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVD--SDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENN 596          

HSP 3 Score: 55.4546 bits (132), Expect = 9.137e-7
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD+K++ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  556 TPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLW-EKTQGPDGVQL--ENANSSIATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 690          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Match: sp|Q8IZA0|K319L_HUMAN (Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 1.475e-43
Identity = 95/333 (28.53%), Postives = 171/333 (51.35%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYIL 1179
            + W++  GP  + + +  + VA +T L++G YVF + +    N   +S +  + + +  N  P A   GNVV+ LP ++ +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++E++L  N+   +      F  Q+ +++        L   I+  K  P T  +  + + + ++        IF    +  +L+  +      F+ F  +++N++ C  +C +HG+CD  T++CICDPFWM N   + L +D  ++C+ ++ YVI    +I++ L +L   ++
Sbjct:  632 YLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSV-NVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGV------LDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQ----IFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-RDGDSNCEWSVLYVIIATFVIVVALGILSWTVI 952          

HSP 2 Score: 65.855 bits (159), Expect = 4.540e-10
Identity = 44/160 (27.50%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  ++ L  G Y F L  +D  ++ +  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W ++       +E+ G  V  P L L  +  G Y ++L V D  G Q   ++T+ V+ + N
Sbjct:  441 QYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVD--SDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQG--VRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENN 596          

HSP 3 Score: 55.8398 bits (133), Expect = 7.686e-7
Identity = 36/139 (25.90%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   ++ ++ G Y + + +         +++  I +   +N  P+A+AG +  + LP  S  L G  S DD+K++ Y W      P G+++   + N     +  L  G Y F L V+D   LQ +  + + VKE+ N
Sbjct:  556 TPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVI-VQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLW-EKTQGPDGVQL--ENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEIN 690          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Match: sp|P0CI71|K0319_RAT (Dyslexia-associated protein KIAA0319 homolog OS=Rattus norvegicus OX=10116 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.942e-38
Identity = 90/323 (27.86%), Postives = 168/323 (52.01%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIII 1149
            ++W+ I GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V++LP  S+ L G  S DDR ++ Y WI D  +PA  +I+G+S N   L L NL  G+Y F LLV D +G  D D   + V  D     M+E++L   ++  +    +    Q+ ++++     ++  +K+++++        +IVFY     ++ +  K++ +A     L + +  +     +F V++I++  C   C  HG+CD  T++CIC   WM NL    +  D  ++C+ ++FYV ++   + +
Sbjct:  667 YRWEHIRGPSAVEMENVDKAIATVTGLQVGTYHFRLTVRDQQGLSS--TSTLTVAVKKENNSPPRAQAGGRHVLMLPNNSITLDGSRSTDDRGIVSYLWIRDGQSPAAGDIIGSSDNGAALQLTNLVEGVYTFHLLVTDSQGASDSDTAIVEVLPDPKKDGMVELILQVGVEQLTEQQKETLVRQLAVLLNV----LDSDVKVLKIQAHTDVS-TVIVFY----VQSGSPFKVLRAADVARNLHKRLSKEKGAFLLFKVLRIDTAGCLLKCSGHGHCDPITKRCICSQLWMENLLQRYM-WDGESNCEWSVFYVAALALTLTV 977          

HSP 2 Score: 81.2629 bits (199), Expect = 6.117e-15
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  106 LQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI---DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGL--EILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            +Q   LPL    +    +   +    + W+++ GP       D +P+  ++NL  G Y F + I   D   NS+  + II+ ++    +  P ANAG N  + LP+ ++ L+G  S DD +++ Y+W  D   P G   E++      P L L  L  G Y F+L+V D  G Q    +TLTV+ + N
Sbjct:  451 IQELSLPLTSALIDGSQSTDDAEIVSYHWEEVDGPFLGEAFLDDSPLLRLSNLDPGNYTFRLTITDSDGATNSTTAALIIRGSL----DYPPVANAGPNQTITLPQNTIILNGNQSSDDHQIVLYEWFPD---PGGESKEMVMQGAQTPYLHLSELQEGEYTFQLMVTDSSGQQSTALVTLTVQAENN 631          

HSP 3 Score: 56.9954 bits (136), Expect = 2.766e-7
Identity = 38/141 (26.95%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
             P   ++ L+ G Y F L+  D     S  + ++ + +   +N  P A AG +  ++ P  S  L G  S DD  ++ Y+W   +  P+ +E+   +V++    +  L  G Y F+L V D +GL     +T+ VK++ N+
Sbjct:  591 TPYLHLSELQEGEYTFQLMVTDSSGQQS--TALVTLTVQAENNQAPVAVAGPDKELVFPVQSAMLDGSRSSDDHGIVCYRW-EHIRGPSAVEM--ENVDKAIATVTGLQVGTYHFRLTVRDQQGLSSTSTLTVAVKKENNS 726          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Match: sp|Q5SZV5|K0319_MOUSE (Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.178e-38
Identity = 88/314 (28.03%), Postives = 164/314 (52.23%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYV 1122
            + W+ I GP  + + +    +A +T L++G Y F + + DQ   SS  +  + + +   +N  P+A AGG  V+ILP  S+ L G  S DDR ++ Y WI D  +PA  +++G S +   L L NL  G+Y F LLV D +G  D D  T+ V  D     ++E++L   ++  +    +    Q+ ++++     ++  +K+++++        +IVFY     ++ +  K++ +A+    L + +  +     +F V+++++  C   C  HG+CD  T++CIC   WM NL    +  D  ++C+ ++FYV
Sbjct:  667 YHWEHIRGPSAVEMENVDKAIATVTGLQVGIYHFRLTVRDQQGLSS--TSTLTVAVKKENNSPPRAQAGGRHVLILPNNSITLDGSRSTDDRGIVSYLWIRDGQSPAAGDVIGGSDHRAALQLTNLVEGVYTFHLLVTDSQGASDSDAATVEVLPDPKKDGLVELILQVGVEQLTEQQKETLVRQLAVLLNV----LDSDVKVLKIQAHTDVS-TVIVFY----VQSGSPFKVLRAAAVARNLHKRLSKEKEAFLLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYM-WDGESNCEWSVFYV 968          

HSP 2 Score: 75.8702 bits (185), Expect = 3.156e-13
Identity = 50/162 (30.86%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI---DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGL--EILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP          P+  ++NL  G Y F + I   D   NS+  S +I+    D+ +  P ANAG N  + LP+ ++ L+G  S DD +++ Y+W A    P G   E++      P L L  L  G Y F+L+V D  G Q    + +TV+ + N
Sbjct:  477 YHWEEVDGPFLGEEFPADTPILRLSNLVPGNYTFRLTITDSDGATNSTTASLVIR----DAVDYPPVANAGPNQTITLPQNTIILNGNQSSDDHQIVLYEWFA---GPGGESKEMVMQGAQTPYLHLSELQEGEYTFQLMVTDSSGQQSTALVAVTVQAENN 631          

HSP 3 Score: 59.3066 bits (142), Expect = 5.772e-8
Identity = 39/141 (27.66%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
             P   ++ L+ G Y F L+  D     S  + ++ + +   +N  P A AG +  ++ P  S  L G  S DD  ++ Y W   +  P+ +E+   +V++    +  L  GIY F+L V D +GL     +T+ VK++ N+
Sbjct:  591 TPYLHLSELQEGEYTFQLMVTDSSGQQS--TALVAVTVQAENNQAPVAVAGPDKELVFPVQSATLDGSRSSDDHGIVCYHW-EHIRGPSAVEM--ENVDKAIATVTGLQVGIYHFRLTVRDQQGLSSTSTLTVAVKKENNS 726          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Match: A0A1S3JFW5 (dyslexia-associated protein KIAA0319-like protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172557 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.217e-44
Identity = 92/301 (30.56%), Postives = 172/301 (57.14%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKD 1086
            ++WKQI GP+   ++ +   VA +TNL +G Y+F + +      + + R+ ++ + +  N  P A+AGG+ ++ +P + V+L G  S DDR +  Y W     + A  +IL  S + P L++ ++ PG Y F L V D +GL  +D  ++ +KED N+KN+++M L  ++  F   + +N  +Q+ L++ K++P  +  + I  +++D  TG  ++ F  +  +   T   L  + + ++K+L+  +  D ++  F VVQ++++ C  +C  HG CD  T++C+CD FWM N +   L+KD
Sbjct:  636 YQWKQIKGPNTADIIHEDQAVATVTNLVIGEYIFELVVADKEGLTGKDRL-KVLVQEKKNQPPVASAGGDQLLTMPVSLVKLDGSGSKDDRAIASYLWEKSEDSLAAGKILNGSDHMPVLLMTDMVPGHYMFTLTVTDQDGLSSKDAASVIIKEDENSKNLLQMYLDVDIAVFKEKNKQNLANQLALLLQKTLPGGDTTVDIRNIEQDMRTGQVIVTFL-VRSEFKDTH--LTHAGTKIVKILKQRLKSDADVLEFEVVQLDTLVCQNNCSGHGRCDSYTKQCVCDAFWMENFFKAALEKD 932          

HSP 2 Score: 73.9442 bits (180), Expect = 4.215e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  148 PGSNLIPSSNAK-------FKWKQIMGPHNLSVLSDTN-PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWI-ADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            P S ++  S +K       + W+++ GP   S   D++ P+  + NL  G Y F + +   ++    S    + +   ++ +P+ANAG   V+ LP+ S+ L G  S DD+ +  Y+WI AD    A ++     V  P L L NL  G Y F L V D  G  D   + + VK + N
Sbjct:  427 PNSAILDGSGSKDDDKIVSYYWEEVSGPLESSDFKDSDKPLLSLKNLSPGEYKFKLTVTD-SDGVTDSTYANVTVIKETDYRPQANAGSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQ----GVRTPFLHLSNLQEGDYTFTLKVTDTSGQTDTADVHVFVKPEHN 599          

HSP 3 Score: 70.0922 bits (170), Expect = 7.629e-9
Identity = 50/188 (26.60%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  100 ATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIY--DSSNIKPKANAGGNVVVILPR-TSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             + Q   LP   I L+  ++      A ++W +        +     P   ++NL+ G Y F +K+    ++S ++    ++++     N  P+ANAG +  V++P   S  L G  S DD+K+  YQW   +  P   +I+    ++    + NL  G Y F+L+V D EGL  +D++ + V+E +N
Sbjct:  513 GSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQGVRTPFLHLSNLQEGDYTFTLKV---TDTSGQTDTADVHVFVKPEHNQAPEANAGEDQTVMIPENQSTTLDGRKSTDDKKITSYQW-KQIKGPNTADIIHE--DQAVATVTNLVIGEYIFELVVADKEGLTGKDRLKVLVQEKKN 694          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Match: A0A1S3JF79 (dyslexia-associated protein KIAA0319-like protein isoform X4 OS=Lingula unguis OX=7574 GN=LOC106172557 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.516e-44
Identity = 92/301 (30.56%), Postives = 172/301 (57.14%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKD 1086
            ++WKQI GP+   ++ +   VA +TNL +G Y+F + +      + + R+ ++ + +  N  P A+AGG+ ++ +P + V+L G  S DDR +  Y W     + A  +IL  S + P L++ ++ PG Y F L V D +GL  +D  ++ +KED N+KN+++M L  ++  F   + +N  +Q+ L++ K++P  +  + I  +++D  TG  ++ F  +  +   T   L  + + ++K+L+  +  D ++  F VVQ++++ C  +C  HG CD  T++C+CD FWM N +   L+KD
Sbjct:  561 YQWKQIKGPNTADIIHEDQAVATVTNLVIGEYIFELVVADKEGLTGKDRL-KVLVQEKKNQPPVASAGGDQLLTMPVSLVKLDGSGSKDDRAIASYLWEKSEDSLAAGKILNGSDHMPVLLMTDMVPGHYMFTLTVTDQDGLSSKDAASVIIKEDENSKNLLQMYLDVDIAVFKEKNKQNLANQLALLLQKTLPGGDTTVDIRNIEQDMRTGQVIVTFL-VRSEFKDTH--LTHAGTKIVKILKQRLKSDADVLEFEVVQLDTLVCQNNCSGHGRCDSYTKQCVCDAFWMENFFKAALEKD 857          

HSP 2 Score: 73.9442 bits (180), Expect = 4.516e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  148 PGSNLIPSSNAK-------FKWKQIMGPHNLSVLSDTN-PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWI-ADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            P S ++  S +K       + W+++ GP   S   D++ P+  + NL  G Y F + +   ++    S    + +   ++ +P+ANAG   V+ LP+ S+ L G  S DD+ +  Y+WI AD    A ++     V  P L L NL  G Y F L V D  G  D   + + VK + N
Sbjct:  352 PNSAILDGSGSKDDDKIVSYYWEEVSGPLESSDFKDSDKPLLSLKNLSPGEYKFKLTVTD-SDGVTDSTYANVTVIKETDYRPQANAGSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQ----GVRTPFLHLSNLQEGDYTFTLKVTDTSGQTDTADVHVFVKPEHN 524          

HSP 3 Score: 69.3218 bits (168), Expect = 1.141e-8
Identity = 50/188 (26.60%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  100 ATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIY--DSSNIKPKANAGGNVVVILPR-TSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             + Q   LP   I L+  ++      A ++W +        +     P   ++NL+ G Y F +K+    ++S ++    ++++     N  P+ANAG +  V++P   S  L G  S DD+K+  YQW   +  P   +I+    ++    + NL  G Y F+L+V D EGL  +D++ + V+E +N
Sbjct:  438 GSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQGVRTPFLHLSNLQEGDYTFTLKV---TDTSGQTDTADVHVFVKPEHNQAPEANAGEDQTVMIPENQSTTLDGRKSTDDKKITSYQW-KQIKGPNTADIIHE--DQAVATVTNLVIGEYIFELVVADKEGLTGKDRLKVLVQEKKN 619          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Match: A0A1S3JEN1 (dyslexia-associated protein KIAA0319-like protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106172557 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.520e-44
Identity = 92/301 (30.56%), Postives = 172/301 (57.14%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKD 1086
            ++WKQI GP+   ++ +   VA +TNL +G Y+F + +      + + R+ ++ + +  N  P A+AGG+ ++ +P + V+L G  S DDR +  Y W     + A  +IL  S + P L++ ++ PG Y F L V D +GL  +D  ++ +KED N+KN+++M L  ++  F   + +N  +Q+ L++ K++P  +  + I  +++D  TG  ++ F  +  +   T   L  + + ++K+L+  +  D ++  F VVQ++++ C  +C  HG CD  T++C+CD FWM N +   L+KD
Sbjct:  583 YQWKQIKGPNTADIIHEDQAVATVTNLVIGEYIFELVVADKEGLTGKDRL-KVLVQEKKNQPPVASAGGDQLLTMPVSLVKLDGSGSKDDRAIASYLWEKSEDSLAAGKILNGSDHMPVLLMTDMVPGHYMFTLTVTDQDGLSSKDAASVIIKEDENSKNLLQMYLDVDIAVFKEKNKQNLANQLALLLQKTLPGGDTTVDIRNIEQDMRTGQVIVTFL-VRSEFKDTH--LTHAGTKIVKILKQRLKSDADVLEFEVVQLDTLVCQNNCSGHGRCDSYTKQCVCDAFWMENFFKAALEKD 879          

HSP 2 Score: 73.9442 bits (180), Expect = 4.209e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  148 PGSNLIPSSNAK-------FKWKQIMGPHNLSVLSDTN-PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWI-ADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            P S ++  S +K       + W+++ GP   S   D++ P+  + NL  G Y F + +   ++    S    + +   ++ +P+ANAG   V+ LP+ S+ L G  S DD+ +  Y+WI AD    A ++     V  P L L NL  G Y F L V D  G  D   + + VK + N
Sbjct:  374 PNSAILDGSGSKDDDKIVSYYWEEVSGPLESSDFKDSDKPLLSLKNLSPGEYKFKLTVTD-SDGVTDSTYANVTVIKETDYRPQANAGSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQ----GVRTPFLHLSNLQEGDYTFTLKVTDTSGQTDTADVHVFVKPEHN 546          

HSP 3 Score: 69.3218 bits (168), Expect = 1.072e-8
Identity = 50/188 (26.60%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  100 ATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIY--DSSNIKPKANAGGNVVVILPR-TSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             + Q   LP   I L+  ++      A ++W +        +     P   ++NL+ G Y F +K+    ++S ++    ++++     N  P+ANAG +  V++P   S  L G  S DD+K+  YQW   +  P   +I+    ++    + NL  G Y F+L+V D EGL  +D++ + V+E +N
Sbjct:  460 GSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQGVRTPFLHLSNLQEGDYTFTLKV---TDTSGQTDTADVHVFVKPEHNQAPEANAGEDQTVMIPENQSTTLDGRKSTDDKKITSYQW-KQIKGPNTADIIHE--DQAVATVTNLVIGEYIFELVVADKEGLTGKDRLKVLVQEKKN 641          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Match: A0A1S3JEE6 (dyslexia-associated protein KIAA0319-like protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172557 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 3.160e-44
Identity = 92/301 (30.56%), Postives = 172/301 (57.14%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKD 1086
            ++WKQI GP+   ++ +   VA +TNL +G Y+F + +      + + R+ ++ + +  N  P A+AGG+ ++ +P + V+L G  S DDR +  Y W     + A  +IL  S + P L++ ++ PG Y F L V D +GL  +D  ++ +KED N+KN+++M L  ++  F   + +N  +Q+ L++ K++P  +  + I  +++D  TG  ++ F  +  +   T   L  + + ++K+L+  +  D ++  F VVQ++++ C  +C  HG CD  T++C+CD FWM N +   L+KD
Sbjct:  650 YQWKQIKGPNTADIIHEDQAVATVTNLVIGEYIFELVVADKEGLTGKDRL-KVLVQEKKNQPPVASAGGDQLLTMPVSLVKLDGSGSKDDRAIASYLWEKSEDSLAAGKILNGSDHMPVLLMTDMVPGHYMFTLTVTDQDGLSSKDAASVIIKEDENSKNLLQMYLDVDIAVFKEKNKQNLANQLALLLQKTLPGGDTTVDIRNIEQDMRTGQVIVTFL-VRSEFKDTH--LTHAGTKIVKILKQRLKSDADVLEFEVVQLDTLVCQNNCSGHGRCDSYTKQCVCDAFWMENFFKAALEKD 946          

HSP 2 Score: 73.9442 bits (180), Expect = 4.503e-10
Identity = 53/178 (29.78%), Postives = 85/178 (47.75%), Query Frame = 1
Query:  148 PGSNLIPSSNAK-------FKWKQIMGPHNLSVLSDTN-PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWI-ADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            P S ++  S +K       + W+++ GP   S   D++ P+  + NL  G Y F + +   ++    S    + +   ++ +P+ANAG   V+ LP+ S+ L G  S DD+ +  Y+WI AD    A ++     V  P L L NL  G Y F L V D  G  D   + + VK + N
Sbjct:  441 PNSAILDGSGSKDDDKIVSYYWEEVSGPLESSDFKDSDKPLLSLKNLSPGEYKFKLTVTD-SDGVTDSTYANVTVIKETDYRPQANAGSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQ----GVRTPFLHLSNLQEGDYTFTLKVTDTSGQTDTADVHVFVKPEHN 613          

HSP 3 Score: 69.707 bits (169), Expect = 9.449e-9
Identity = 50/188 (26.60%), Postives = 91/188 (48.40%), Query Frame = 1
Query:  100 ATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIY--DSSNIKPKANAGGNVVVILPR-TSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             + Q   LP   I L+  ++      A ++W +        +     P   ++NL+ G Y F +K+    ++S ++    ++++     N  P+ANAG +  V++P   S  L G  S DD+K+  YQW   +  P   +I+    ++    + NL  G Y F+L+V D EGL  +D++ + V+E +N
Sbjct:  527 GSTQVISLPKNSITLYGNASSDDKGIASYEWIKADDKLTADMQGVRTPFLHLSNLQEGDYTFTLKV---TDTSGQTDTADVHVFVKPEHNQAPEANAGEDQTVMIPENQSTTLDGRKSTDDKKITSYQW-KQIKGPNTADIIHE--DQAVATVTNLVIGEYIFELVVADKEGLTGKDRLKVLVQEKKN 708          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Match: A0A4X2JYU3 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=KIAA0319L PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 4.734e-44
Identity = 104/349 (29.80%), Postives = 176/349 (50.43%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP++   L    +L       + W++  GP  + + +  N +A +T L++G Y+F + +    N   +S +  I + +  N  P A   GNVV+ LP  + +L G  S DD+ ++ Y W  D  +PA  E+L +S + P L L NL  G Y F L V D +G  D D+ T+ VK D    N++EM+L  N+   +      F  Q+ +++     +I +Q      K  P T  +  + + + ++        IF    +  +L+  +      F+ F  ++IN++ C  +C +HG+CD  T++CICDPFWM N   + L KD  ++C+ +I YVI    +II+ L +L
Sbjct:  680 LPVDSTTLDGSKSLDDQKIISYLWEKTQGPDGVRLENANNSIATVTGLQVGTYIFTLTVKDERNLQSQSSVSVI-VKEEMNKPPVAKIIGNVVITLPTNTAELDGSRSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLRVTDAKGESDTDRTTVDVKPDPRKNNLVEMILDVNVSQLTERQKGMFIRQIGVLLGVLDSDITVQ------KIQPYTEQSTKMVFFVQNEPPHQ----IFKGHDVAAMLKSELRKQQTDFLIFRALEINTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQL-KDGESNCEWSILYVIIASFVIIVALGIL 1016          

HSP 2 Score: 72.4034 bits (176), Expect = 1.140e-9
Identity = 47/159 (29.56%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            ++ W+++ GP     +S+   +  +TNL  G Y F L  +D F  SS  S    + +  + +  P ANAG N V+ LP+ S+ L G  S DD  +  Y+W     +  G  +    V  P L L  +  G Y ++L V D  G Q   ++ + V+ + N
Sbjct:  510 RYHWEELKGPLREEKVSEDTAILKLTNLVPGNYTFSLTVVDSFGASS--SATASLTVNKAVDYPPVANAGPNQVITLPQNSITLYGNQSTDDHGIASYEWSLSPSS-KGKVVDMQGVRTPALQLSAMQEGDYTYQLTVTDTAGHQATTEVIVIVQPENN 665          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:103041131])

HSP 1 Score: 133.265 bits (334), Expect = 6.736e-33
Identity = 85/331 (25.68%), Postives = 158/331 (47.73%), Query Frame = 1
Query:  178 AKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI-DQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDIN-IFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            A + W+Q  GP  + + +  + VA +T L+ G Y+F++ + D+ N  S  S  + +   +  +  P A    +  + LP  +  L G  S DD+  + Y W  D  +PA  ++L NS ++  L L NL  G Y F L V D +G    D  T+ V+ D   ++++E++L   +   SH        QV +++   + + ++ ++ +    +  T L  +V  G          +   S   +   LR  +    N  F+F   +++++ C  +C  HG CD  TR+C+C PFWM N     L +D+ ++C+ ++ YV     +I++ +  +
Sbjct:  559 ATYHWEQTKGPEGVKIENADSAVATVTGLQDGTYIFMLTVTDERNLHS--SDTVTVTAREEVDQPPVARVQSSPSITLPVRTAVLDGSRSSDDKGSISYVWTRDGSSPAAGDVLNNSDHQAVLFLGNLVEGKYTFTLTVTDSKGQSHADTGTVEVRPDIWERDLVELVLEVTVSQVSHRQRDMLLRQVGVLL--GVLDSDIIVREIGAFNEHSTRLVFLVSGGPG--------RPPLSGHGVATSLRNKLHKSKNEFFIFKAQRVDTVICQLNCSGHGECDSFTRRCVCHPFWMENFIRTQL-QDAESNCEWSVLYVTIASFMIVVAIAAV 876          

HSP 2 Score: 78.1814 bits (191), Expect = 6.662e-15
Identity = 47/157 (29.94%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP     +S    V  +T+L  G Y F + +   + +   ++ + +++  + + +P ANAG N V+ LPR SV L G  S DD + L Y+W     +  G  +    V  P L L  +  G Y F+L V D  G QD  ++T+ V+ + N
Sbjct:  371 WHWEEVKGPLREEKVSADTAVLTLTSLVPGNYTFSLTVTDSDGAQSSTQAM-LSVNKAMDYRPVANAGANQVITLPRNSVTLYGNQSTDDHEPLAYEWSLSPES-KGKVVEMQGVRTPTLQLSAMQEGDYTFQLTVTDSSGQQDTAQVTVIVQPENN 525          

HSP 3 Score: 53.9138 bits (128), Expect = 2.751e-7
Identity = 37/139 (26.62%), Postives = 62/139 (44.60%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINI--YDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKED 648
             P   ++ ++ G Y F + +    +SS +    Q+ +     +N  P A+AG +  + LP     L G  S DD+K+  Y W      P G++I   + +     +  L  G Y F L V D   L   D +T+T +E+
Sbjct:  485 TPTLQLSAMQEGDYTFQLTV---TDSSGQQDTAQVTVIVQPENNKPPVADAGPDKELTLPVDHTTLDGSKSTDDQKIATYHW-EQTKGPEGVKI--ENADSAVATVTGLQDGTYIFMLTVTDERNLHSSDTVTVTAREE 617          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 102.834 bits (255), Expect = 8.093e-23
Identity = 81/342 (23.68%), Postives = 156/342 (45.61%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHH-DRTQTRRKLIFSASSLIKLLRPVILDDINIF-MFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIII----TLFLLCRYILHIKI 1191
            ++W+ + GP    +      VA++T L+ G +   + + Q       S +I + + ++ ++   A+A G+  + LP  S+ L G  S      + Y W+ D  +PA  ++L  S +E  L L NL  G Y F+L V D +G       T+ V+ D   +  +E+ L   +   S         Q+  ++   + + ++ +K +  + D    ++ +  + +   D T            L ++LR  +L +   F +F V++++++ C   C   G CD  +R C CDP WM N +   LD D+ ++CD ++ YV     +++I    T +  C+     K+
Sbjct:  643 YQWEILSGPPGSKIKDADKAVAMVTGLRAGSHKIKLTV-QDQQGEADSAVITVTVTEAKSLPLIAHASGSHTLTLPNNSLVLRGSASNCGSVNVSYLWVRDEQSPAAGDVLYGSDHEAFLYLANLVEGTYLFRLRVADSQGRSSSATATVEVRPDLREREEVELELQVAVAQVSQQQKDTVVRQLAALL--HVMDTDIALKGLHGQSD----ISTVFRFSVQGPDGT-------IPGPKLARILRFQLLKEKTDFLLFKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLD-DNESNCDWSVLYVTICCLVVVIFLVSTSWAWCKRGRRTKV 969          

HSP 2 Score: 62.7734 bits (151), Expect = 4.723e-10
Identity = 54/201 (26.87%), Postives = 97/201 (48.26%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHD 855
            ++ L+ G Y FL+ +   ++S   S  + + +    N  P A AG +  ++LP +SV L+G +S DD+ +  YQW   +  P G +I     ++   ++  L  G +K KL V+D +G  D   +T+TV E ++   +I     ++     +NSL      V    + +  ++N+    VR ++ P  G    V YG  H+
Sbjct:  573 LSELQEGQYTFLLTVTD-SSSQQDSDTVVVTVL-PENRAPVAVAGPDRQLLLPTSSVMLNGTDSSDDQAITNYQWEI-LSGPPGSKI--KDADKAVAMVTGLRAGSHKIKLTVQDQQGEADSAVITVTVTEAKSLP-LIAHASGSHTLTLPNNSL------VLRGSASNCGSVNVSYLWVRDEQSPAAG---DVLYGSDHE 758          

HSP 3 Score: 49.2914 bits (116), Expect = 8.976e-6
Identity = 41/158 (25.95%), Postives = 62/158 (39.24%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
            + W+Q+ GP   S      PV  + N+  G Y F + +      +  S    + +    +  P A AG + V+ LP   + L    S DD  +  Y W     + A    +   +    L L  L  G Y F L V D    QD D + +TV  +  A
Sbjct:  454 YLWEQVDGPLWKSEAPMDTPVLRLQNITAGEYTFRLTVTDPEGLT-DSSTATLTVSSPKDNPPVARAGSDQVITLPLNHLTLWANQSTDDLAITGYLWSLQSSSSAKAATM-RGIRSLALQLSELQEGQYTFLLTVTDSSSQQDSDTVVVTVLPENRA 609          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 102.834 bits (255), Expect = 8.093e-23
Identity = 81/342 (23.68%), Postives = 156/342 (45.61%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHH-DRTQTRRKLIFSASSLIKLLRPVILDDINIF-MFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIII----TLFLLCRYILHIKI 1191
            ++W+ + GP    +      VA++T L+ G +   + + Q       S +I + + ++ ++   A+A G+  + LP  S+ L G  S      + Y W+ D  +PA  ++L  S +E  L L NL  G Y F+L V D +G       T+ V+ D   +  +E+ L   +   S         Q+  ++   + + ++ +K +  + D    ++ +  + +   D T            L ++LR  +L +   F +F V++++++ C   C   G CD  +R C CDP WM N +   LD D+ ++CD ++ YV     +++I    T +  C+     K+
Sbjct:  643 YQWEILSGPPGSKIKDADKAVAMVTGLRAGSHKIKLTV-QDQQGEADSAVITVTVTEAKSLPLIAHASGSHTLTLPNNSLVLRGSASNCGSVNVSYLWVRDEQSPAAGDVLYGSDHEAFLYLANLVEGTYLFRLRVADSQGRSSSATATVEVRPDLREREEVELELQVAVAQVSQQQKDTVVRQLAALL--HVMDTDIALKGLHGQSD----ISTVFRFSVQGPDGT-------IPGPKLARILRFQLLKEKTDFLLFKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLD-DNESNCDWSVLYVTICCLVVVIFLVSTSWAWCKRGRRTKV 969          

HSP 2 Score: 62.7734 bits (151), Expect = 4.723e-10
Identity = 54/201 (26.87%), Postives = 97/201 (48.26%), Query Frame = 1
Query:  253 ITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHD 855
            ++ L+ G Y FL+ +   ++S   S  + + +    N  P A AG +  ++LP +SV L+G +S DD+ +  YQW   +  P G +I     ++   ++  L  G +K KL V+D +G  D   +T+TV E ++   +I     ++     +NSL      V    + +  ++N+    VR ++ P  G    V YG  H+
Sbjct:  573 LSELQEGQYTFLLTVTD-SSSQQDSDTVVVTVL-PENRAPVAVAGPDRQLLLPTSSVMLNGTDSSDDQAITNYQWEI-LSGPPGSKI--KDADKAVAMVTGLRAGSHKIKLTVQDQQGEADSAVITVTVTEAKSLP-LIAHASGSHTLTLPNNSL------VLRGSASNCGSVNVSYLWVRDEQSPAAG---DVLYGSDHE 758          

HSP 3 Score: 49.2914 bits (116), Expect = 8.976e-6
Identity = 41/158 (25.95%), Postives = 62/158 (39.24%), Query Frame = 1
Query:  184 FKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNA 657
            + W+Q+ GP   S      PV  + N+  G Y F + +      +  S    + +    +  P A AG + V+ LP   + L    S DD  +  Y W     + A    +   +    L L  L  G Y F L V D    QD D + +TV  +  A
Sbjct:  454 YLWEQVDGPLWKSEAPMDTPVLRLQNITAGEYTFRLTVTDPEGLT-DSSTATLTVSSPKDNPPVARAGSDQVITLPLNHLTLWANQSTDDLAITGYLWSLQSSSSAKAATM-RGIRSLALQLSELQEGQYTFLLTVTDSSSQQDSDTVVVTVLPENRA 609          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Match: spint1b (kunitz-type protease inhibitor 1-like [Source:NCBI gene;Acc:103024868])

HSP 1 Score: 55.8398 bits (133), Expect = 5.735e-8
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  214 NLSVLSDTNPVAVITNLKMGFYVFLVK-IDQFNNSSLRSRIIQINIYD----------SSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            NL+++        ITN  +   V+  K + +F  ++  S  I+  +YD            + +P ANAG + VV  P   V L+G+ S+DD+K++ Y+W     N + L  +  +      +L NL PG Y+F+L V D  G  D   +T+ V
Sbjct:   76 NLALVERAEEQDSITNCFLFDCVYRNKYVCRFVKTTGFSNYIRTTVYDHHLGGPPGAGEEDRQPIANAGPDEVV-RPGQKVTLNGIESWDDKKIVSYEWKQTKGNHSVL--IEKATYSDQRVLSNLYPGFYEFQLKVTDSAGQSDSTSVTVLV 225          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 [Source:NCBI gene;Acc:103032340])

HSP 1 Score: 51.9878 bits (123), Expect = 9.500e-7
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  265 KMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            K GF  +L+     N+   RS +   +I  +   KP     G   VI P   V L+G+ S DD K++ ++W     NP+   ++  S     + +  L+ G+YKF+L V D  G  D  ++T+ V
Sbjct:  112 KTGFKNYLL-----NSGVFRSYLQ--DIPSTQEDKPPKAKAGQDRVIQPNEVVTLNGIESKDDHKIVDFKWTLVSGNPSA--VIEKSHFPDQVTVSKLTAGVYKFRLTVTDNVGQSDSTEITVLV 227          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Sea Lamprey
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 156.377 bits (394), Expect = 1.003e-41
Identity = 98/332 (29.52%), Postives = 169/332 (50.90%), Query Frame = 1
Query:  178 AKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVI-LDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLC 1167
            A + W++I GP  + +      VA ++ L++G YVF L  +D    SS  S  + + + + +N  P A AGGN V++LP  +V L G  S+DD+  L Y+W  D  +PA   +L  S + P L L NL  G Y F+L V D +G   +D  T+ VK D  +  ++E++L   +        +    Q+ +++S    +I++Q    RL+    +   L VFY +       +  +I+    + ++LR ++  +  N+  F  +++++  C  +C  HG CD  T++C C PFWM N+    L  D  ++CD ++ YV      + +T+ LL 
Sbjct:  327 ASYHWEKISGPPGVRLDHGDEAVATVSELQVGTYVFSLTVLDAKGLSS--SASVTVTVKEENNKPPHATAGGNKVLLLPDDTVMLDGSRSWDDQGSLSYEWTRDGSSPAAGVVLNGSEHHPVLWLTNLVEGTYVFRLRVTDNKGESSQDMATVEVKPDPKSSQLVELVLDVPVSQLQQQQKELLIRQLSVLLSVQDSDIHVQ----RLQAYTQSSTQL-VFYVLTE-----QPNMIYKGVDVARMLRRLLQREKTNLLAFRTLRVDTFVCQLACSGHGRCDSFTKRCTCFPFWMENVIRTQL-GDGESNCDWSVLYVTLTTFAVAVTVGLLA 645          

HSP 2 Score: 68.9366 bits (167), Expect = 1.005e-12
Identity = 52/168 (30.95%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  178 AKFKWKQIMGP-HNLSVLSDTN-PVAVITNLKMGFYVF-LVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIE 672
            A ++W+QI GP H   V   TN P+  +++L  G Y F L  +D    S+  +  + +N   + +  P ANAG N  + LPR  V L+G  S DD  ++ Y+W     N  G  +    V  P L L ++  G Y F+L V D    Q   ++T+ ++ + N   + E
Sbjct:  138 ASYRWEQIRGPLHEERV---TNLPILHLSSLVAGSYTFRLTVVDSDGVSNWTTANVTVN--KAVDYPPVANAGPNQAITLPRNFVTLNGNQSSDDHGIVSYEWTLG-SNTKGKVLEMQGVRTPYLQLSSMQEGDYTFQLTVTDAAEQQSTAEVTVVIQPENNRPPVAE 299          

HSP 3 Score: 55.8398 bits (133), Expect = 1.270e-8
Identity = 37/139 (26.62%), Postives = 63/139 (45.32%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
             P   +++++ G Y F + +         + +  + I   +N  P A AG +  + +P  S  L G  S DD+ +  Y W   +  P G+ +  +  +E    +  L  G Y F L V D +GL     +T+TVKE+ N
Sbjct:  253 TPYLQLSSMQEGDYTFQLTVTDAAEQQSTAEVTVV-IQPENNRPPVAEAGPDKELTIPVDSTSLDGSKSTDDQGIASYHW-EKISGPPGVRL--DHGDEAVATVSELQVGTYVFSLTVLDAKGLSSSASVTVTVKEENN 387          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Nematostella
Match: EDO42871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H0])

HSP 1 Score: 155.992 bits (393), Expect = 2.342e-41
Identity = 93/341 (27.27%), Postives = 170/341 (49.85%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSA---SSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFY--------VISVGSIIIITLFLLCR 1170
            K+ W Q+ GP +  +    N V  +  L  G YVF + +   +     S  + +N+    N  P A AG +VVV LP  + +L G  S DD  + +Y W  D  +PA  +++ +S ++  L L NL  G+YKFKL V D +GL+  D+  LTVKED ++ +++E+ L  ++  F+  +      ++ +I+     ++  +  +V   ++  TG +++V + +         K +  A    ++ + L+  I ++   F F ++++    C  +C  HGYCD  T+ C+C+ FWM +++         ++CD +I Y        V+++G II    F + R
Sbjct:  328 KYHWDQVSGPSSAEMSGADNQVVEVKKLTEGHYVFKLTVTD-DKGLTGSGTVAVNVKKDVNQAPVARAGPDVVVHLPNRAAELDGSKSSDDHGIAQYLWTRDAKSPAAGDVINSSNHQAILRLSNLVEGMYKFKLTVLDAKGLKSSDEALLTVKEDEHSAHLVELFLDVDITKFTEENKGQLIRKLAVIL-----DVQDEEIVVEHLKEAGTGHSMMVMFYV---------KAVGGAKDGQAVAETLKEKIENEEGFFEFRMLKVEPYICRNNCSFHGYCDRSTKLCVCESFWMQDIFKSSFGAKE-SNCDWSILYVTVIIFGIVMAIGGIIWGICFCMGR 652          

HSP 2 Score: 75.8702 bits (185), Expect = 1.257e-14
Identity = 51/181 (28.18%), Postives = 87/181 (48.07%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTN-PVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILG--NSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            LP+  + L+  S+      A ++W +      +  +  TN P   ++N+ +G Y F++K+      S  SR+  + +    N  P A AG +  ++ P  +  L    S+DD+K+++Y W   V  P+  E+ G  N V E    +  L+ G Y FKL V D +GL     + + VK+D N
Sbjct:  213 LPVNHVVLYGNSSTDDKGIASYEWSKTPSSPAVGDMQGTNSPQLKVSNMVLGDYTFVLKVTDTGGQSATSRVTVV-VQPEKNTPPVAKAGSDKDLVYPDDTTTLDAKGSYDDQKIVKYHW-DQVSGPSSAEMSGADNQVVE----VKKLTEGHYVFKLTVTDDKGLTGSGTVAVNVKKDVN 387          

HSP 3 Score: 73.9442 bits (180), Expect = 5.156e-14
Identity = 51/187 (27.27%), Postives = 91/187 (48.66%), Query Frame = 1
Query:  109 QSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHN-----LSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            Q+  LP  ++ L    +       ++KW+++ GP N     +S  +D+ PV  + +L  G Y F + +   +  +  +  + + + D  +  P A AG +VV+ LP   V L G +S DD+ +  Y+W     +PA  ++ G   N P L + N+  G Y F L V D  G     ++T+ V+ ++N
Sbjct:  111 QTITLPTNEVVLDGSKSTDDDKIVEYKWEEMKGPLNDKNKMISQGADS-PVLQLKSLVPGIYTFKLTVSDSDGETDSTTAV-VTVNDEKDYPPVARAGNDVVLTLPVNHVVLYGNSSTDDKGIASYEWSKTPSSPAVGDMQG--TNSPQLKVSNMVLGDYTFVLKVTDTGGQSATSRVTVVVQPEKN 293          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:101168634])

HSP 1 Score: 135.191 bits (339), Expect = 1.672e-33
Identity = 91/354 (25.71%), Postives = 167/354 (47.18%), Query Frame = 1
Query:  121 LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSK-----SIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLL 1164
            LP+++  L    +      A ++W +  GP  + + +  + +A +T L++G Y F++ +    N    S  + + + +  +  P A    +  + LP  +  L G +S DD   L Y W  D  +PA  E+L NS ++  L L NL  G Y+FKL V D +G    D  T+ VK D   K+++E++L   +          FQ Q  L++ +      + + ++ ++ +    +  T L  +V  G          +   S  S+   LR  +    N F+ F   ++++I C  +C  HG CD  +R+C+C PFWM N + + L+ D+ ++C+ ++ YV     +I++    L
Sbjct:  521 LPVDRTTLDGSKSSDDQRIATYRWTKTSGPDGVKIENADSAIATVTGLEVGTYTFMLTVTDDRNLE-NSDTVTVIVREEKDQPPVARVISSPPISLPVRTASLDGSHSTDDEGGLSYLWTRDDSSPAAGEVLNNSDHQAVLFLGNLVEGKYRFKLTVTDSKGQSSSDSGTVEVKADPWEKDLVELVLEVPVSQV-------FQRQRDLLLRQVEVLLGVLDGDIIVREITAFNEHSTRLVFLVSAGPG--------RPPLSGRSVALGLRNKLRKQKNDFLIFKARRVDTIVCQLNCSGHGECDPFSRRCVCHPFWMENFFRVQLE-DAESNCEWSVLYVTIASFMIVVATATL 857          

HSP 2 Score: 73.1738 bits (178), Expect = 2.520e-13
Identity = 50/159 (31.45%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  184 FKWKQIMGP-HNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQW-IADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRN 654
            + W+++ GP     VL+DT  +  +TNL  G Y F + +   + ++  S    +++  + + +P +NAG N V+ LPR S+ L G  S DD   L Y+W ++       +E+ G  V  P L L  +  G Y F+L V D  G QD   +T+ V+ + N
Sbjct:  352 WHWEEVKGPLREEKVLADTK-ILTLTNLVPGNYTFSLTVTDTDGAT-NSTQATLSVNKAKDYRPISNAGPNQVIQLPRNSITLYGNQSTDDHDSLSYEWSLSPESKDKVVEMQG--VRTPILQLSAMQEGDYTFQLTVTDSSGQQDTSHVTVIVQPENN 506          

HSP 3 Score: 56.6102 bits (135), Expect = 4.465e-8
Identity = 37/149 (24.83%), Postives = 69/149 (46.31%), Query Frame = 1
Query:  238 NPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLS 684
             P+  ++ ++ G Y F + +   +     S +  I +   +N  P ANAG    + LP     L G  S DD+++  Y+W      P G++I   + +     +  L  G Y F L V D   L++ D +T+ V+E+++   +  ++ S
Sbjct:  466 TPILQLSAMQEGDYTFQLTVTDSSGQQDTSHVTVI-VQPENNKAPVANAGPEKELTLPVDRTTLDGSKSSDDQRIATYRWTK-TSGPDGVKI--ENADSAIATVTGLEVGTYTFMLTVTDDRNLENSDTVTVIVREEKDQPPVARVISS 610          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 96.2857 bits (238), Expect = 8.217e-21
Identity = 78/350 (22.29%), Postives = 145/350 (41.43%), Query Frame = 1
Query:  178 AKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPA----GLE-------------------------------------ILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASC 1101
            + F+W+ + GP    + +    VA +T+++ G YVF + +      +  S  + + + ++S+  P A+A G+  + LP  S+ L G  S  D+  + + W  D  +PA    G E                                     +L  S  +P+L L +L  G Y F+L V D +G       T+ V+ +      +E+ +   +   S         Q+  ++   +PN ++ ++        L G + ++ + +              A  L+ LLR  +L   + ++ F  ++++++ C  SC   G CD  TR+C CDPFW  NL    L  D  ++C
Sbjct:  305 SSFRWEAVSGPPGFLLQNADRAVATVTSVQPGRYVFRLTVSD-QEGATDSASLTVRVQEASSPPPVAHASGSHTLTLPNNSLVLRGSVSDGDQSRVHFLWTRDPQSPAAGVSGAEQNMRHLGRNRNSEEQRLLYSQDGYPSFRRNASALLQVVLFGSRTQPSLFLADLVEGTYLFQLKVTDAQGRSSVAMATVEVRPEPAGGEQVELEMLVPVSQVSVLQRDTVVQQLAALIR--VPNSDVHVRA-------LEGRSTVLRFSVGG------LSGPVPAPRLVALLRTHLLRQRSSYLLFRALRVDAVVCFLSCSGRGQCDPITRQCGCDPFWTENLVRRYL-GDGESNC 637          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 84.3445 bits (207), Expect = 6.835e-17
Identity = 60/237 (25.32%), Postives = 107/237 (45.15%), Query Frame = 1
Query:  355 SSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFM-FPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNL 1062
            +S+  P A+A G+  + LP  S+ L G  S  D+  + + W  D  +PA        V+ P+L L +L  G Y F+L V D +G       T+ V+ +      +E+ +   +   S         Q+  ++   +PN ++ ++        L G + ++ + +              A  L+ LLR  +L   + ++ F  ++++++ C  SC   G CD  TR+C CDPFW  NL
Sbjct:  393 ASSPPPVAHASGSHTLTLPNNSLVLRGSVSDGDQSRVHFLWTRDPQSPAA------GVSGPSLFLADLVEGTYLFQLKVTDAQGRSSVAMATVEVRPEPAGGEQVELEMLVPVSQVSVLQRDTVVQQLAALIR--VPNSDVHVRA-------LEGRSTVLRFSVGG------LSGPVPAPRLVALLRTHLLRQRSSYLLFRALRVDAVVCFLSCSGRGQCDPITRQCGCDPFWTENL 608          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 69.3218 bits (168), Expect = 2.103e-12
Identity = 60/256 (23.44%), Postives = 103/256 (40.23%), Query Frame = 1
Query:  355 SSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYV 1122
            +S+  P A+A G+  + LP  S+ L G  S  D+  + + W  D  +PA   +L  S  +P+L L +L  G Y F+L V D +G       T+ V+        + +   T  Q      ++   + +       +PN ++ ++   L+   + GL+  V    H                            +++   P+  +    C  SC   G CD  TR+C CDPFW  NL    L  D  ++C   + ++
Sbjct:  122 ASSPPPVAHASGSHTLTLPNNSLVLRGSVSDGDQSRVHFLWTRDPQSPAAGVVLFGSRTQPSLFLADLVEGTYLFQLKVTDAQGRSSVAMATVEVR-----PGGLTLQHRTGQQRRRDTVVQQLAALIR------VPNSDVHVRA--LEGRSVGGLSGPVPSLKHEG------------------------GGLHVQPLPLWSV----CFLSCSGRGQCDPITRQCGCDPFWTENLVRRYLG-DGESNCGKTVLHL 335          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Match: spint1a (serine peptidase inhibitor, Kunitz type 1 [Source:NCBI gene;Acc:101173105])

HSP 1 Score: 48.9062 bits (115), Expect = 8.365e-6
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  265 KMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTV 639
            + GF  ++ K    +  S+  R  +++        P+ANAG ++VV  P  +V L+G  S DD  +  +QW      P  +    N  ++  L++ NL+ G YKFKL V D  G  D   +T+ V
Sbjct:  114 QQGFTSYITKSVYTSYISVEPRPTKVDT------PPEANAGFDLVV-QPGETVTLNGFQSKDDHTIKSFQWDMITEYPHAVLTKTNLPDQ--LLVSNLTSGRYKFKLTVTDSIGQTDSTVLTVLV 229          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 377/380 (99.21%), Postives = 378/380 (99.47%), Query Frame = 1
Query:   88 KFEFATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 1227
            KFEFATLQSY+LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLIL NLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSH SLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE
Sbjct:   20 KFEFATLQSYYLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 399          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 348/380 (91.58%), Postives = 349/380 (91.84%), Query Frame = 1
Query:   88 KFEFATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 1227
            KFEFATLQSY+LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLIL NLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSH SLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLT   L                          LLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE
Sbjct:   20 KFEFATLQSYYLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTVPLLCSM-----------------------LLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 376          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 349/380 (91.84%), Postives = 352/380 (92.63%), Query Frame = 1
Query:   88 KFEFATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 1227
            KFEFATLQSY+LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLIL NLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSH SLKNFQ+Q   I   S  +                  ALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE
Sbjct:   20 KFEFATLQSYYLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQNQNCPIEKGSFDS------------------ALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 381          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 304/380 (80.00%), Postives = 310/380 (81.58%), Query Frame = 1
Query:   88 KFEFATLQSYHLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 1227
            KFEFATLQSY+LPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLIL NLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSH   K F          S+PN                                   + I+S   L     P+     +      VQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE
Sbjct:   20 KFEFATLQSYYLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHK--KKFSES-------SLPNC----------------------------------QQIYSKYQLADQNCPIEKGSFDRSCPYFVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE 356          

HSP 2 Score: 68.1662 bits (165), Expect = 3.400e-12
Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 3
Query:  738 LPNCQQIYSKYQLADQNCPIEKGSFDRPCPHCV 836
            LPNCQQIYSKYQLADQNCPIEKGSFDR CP+ V
Sbjct:  235 LPNCQQIYSKYQLADQNCPIEKGSFDRSCPYFV 267          
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Match: SMESG000079575.1 (SMESG000079575.1)

HSP 1 Score: 123.635 bits (309), Expect = 7.957e-30
Identity = 94/348 (27.01%), Postives = 172/348 (49.43%), Query Frame = 1
Query:  181 KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANA-GGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQIKI--VRLKRDPLTGLALIVFYGIHHDRTQTR-----RKLIFSASSLIKLLRPVILDDIN-------------------------IFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLDKDSMASCDCNIFYVI 1125
            K++W+Q  G   L+++    P+A + +LK+G + F + +   ++    S I+ + + ++ N KPKA     + V  L    +++ G  S+DD K+++YQWI +  + A  +IL  S +E  L+L  L PG+YKFKL+V D EGL D    +L V   +     +E+     L++F+ +    F + + LI+ K + + + ++KI  ++L+  P T    I+FY   H+R+ +      +  + + +SL K +    ++D                           +  FP++++ +  C  +C  HG C+  TR C CD FW N+L       D   +CD +I Y++
Sbjct:  463 KYQWEQTSGQQKLNIVDGDKPIAFVNDLKIGSFQFRLTV-WDSDKQAGSDIVTLKVNENQNQKPKATVVESSEVYYLQPDLIKIDGSKSWDDHKIVKYQWIREDDSLAVGDILEKSYSESVLLLTGLLPGLYKFKLIVYDEEGLYDSAITSLQVFPSKLENYFLELQFQCPLKSFTESKKNIFINNLQLIIQKHVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNENSLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFG-DGRPNCDWSIIYLV 808          

HSP 2 Score: 59.6918 bits (143), Expect = 3.636e-9
Identity = 50/200 (25.00%), Postives = 92/200 (46.00%), Query Frame = 1
Query:  118 HLPLEKIYLHPGSNLIPSSNAKFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKI----DQFNNSSLRSRIIQINIYDSSNIKPKANAG----GNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMTLTVKEDRNAKNMIEMLLSTNL 693
            +LP+    L+   +        ++W ++       +     P+  ++NL+ G Y F +K+    DQ +N     + +++ +    N+ P A A     G V V LP T   L+G  S DD K+++YQW         L I+    ++P   + +L  G ++F+L V D +     D +TL V E++N K    ++ S+ +
Sbjct:  344 NLPVNSAILNGSGSTDDKKIVSYEWSKVSDGLTADIQGVREPILKLSNLQEGTYTFNLKVTDSADQVSN-----KEVKVYVKPRVNVPPVAKASTTPDGIVTVRLPATEAVLNGSLSSDDDKIVKYQW-EQTSGQQKLNIVDG--DKPIAFVNDLKIGSFQFRLTVWDSDKQAGSDIVTLKVNENQNQKPKATVVESSEV 535          

HSP 3 Score: 58.151 bits (139), Expect = 9.605e-9
Identity = 42/140 (30.00%), Postives = 69/140 (49.29%), Query Frame = 1
Query:  184 FKWKQIMGP-HNLSVLSDTNPVAVI-TNLKMGFYVFLVKIDQFNNSSLRSRIIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWIADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVED 597
            + W+ I GP    +++ D  P+  +   +  G Y F + +    +  L   I  + +    +  PK++ G N+++ LP  S  L+G  S DD+K++ Y+W + V +    +I G  V EP L L NL  G Y F L V D
Sbjct:  270 YHWEIIQGPIVKENIMKDDQPMLQLDKTITQGNYTFKLTVKD-TSGQLNFTIANLIVLPEKDYPPKSDPGPNMILNLPVNSAILNGSGSTDDKKIVSYEW-SKVSDGLTADIQG--VREPILKLSNLQEGTYTFNLKVTD 405          
The following BLAST results are available for this feature:
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L3.785e-4628.96KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA0319L3.072e-4428.53KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA0319L3.073e-4428.53KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA03191.945e-3926.80KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
KIAA03191.782e-3727.27KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG75651.962e-3930.32gene:FBgn0035833 transcript:FBtr0076738[more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-193k19.11.219e-2924.21si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
CT485618.15.761e-2924.51pep chromosome:GRCz11:CHR_ALT_CTG16_1_18:36918990:... [more]
si:ch211-193k19.16.564e-2824.25si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
si:ch73-215d9.14.354e-2623.82si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
si:ch73-215d9.15.217e-2623.82si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L1.233e-4229.51kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L1.666e-4229.51kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L1.716e-4229.51kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L1.800e-4229.51kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L2.044e-4229.51kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AU0403201.354e-4428.96expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403201.773e-4428.96expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403201.773e-4428.96expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
D130043K22Rik8.833e-3928.03RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:... [more]
D130043K22Rik8.059e-1430.86RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K135|K319L_MOUSE9.472e-4428.96Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q5RFR6|K319L_PONAB1.022e-4328.53Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q8IZA0|K319L_HUMAN1.475e-4328.53Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|P0CI71|K0319_RAT1.942e-3827.86Dyslexia-associated protein KIAA0319 homolog OS=Ra... [more]
sp|Q5SZV5|K0319_MOUSE6.178e-3828.03Dyslexia-associated protein KIAA0319 homolog OS=Mu... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JFW52.217e-4430.56dyslexia-associated protein KIAA0319-like protein ... [more]
A0A1S3JF792.516e-4430.56dyslexia-associated protein KIAA0319-like protein ... [more]
A0A1S3JEN12.520e-4430.56dyslexia-associated protein KIAA0319-like protein ... [more]
A0A1S3JEE63.160e-4430.56dyslexia-associated protein KIAA0319-like protein ... [more]
A0A4X2JYU34.734e-4429.80Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-193k19.16.736e-3325.68KIAA0319 like [Source:NCBI gene;Acc:103041131][more]
si:ch73-215d9.18.093e-2323.68dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
si:ch73-215d9.18.093e-2323.68dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
spint1b5.735e-829.41kunitz-type protease inhibitor 1-like [Source:NCBI... [more]
spint1a9.500e-729.60serine peptidase inhibitor, Kunitz type 1 [Source:... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193k19.11.003e-4129.52si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428712.342e-4127.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-193k19.11.672e-3325.71KIAA0319 like [Source:NCBI gene;Acc:101168634][more]
si:ch73-215d9.18.217e-2122.29dyslexia-associated protein KIAA0319 homolog [Sour... [more]
si:ch73-215d9.16.835e-1725.32dyslexia-associated protein KIAA0319 homolog [Sour... [more]
si:ch73-215d9.12.103e-1223.44dyslexia-associated protein KIAA0319 homolog [Sour... [more]
spint1a8.365e-630.40serine peptidase inhibitor, Kunitz type 1 [Source:... [more]
back to top
BLAST of Dyslexia-associated protein KIAA0319-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063418.10.000e+099.21SMESG000063418.1[more]
SMESG000063418.10.000e+091.58SMESG000063418.1[more]
SMESG000063418.10.000e+091.84SMESG000063418.1[more]
SMESG000063418.13.400e-1280.00SMESG000063418.1[more]
SMESG000079575.17.957e-3027.01SMESG000079575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034174 ID=SMED30034174|Name=Dyslexia-associated protein KIAA0319-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1402bp
GTTTTTTCGTTATTTTTGGCAATGATATAAATGGAATTGATCGTGTCCAT
TCTGGTAGCTAGCAGCGTGTTGGCAGGATCAAGTGCTAAATTCGAATTTG
CAACCCTACAATCATACCATTTACCATTAGAGAAAATTTATCTTCATCCT
GGAAGTAATTTAATACCTTCATCAAATGCCAAATTCAAATGGAAGCAAAT
AATGGGTCCACACAATCTCTCCGTTCTAAGTGATACAAATCCAGTGGCTG
TCATCACTAATCTGAAAATGGGCTTTTACGTGTTCCTTGTGAAAATTGAT
CAATTCAATAACTCTAGTCTTAGATCAAGAATTATTCAAATCAATATTTA
TGACAGTTCCAATATAAAACCAAAAGCCAATGCTGGCGGAAATGTAGTAG
TCATTCTGCCGAGAACTAGTGTTCAGTTATCTGGAGTAAATTCATTCGAT
GACAGAAAAGTTTTAAGATATCAATGGATTGCAGATGTCCACAATCCAGC
TGGACTGGAAATCCTTGGAAATTCCGTCAATGAACCAAATCTCATTCTTT
GGAATCTCTCACCGGGTATTTATAAATTTAAATTACTTGTTGAAGACCTT
GAAGGACTTCAAGATGAAGATAAAATGACTCTGACCGTTAAGGAAGATAG
AAATGCAAAGAATATGATAGAAATGCTTCTTTCAACAAATCTGCAAAATT
TTTCTCATAACAGTTTGAAAAATTTTCAGAGTCAAGTTTACCTAATTGTC
AGCAAATCTATTCCAAATATCAACTTGCAGATCAAAATTGTCCGATTGAA
AAGGGATCCTTTGACAGGCCTTGCCCTCATTGTGTTCTATGGTATCCACC
ATGACAGGACTCAGACTCGACGGAAACTAATATTCTCTGCTTCTTCATTG
ATCAAGCTGCTACGCCCCGTCATTCTAGACGATATTAATATATTCATGTT
TCCAGTTGTTCAAATAAATAGTATAAATTGTTCGAGATCTTGTTTTGAGC
ACGGCTATTGTGACTTCGACACCAGAAAATGTATCTGTGACCCTTTTTGG
ATGAACAATTTGTGGAATATATTGCTTGACAAGGACTCGATGGCAAGCTG
CGATTGCAACATTTTCTACGTGATTTCAGTCGGAAGCATTATTATAATAA
CTTTATTTCTTCTGTGTCGGTACATTTTACATATCAAAATTCTGTGCTAT
AGCTTCAGACCTATATCCATAACTGAATAAAGTGTCCACTTGATTAGATT
TGTATAAACACATATTTTTAGCATGCATCAAATTGACGGATCGAAAACAT
GCGAAAGTATCAAAATTCATAATTAAAAAATCATATAATAAAATATACAT
GGGTTTGGGCCAGAAGCAGGATCTTATGTCTTTTGGAAATGGATATTTGG
TG
back to top

protein sequence of SMED30034174-orf-1

>SMED30034174-orf-1 ID=SMED30034174-orf-1|Name=SMED30034174-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MELIVSILVASSVLAGSSAKFEFATLQSYHLPLEKIYLHPGSNLIPSSNA
KFKWKQIMGPHNLSVLSDTNPVAVITNLKMGFYVFLVKIDQFNNSSLRSR
IIQINIYDSSNIKPKANAGGNVVVILPRTSVQLSGVNSFDDRKVLRYQWI
ADVHNPAGLEILGNSVNEPNLILWNLSPGIYKFKLLVEDLEGLQDEDKMT
LTVKEDRNAKNMIEMLLSTNLQNFSHNSLKNFQSQVYLIVSKSIPNINLQ
IKIVRLKRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILD
DINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLWNILLD
KDSMASCDCNIFYVISVGSIIIITLFLLCRYILHIKILCYSFRPISITE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031410cytoplasmic vesicle
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR003614Scorpion_toxin-like
IPR035986PKD_dom_sf
IPR000601PKD_dom
Vocabulary: biological process
TermDefinition
GO:0006952defense response
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 112..211
e-value: 1.1E-14
score: 56.1
NoneNo IPR availablePANTHERPTHR46182FAMILY NOT NAMEDcoord: 50..378
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.509
NoneNo IPR availableTMHMMTMhelixcoord: 361..383
IPR003614Knottin, scorpion toxin-likeCDDcd00107Knot1coord: 316..337
e-value: 0.00607627
score: 32.322
IPR035986PKD domain superfamilySUPERFAMILYSSF49299PKD domaincoord: 111..205