Innexin

Overview
NameInnexin
Smed IDSMED30034170
Length (bp)1616
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30034170) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30034170) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30034170) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30034170) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034170

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034170SMESG000075619.1 SmedASXL_008834SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30034170SMESG000075619.1 dd_Smed_v4_17716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034170SMESG000075619.1 dd_Smed_v6_17716_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034170SMESG000075619.1 OX_Smed_1.0.12160ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 258.07 bits (658), Expect = 6.465e-81
Identity = 139/391 (35.55%), Postives = 224/391 (57.29%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRV---WSRRVPI--LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWR--VTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDH 1382
            L  +F   +   D DFVD++NY Y+S ++  F  I+  +Q+VG PIQCWVP +FT +WEQY EN CWV+NTY +P     P +  D ++   ISYYQWV  V+  +AL  +IP I WR    W   + +  L   A +A + D + R   VQ +   +E+  +        +G         +   W   VT +++ ++M++LGN + Q++++  F+ T+   +G  + +DL+   +W+ SGNFPR+T C  ++R  G      HT QCVL IN F EKI++FLW W+F +A ++ V+   WIII  LP Q ++FIR+YL+A  L +  D +   KFV   LG DG+F ++ +S  + D++A ++  ++W N+   R+  ++ + +  L+H
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ-ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSG-------MCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT--DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFND-RVRKIQFNSTESLNH 383          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 258.07 bits (658), Expect = 6.465e-81
Identity = 139/391 (35.55%), Postives = 224/391 (57.29%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRV---WSRRVPI--LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWR--VTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDH 1382
            L  +F   +   D DFVD++NY Y+S ++  F  I+  +Q+VG PIQCWVP +FT +WEQY EN CWV+NTY +P     P +  D ++   ISYYQWV  V+  +AL  +IP I WR    W   + +  L   A +A + D + R   VQ +   +E+  +        +G         +   W   VT +++ ++M++LGN + Q++++  F+ T+   +G  + +DL+   +W+ SGNFPR+T C  ++R  G      HT QCVL IN F EKI++FLW W+F +A ++ V+   WIII  LP Q ++FIR+YL+A  L +  D +   KFV   LG DG+F ++ +S  + D++A ++  ++W N+   R+  ++ + +  L+H
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ-ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSG-------MCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT--DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFND-RVRKIQFNSTESLNH 383          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 256.914 bits (655), Expect = 6.245e-80
Identity = 136/373 (36.46%), Postives = 215/373 (57.64%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRV---WSRRVPI--LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWR--VTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY 1328
            L  +F   +   D DFVD++NY Y+S ++  F  I+  +Q+VG PIQCWVP +FT +WEQY EN CWV+NTY +P     P +  D ++   ISYYQWV  V+  +AL  +IP I WR    W   + +  L   A +A + D + R   VQ +   +E+  +        +G         +   W   VT +++ ++M++LGN + Q++++  F+ T+   +G  + +DL+   +W+ SGNFPR+T C  ++R  G      HT QCVL IN F EKI++FLW W+F +A ++ V+   WIII  LP Q ++FIR+YL+A  L +  D +   KFV   LG DG+F ++ +S  + D++A ++  ++W N+
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ-ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSG-------MCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVH--HHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLAT--DRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNF 366          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 237.269 bits (604), Expect = 6.653e-73
Identity = 127/363 (34.99%), Postives = 216/363 (59.50%), Query Frame = 3
Query:  267 DIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPI----LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTL-----NPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY 1328
            D D +D++NY Y++ ++ +F  ++  +Q+VG PIQCWVP  FT+  EQY EN CWV+NTY +P ++ IP +  + ++   I YYQWV  V+  +AL+ ++P I WR+ S +  I    L+  A ++ + D E+R +A+Q + + +EE    H++++  +G  ++  L  L     +    VTF++I V++++  N +GQ++L+  F+      +G+ V  DL+   +W+ESG+FPR+T C  +++  G      HT QCVL IN F EKI++FLW W+F LA  T  +   WI I  +P +Q+ F+ +YL  ++     D +   +FV   L  DG+FLL+ V+  + +L   ++  ++W NY
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQ-IGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEAL--HVKHQVMSG--NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG--NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 233.032 bits (593), Expect = 2.387e-70
Identity = 128/377 (33.95%), Postives = 210/377 (55.70%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWR---VWSRRVPI--LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFT---LNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKAL---KLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY 1328
            L   F   Y   D DFVD++NY Y++ +L  F  ++  +Q+VG PIQCWVP  FT + EQY EN CWV+NTY +P  E IP +    ++   I YYQWV  ++  +AL+ ++P I WR    W   + +  L+  A +A + D E + + V  +   +++   +  R       FS   L      +    VT ++I +++++  N + Q +L+ H + +N+  +G  + KDL+   +W+++G FPR+T C  ++R  G      HT QCVL IN F EKI++FLW WF    I+T  NT  WI+I+ +P Q + F+R+YL+ L        ADD    KF  + L  DG+F+L+ +S  + +L++ ++  ++W ++
Sbjct:   67 LASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQ-IGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIH--RHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDF 440          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 94.3597 bits (233), Expect = 1.010e-20
Identity = 88/340 (25.88%), Postives = 142/340 (41.76%), Query Frame = 3
Query:  345 RQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPEN-EKIPEDDL----------DLKSVTFISYYQWVAIVMGGQALICWIPHICWRVW-SRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFG--IWVFKDLIENHQWKESGN-FPRITFCTIDIRKFGQNKPA-SHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASM 1316
            RQ++G PI C V +      + Y    CW+ +T+ +PE    I   D+              V +  YYQWV  V+  QA++ ++P   W+ W   R+ +L+       V D E +    + L+     N   H  Y                      F F +   +   N IGQ+Y +  F+    + +G  +  F +L  + +       FP++T CT    K+G +    +H   CVLP+N   EKIYVFLW WF  L+I++ ++    I +V  P      +R  L  L+  S   + E  + V +   I   FLL  +      LI  +V + +
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVND-ECKNDRKKILVDYFIGNLNRHNFY---------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF--HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPK-----LRHLL--LRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 94.3597 bits (233), Expect = 1.010e-20
Identity = 88/340 (25.88%), Postives = 142/340 (41.76%), Query Frame = 3
Query:  345 RQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPEN-EKIPEDDL----------DLKSVTFISYYQWVAIVMGGQALICWIPHICWRVW-SRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFG--IWVFKDLIENHQWKESGN-FPRITFCTIDIRKFGQNKPA-SHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASM 1316
            RQ++G PI C V +      + Y    CW+ +T+ +PE    I   D+              V +  YYQWV  V+  QA++ ++P   W+ W   R+ +L+       V D E +    + L+     N   H  Y                      F F +   +   N IGQ+Y +  F+    + +G  +  F +L  + +       FP++T CT    K+G +    +H   CVLP+N   EKIYVFLW WF  L+I++ ++    I +V  P      +R  L  L+  S   + E  + V +   I   FLL  +      LI  +V + +
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVND-ECKNDRKKILVDYFIGNLNRHNFY---------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF--HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPK-----LRHLL--LRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 94.3597 bits (233), Expect = 1.010e-20
Identity = 88/340 (25.88%), Postives = 142/340 (41.76%), Query Frame = 3
Query:  345 RQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPEN-EKIPEDDL----------DLKSVTFISYYQWVAIVMGGQALICWIPHICWRVW-SRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFG--IWVFKDLIENHQWKESGN-FPRITFCTIDIRKFGQNKPA-SHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASM 1316
            RQ++G PI C V +      + Y    CW+ +T+ +PE    I   D+              V +  YYQWV  V+  QA++ ++P   W+ W   R+ +L+       V D E +    + L+     N   H  Y                      F F +   +   N IGQ+Y +  F+    + +G  +  F +L  + +       FP++T CT    K+G +    +H   CVLP+N   EKIYVFLW WF  L+I++ ++    I +V  P      +R  L  L+  S   + E  + V +   I   FLL  +      LI  +V + +
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVND-ECKNDRKKILVDYFIGNLNRHNFY---------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF--HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPK-----LRHLL--LRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 94.3597 bits (233), Expect = 1.010e-20
Identity = 88/340 (25.88%), Postives = 142/340 (41.76%), Query Frame = 3
Query:  345 RQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPEN-EKIPEDDL----------DLKSVTFISYYQWVAIVMGGQALICWIPHICWRVW-SRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFG--IWVFKDLIENHQWKESGN-FPRITFCTIDIRKFGQNKPA-SHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASM 1316
            RQ++G PI C V +      + Y    CW+ +T+ +PE    I   D+              V +  YYQWV  V+  QA++ ++P   W+ W   R+ +L+       V D E +    + L+     N   H  Y                      F F +   +   N IGQ+Y +  F+    + +G  +  F +L  + +       FP++T CT    K+G +    +H   CVLP+N   EKIYVFLW WF  L+I++ ++    I +V  P      +R  L  L+  S   + E  + V +   I   FLL  +      LI  +V + +
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVND-ECKNDRKKILVDYFIGNLNRHNFY---------------------AFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF--HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPK-----LRHLL--LRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349          
BLAST of Innexin vs. Ensembl Fly
Match: ogre (gene:FBgn0004646 transcript:FBtr0071037)

HSP 1 Score: 78.5666 bits (192), Expect = 1.914e-15
Identity = 64/257 (24.90%), Postives = 104/257 (40.47%), Query Frame = 3
Query:  348 QFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPE-----------NEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFK--DLIENHQWKESGN-FPRITFCTIDIRKFGQNKP-ASHTFQCVLPINHFVEKIYVFLWIWF 1073
            Q+VG PI C V               CW+ +T+ +P+           +  +  D  D  +  + +YYQWV  V+  QA+ C+ P   W  +   +  ++      T+  RE ++     L+  L ++ + H  Y  +               W   F+  +       N I Q+YLM  F       +G  + K  D+ +  +       FPR+T CT    K+G +     H   C+LP+N   EK YVF+W WF
Sbjct:   46 QYVGQPISCIV----NGVPPHVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRDALLDYLIKHVKRHKLYAIR--------------YWACEFLCCI-------NIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTF--HKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWF 275          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.463e-72
Identity = 127/363 (34.99%), Postives = 216/363 (59.50%), Query Frame = 3
Query:  267 DIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPI----LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTL-----NPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY 1328
            D D +D++NY Y++ ++ +F  ++  +Q+VG PIQCWVP  FT+  EQY EN CWV+NTY +P ++ IP +  + ++   I YYQWV  V+  +AL+ ++P I WR+ S +  I    L+  A ++ + D E+R +A+Q + + +EE    H++++  +G  ++  L  L     +    VTF++I V++++  N +GQ++L+  F+      +G+ V  DL+   +W+ESG+FPR+T C  +++  G      HT QCVL IN F EKI++FLW W+F LA  T  +   WI I  +P +Q+ F+ +YL  ++     D +   +FV   L  DG+FLL+ V+  + +L   ++  ++W NY
Sbjct:   20 DDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQ-IGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEAL--HVKHQVMSG--NRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG--NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.171e-67
Identity = 129/379 (34.04%), Postives = 211/379 (55.67%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWR---VWSRRVPI--LLHTAREATVPDRETRQKAVQCLISALEENAQ--SHLRYRRKTGFFSKFPLFT---LNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKAL---KLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY 1328
            L   F   Y   D DFVD++NY Y++ +L  F  ++  +Q+VG PIQCWVP  FT + EQY EN CWV+NTY +P  E IP +    ++   I YYQWV  ++  +AL+ ++P I WR    W   + +  L+  A +A + D E + + V  +   +++  Q  +  R       FS   L      +    VT ++I +++++  N + Q +L+ H + +N+  +G  + KDL+   +W+++G FPR+T C  ++R  G      HT QCVL IN F EKI++FLW WF    I+T  NT  WI+I+ +P Q + F+R+YL+ L        ADD    KF  + L  DG+F+L+ +S  + +L++ ++  ++W ++
Sbjct:  126 LASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQ-IGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIH--RHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDF 501          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 5.304e-53
Identity = 121/408 (29.66%), Postives = 208/408 (50.98%), Query Frame = 3
Query:  231 LGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPI----LLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFP----LFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRE--------------CAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY--RQARLVGVEDDISRFLDH 1382
            LG +F       D    D++NY YS+ +++     I  RQ+VGSP+QCWVP +FTK+WEQYAE+ C+V NTY +  N+K+P    +  S   I YYQW   +M  +A   ++P I W + S +  I    L+ TA++A   + E R+K +  +   +  N    LR RR     +K      +F +     +T V+++ +++++ N+  Q Y    F+  N+  +G+ +  D+++   W+ SGNFPRI  C   +R  G  +   ++ QCVL +N F EKI++FL+IWF  +  +T  ++      +    + V F++Q+L       N + +                ++F       D I LL+ ++N + D++  ++   MW  +  R A+LV     + RF+D+
Sbjct:    4 LGSMFSMVKPRLDDLGTDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLI-YYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNN----LRKRRNEEETTKMAKIQRIFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQ--RYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKLV-----LQRFVDN 399          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 3.822e-51
Identity = 119/401 (29.68%), Postives = 197/401 (49.13%), Query Frame = 3
Query:  216 GAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIP-----ENE-KIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRY-RRKTGFFSKFPLFTLNPSWRVT-----FVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDREC---AKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNY--RQARLVGVEDDIS 1367
            G ++   + F  +   NDI   D+ +YQY+S LL     ++   Q+VG PIQCWVP +FT++WE+YAE  C++K TY +P     E E  +   D  + +   + YYQW+ IV+  QA + ++P I WR ++    + +      +   R+ +       +S  +  A    RY  +K  F ++ P+F    S   +      ++++V++++L N + Q +++ +F+ T   ++G   F+DL+   +W+ +G FPR+T C   I          H+ QCV+ IN   EK+YVF W W   + +LT  + A W +I  L      FI  YL+         +R     A FV   L  DG+F+ + V   S DL    +   M+  Y  R+A     +DD S
Sbjct:    3 GVLLPYVRKFQRSAESNDI--ADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSN-----MSDDQVKATKFGRYFFKKLNFRNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDL--TSVHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKDDDS 394          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.286e-50
Identity = 115/380 (30.26%), Postives = 188/380 (49.47%), Query Frame = 3
Query:  273 DFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRV----PILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSN 1400
            D VD+++Y  ++ LL  F  ++  +Q+VGS IQCW+P EF   WEQYAE+ C+++NT+ IPE  +IP D  D +    I YYQWV IV+  QA + ++P   W    ++     P ++  A      D ETR K V  L+  + +   +  R + + G F  +  F        + ++I +++M+L N   Q  ++  F+     L+G   F DL    +W++SG FPR+T C   +RK        +T QCVL IN F EKIY+F+W WF  + I T +NT   I  +     +  +IR  L         +    A F  + L  DG+ L++ + + +  ++  ++   ++  +      G     +R   H  ST +
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE-IGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT--RSKNEYGRFYCYR-FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVH--RYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKH------GENLQHNRDFHHGHSTKS 389          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M9 (Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 5.901e-174
Identity = 237/400 (59.25%), Postives = 319/400 (79.75%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            ME+G   ++G+LF   YGG  +DFVDQ+NYQ++SGLL++FI IIG+RQ+VG PIQCWVPQEFT+SWE+YAEN+CWV+NTY +  +E +P ++ +L  V +ISYYQWVAIV+ GQA++ W+PH+ WRVWSRRVPILL +AREA+ PDRE R+KA+ CL++ALEE  +S  R+R+  G F K  L  +NP+ RVT +FI VR++F+ NNIGQ+++MK FI TNET FGI VF+DL++ ++ + S  FPR+T+CTI +RK GQ KP S+T QCVLPIN+FVEK+YVFLW WF  L+ILTT+NT QW + VC+P ++V+FIRQYLKALK+ ++ D+R+C +FV+  LG DGIFLLQ+VS +SSDLIALDVT ++W NY++A+L G EDDI R +D    +S +V
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNEYELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKC-LGGVNPTARVTLLFIFVRLLFIANNIGQIFMMKKFIGTNETTFGITVFRDLLDGNEGQISATFPRVTYCTIKVRKMGQVKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCVPLRRVQFIRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LXE0 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 7.683e-169
Identity = 228/401 (56.86%), Postives = 309/401 (77.06%), Query Frame = 3
Query:  204 LMENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            L++ G + KLG+LF T YGG  +DF+DQ+NYQY+ GL++IFI+II LRQ+VG PIQCWVPQEFTKSWE+YAENLCWV NTY +  NE+IP D +D + V FI YYQWV IVM GQAL+ W+PH+ WRV SRR+P+LL +AREA +PDRE R KAV CL++ LEE A+S  R+RR     ++  L  + P+ R+T +F++VRM+F+ N++GQ+Y+MK F   N TLFG+ + +DL    +W+ +G+FPR+T+CTI +RK GQ KPAS+T QCVLPIN+F EKIYVFLW WF  L ILTT+NT QW +   LP ++V +I+QYLKAL+L S+ ++R+CA+FV + LG DG+F+L  VS ++SDLIALDVTA++W NYRQA++ G E+D++R L+    +S +V
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQYTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVMAGQALLSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLNRC-LCGVTPNARLTTLFLLVRMLFVANSVGQIYMMKRFTGFNSTLFGMKLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGILTTLNTLQWAMNTILPVRRVNYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWRNYRQAKITGTEEDVNRLLETVNRSSAVV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RM26 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 3.724e-167
Identity = 225/401 (56.11%), Postives = 307/401 (76.56%), Query Frame = 3
Query:  204 LMENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            L++ G + KLG+LF T YGG  +DFVDQ+NYQ++ GL++IFI+II LRQ+VG PIQCWVPQEFTKSWE+YAENLCWV NTY +  NE+IP D +D + V FI YYQWV IV+ GQA++ W+PH+ WRV SRR+P+LL +AREA +PDRE R KAV CL++ LEE A+S  R+RR     S+  L  + P+ R+T +F+ VR +F+ N++GQ+YLMK F   N T+FG+ + +DL    +W+ +G+FPR+T+CTI +RK GQ KPAS+T QCVLPIN+F EKIYVFLW WF  L +LTT+NT QW +   LP ++V +I+QYLKAL+L S+ ++R+CA+FV + LG DG+F+L  VS ++SDLIALDVTA++W NYRQA++ G E+D++R L+     S++V
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFVDQLNYQFTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVLAGQAMMAWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLSRC-LCGVTPNARLTMLFLFVRTLFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFVILGVLTTLNTLQWALNTMLPMRRVHYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNRGSSVV 407          
BLAST of Innexin vs. TrEMBL
Match: C1LEY2 (Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE=2 SV=1)

HSP 1 Score: 483.026 bits (1242), Expect = 6.267e-165
Identity = 222/391 (56.78%), Postives = 305/391 (78.01%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLD 1379
            M+    +KLG+LF   YGG  +DFVDQ+NYQ++SG++++FI +IG RQ+VG P+ CWVPQEFT SWE YAEN+CWV+NTY +  NE IPEDD ++  V  ISYYQWVAI++ GQA++ WIPH+ WRVWS+RVP+LL  AREA VPD+E R KA+ CL++ALEE +++  RYRR  G F +  L    P+ R+T +F++VR+ F+ NNIGQ+Y+MKHFI TN+TLFG+ VF++L+   +W+ SG FPR+T+C + +RK GQ KPAS+T QCVLP+N+F+EK+Y+FLW W+  +A LT +NT  WI  +CLP+++V+FIRQYLKALK  S+ ++ ECA+FV + LG DGIFLLQAVS +SSDLI LDVT  +W NY++A++ G E++I RF++
Sbjct:    1 MDANNALKLGRLFRVPYGGEGVDFVDQLNYQFTSGIIVLFIVMIGFRQYVGKPLHCWVPQEFTSSWEDYAENICWVQNTYFLLPNEAIPEDDFEMLRVRHISYYQWVAIILAGQAMMAWIPHVLWRVWSKRVPVLLKNAREAAVPDKEVRHKAISCLVAALEEISEASKRYRRARGIFQRC-LGGPPPTTRITLLFLIVRVFFIANNIGQIYVMKHFIGTNDTLFGLHVFQELLVGSEWEVSGLFPRVTYCDVKVRKLGQLKPASYTLQCVLPVNYFIEKVYIFLWFWYILMACLTILNTFLWITKLCLPYRRVQFIRQYLKALKQLSHTEETECARFVNNNLGCDGIFLLQAVSKISSDLIVLDVTGMLWSNYQRAKITGTEENIGRFIE 390          
BLAST of Innexin vs. TrEMBL
Match: A0A3Q0KNG6 (Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3 SV=1)

HSP 1 Score: 482.641 bits (1241), Expect = 9.579e-165
Identity = 221/400 (55.25%), Postives = 311/400 (77.75%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            M    ++++GK+F T YGG+ +DFVDQ+NYQ++ GLL+IFI++IG+RQ+VG PIQCWVPQEFT SWE+YAENLCWV+NTY +  ++++PEDD +L  V +I YYQW+AIV+ GQA++CW+P I WRV S+R+P+LL +A+EA+VPDRE RQKA+ CL++ LEE A+S  R+RR T    +  L +  P+ R+TF+F +VR+ F+GN++GQ+YLMK FI TN T+FG+ V  DLI   +W+ SG FPR+TFCT+ +RK GQ KPAS+T QCVLPIN+FVEK+YVFLW WF  L+I+T ++T QW     +P +++ +I+QY++A++  SN ++R+C +FV   LG DG+ +LQ VS VSSDLIALDVTA++W NYR A++ G E+DI+RFL++    +N V
Sbjct:    1 MNPDTVLRIGKVFETPYGGDGVDFVDQLNYQFTGGLLIIFIAVIGVRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTKVRYIGYYQWIAIVLAGQAMLCWVPQILWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARHRRATSTIKRI-LCSFRPNTRITFLFFIVRICFIGNSVGQIYLMKKFIGTNSTMFGMDVLNDLITGQEWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILSIVTILSTLQWAFNTLVPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNYNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGTNAV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 263/402 (65.42%), Postives = 338/402 (84.08%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRR-KTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTS-NIV 1406
            ME    +K+GK FHT YGGNDIDFVDQ+NYQYS+GLL IFISIIG RQ+VG PIQCWVPQ+FTKSWE+YAENLCW+++TY++ +NE IPEDD ++ S+ +ISYYQWVAIVMGGQA++ ++PH+ WR+WS+R+PILL TAREA++PDRE R KA+QC+++ LEE  ++ +RYRR + G F+++  F  NPS R+T +F+ VR +F+ NNIGQ+YLMK+FI+TN T FGI V  DL++ ++WK+ GNFPRIT+CTI++RKFGQ K ASHTFQCVLPINHFVEKIYVFLW+WF  LA+LTT+NT QW +IVCLPW+Q +FI++YLKALKL SN++ REC +FV   LG DGIF+LQAVS VSSDLIALDVTA++W NYRQA+L G EDDI+R+++ +  T+ NIV
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 402          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000075619.1 (SMESG000075619.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 264/264 (100.00%), Postives = 264/264 (100.00%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPA 998
            MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYSSGLLLIFISIIGLRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPA
Sbjct:    1 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYSSGLLLIFISIIGLRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPA 264          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 505.753 bits (1301), Expect = 2.019e-177
Identity = 237/400 (59.25%), Postives = 318/400 (79.50%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            ME+G   ++G+LF   YGG  +DFVDQ+NYQ++SGLL++FI IIG+RQ+VG PIQCWVPQEFT+SWE+YAEN+CWV+NTY +  +E +P +D +L  V +ISYYQWVAIV+ GQA++ W+PH+ WRVWSRRVPILL +AREA+ PDRE R+KA+ CL++ALEE  +S  R+R+  G F K  L  +NP+ RVT +FI VR++F+ NN+GQ+++MK FI TNET FGI VF+DL+  ++ + S  FPR+T+CTI +RK GQ KP S+T QCVLPIN+FVEK+YVFLW WF  L+ILTT+NT QW + VCLP ++V+F+RQYLKALK+ ++ D+R+C +FV+  LG DGIFLLQ+VS +SSDLIALDVT ++W NY++A+L G EDDI R +D    +S +V
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKC-LGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 476.093 bits (1224), Expect = 1.523e-165
Identity = 218/402 (54.23%), Postives = 315/402 (78.36%), Query Frame = 3
Query:  204 LMENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLD-HARSTSNIV 1406
            LME+G + K+G+LF T YGG  +DF DQ+NYQ++SGL++IFI+I+ +RQ+VG PIQCWVPQEFTK+WE+YAENLCWV NTY +  +++IP DD + K+V +ISYYQW+ IV+ GQAL+ W+PH+ WRV SRR+P+LL +AREA +PDR+ R KAV C++++LEE A + +R RR  G F +  L  L P+ R+T +FI+VR+MF+GN +GQ+YLM+ F+ +N  +FG  + KDL+    W+ +GNFPR+T+CTI +R+ GQ K AS+T QCVLPINHF+EK+YVFLW WF  +A +T ++T QW+    LP ++V ++RQYLKA++L ++ ++R+C++FV + LG DG+FLL  VS+ +SDLI+LDVTA++W N+RQA++ G E+D+SR L+ + R+ S+IV
Sbjct:   11 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRC-LGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1)

HSP 1 Score: 439.499 bits (1129), Expect = 2.157e-151
Identity = 207/400 (51.75%), Postives = 301/400 (75.25%), Query Frame = 3
Query:  207 MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYXXXXXXXXXXXXXXRQFVGSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTFISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETRQKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVRMMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITFCTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNTAQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFLLQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV 1406
            M  G  +K+ + F   YGG D+DFVDQ+NYQ++SGLL +F+ IIG RQ++G PIQCWVPQEFTK+WE+YAENLCWV+NTY +   E IP  D++L  + +ISYYQWVAIV+ GQAL+ WIP++ WR++S++V +LL++A+EA++PD   R+KAV  L++ALEE +Q + ++ ++ G   ++ L  +NP++R+TF+FI+VR++F+ N  GQ+ +M+ FI +++ +FG  VF+ L+ NHQW+ S  FPR+T+CT+ +RK GQ +P S+T QCVLP+N+FVEK+YVFLW WF  L +LTT++TAQWI  VC+P  +V+FIRQYLKALK+ S  ++++C +FV   LG DGIFLL +VS +SSDLIALDV   +W N++ A+  G E D++  +       N+V
Sbjct:    1 MNAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGKPIQCWVPQEFTKAWEEYAENLCWVQNTYFLSPEEDIPRTDVELNKMKYISYYQWVAIVLSGQALMSWIPYLVWRLFSQKVIVLLNSAKEASIPDWSVRRKAVSYLVNALEEQSQINNQFYKRKGIVRRY-LTEINPAYRITFIFIVVRILFVTNCFGQIIIMRIFIGSSDFMFGYNVFQYLLRNHQWQISETFPRVTYCTVKVRKLGQLRPGSYTLQCVLPVNYFVEKVYVFLWFWFIILGVLTTISTAQWIANVCIPPWRVQFIRQYLKALKVISGPEEKDCNRFVNKKLGCDGIFLLHSVSKLSSDLIALDVAGHLWQNFKMAKSQGNEVDLNNLIQSIHRGPNVV 399          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-16.465e-8135.55Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-16.465e-8135.55Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-16.245e-8036.46Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-96.653e-7334.99Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-72.387e-7033.95Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx21.010e-2025.88gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.010e-2025.88gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.010e-2025.88gene:FBgn0027108 transcript:FBtr0332314[more]
Inx21.010e-2025.88gene:FBgn0027108 transcript:FBtr0071006[more]
ogre1.914e-1524.90gene:FBgn0004646 transcript:FBtr0071037[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL8.463e-7234.99Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.171e-6734.04Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q27295|EAT5_CAEEL5.304e-5329.66Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23027|INX5_CAEEL3.822e-5129.68Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q19746|INX3_CAEEL1.286e-5030.26Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M95.901e-17459.25Innexin OS=Dugesia japonica OX=6161 GN=inx5 PE=2 S... [more]
A0A4S2LXE07.683e-16956.86Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A4E0RM263.724e-16756.11Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
C1LEY26.267e-16556.78Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE... [more]
A0A3Q0KNG69.579e-16555.25Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051126.10.000e+065.42SMESG000051126.1[more]
SMESG000075619.10.000e+0100.00SMESG000075619.1[more]
SMESG000033444.12.019e-17759.25SMESG000033444.1[more]
SMESG000068735.11.523e-16554.23SMESG000068735.1[more]
SMESG000027007.12.157e-15151.75SMESG000027007.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034170 ID=SMED30034170|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1616bp
GTTTCAATATTCTTTAGCGTAATTATTATCAGAGATTCATAGATTCTGAA
CTGATTATCAAGATATTTTCATCAATTTATTATTTCGAAATTGAGTTTTC
TATGGATATTTATTCGGGATTTATTAGTGCTCAATTGAGAACATGAGATT
TTATCAAAGGTTGGATTATTGATTTTAAATACTTTGCGAGAATTTAGTCA
ATATTAATGGAAAATGGAGCAATAATCAAATTGGGAAAATTGTTCCATAC
GAATTATGGTGGAAATGATATTGATTTTGTAGATCAGATTAATTATCAAT
ACTCGAGTGGACTTTTACTCATTTTCATATCGATTATTGGACTTCGTCAG
TTTGTTGGCAGTCCAATTCAATGCTGGGTACCACAGGAATTCACCAAATC
TTGGGAACAATATGCAGAGAATCTTTGTTGGGTTAAAAATACCTATCGGA
TACCTGAAAATGAGAAAATACCGGAAGATGATTTAGATTTGAAATCGGTA
ACATTTATCAGTTATTATCAATGGGTTGCTATTGTAATGGGCGGTCAAGC
ACTTATCTGTTGGATTCCGCACATATGCTGGAGAGTTTGGTCTAGAAGAG
TCCCTATACTTTTGCACACTGCCAGAGAAGCTACAGTGCCGGATAGAGAA
ACTCGACAAAAGGCAGTTCAGTGTCTGATATCAGCTCTTGAAGAAAATGC
TCAATCTCATCTCAGATATCGAAGAAAAACTGGATTCTTTTCAAAGTTTC
CGTTGTTTACTCTAAATCCATCATGGAGAGTAACATTTGTGTTTATTATG
GTACGAATGATGTTCCTTGGAAACAATATTGGACAGTTATATTTAATGAA
GCATTTTATTCGAACCAATGAAACATTATTTGGCATATGGGTTTTTAAAG
ATTTGATTGAAAATCATCAATGGAAAGAATCCGGAAATTTTCCAAGAATT
ACATTTTGTACCATAGACATTAGAAAATTTGGACAGAATAAACCAGCAAG
TCACACATTCCAGTGTGTTTTACCAATAAATCATTTTGTGGAGAAGATCT
ACGTTTTTCTTTGGATATGGTTCTTTTGTCTGGCAATTTTAACAACTGTG
AATACTGCACAATGGATCATTATTGTTTGTCTACCATGGCAGCAAGTCCG
TTTCATTAGACAATATCTCAAAGCTCTAAAACTGACCTCAAATGCTGATG
ATAGAGAGTGTGCTAAATTTGTTAAAGACATTCTTGGAATAGATGGAATA
TTTTTATTACAGGCTGTGAGCAACGTTTCAAGTGATCTTATTGCTCTCGA
TGTTACTGCTTCAATGTGGTGGAATTATCGGCAGGCTAGATTAGTTGGGG
TCGAGGATGACATCAGTCGGTTTTTAGATCACGCCCGAAGCACTTCAAAT
ATTGTTTGAGCTGATAGTTGCGACAGAAACTTTCGTTATATTTATAAAAA
TGAGTTATTTAGAGAAATTCGACTTTTCAATTTAGAATATATTTTTTCCG
TGTAATATTTTCATATCAATTTTCCGTGAAAATATTTATTAACCCGGGCT
TGTAATGCAGACTGGCTCAAATTACTTTGATCCTTTTTTATAGAGATTCA
TATAGATATTCATGGT
back to top

protein sequence of SMED30034170-orf-1

>SMED30034170-orf-1 ID=SMED30034170-orf-1|Name=SMED30034170-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MENGAIIKLGKLFHTNYGGNDIDFVDQINYQYSSGLLLIFISIIGLRQFV
GSPIQCWVPQEFTKSWEQYAENLCWVKNTYRIPENEKIPEDDLDLKSVTF
ISYYQWVAIVMGGQALICWIPHICWRVWSRRVPILLHTAREATVPDRETR
QKAVQCLISALEENAQSHLRYRRKTGFFSKFPLFTLNPSWRVTFVFIMVR
MMFLGNNIGQLYLMKHFIRTNETLFGIWVFKDLIENHQWKESGNFPRITF
CTIDIRKFGQNKPASHTFQCVLPINHFVEKIYVFLWIWFFCLAILTTVNT
AQWIIIVCLPWQQVRFIRQYLKALKLTSNADDRECAKFVKDILGIDGIFL
LQAVSNVSSDLIALDVTASMWWNYRQARLVGVEDDISRFLDHARSTSNIV
*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 196..210
score: 25.87
coord: 103..125
score: 42.26
coord: 270..286
score: 62.12
coord: 45..56
score: 50.33
coord: 73..82
score: 46.4
coord: 244..253
score: 51.6
IPR000990InnexinPFAMPF00876Innexincoord: 23..374
e-value: 1.1E-98
score: 330.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 11..378
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..380
score: 30.37
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 284..306