GTP:AMP phosphotransferase, mitochondrial

Overview
NameGTP:AMP phosphotransferase, mitochondrial
Smed IDSMED30034168
Length (bp)926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GTP:AMP phosphotransferase, mitochondrial (SMED30034168) t-SNE clustered cells

Violin plots show distribution of expression levels for GTP:AMP phosphotransferase, mitochondrial (SMED30034168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GTP:AMP phosphotransferase, mitochondrial (SMED30034168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GTP:AMP phosphotransferase, mitochondrial (SMED30034168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034168SMESG000015204.1 Contig1038GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034168SMESG000061897.1 Contig1038GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034168SMESG000061897.1 dd_Smed_v4_699_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034168SMESG000061897.1 dd_Smed_v4_699_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30034168SMESG000061897.1 dd_Smed_v4_699_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Match: AK3 (adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17376])

HSP 1 Score: 238.424 bits (607), Expect = 6.815e-78
Identity = 108/213 (50.70%), Postives = 154/213 (72.30%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            S    + +I+GAPGSGKGT+SSRI   F +K++SSGDLLR+N+   TE+G+ A  F++ GKL+PD ++T L L E+K     + L+DG+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y+    PVL +Y+ +GV+  F G  +N+IWP V+ FL +K+
Sbjct:    4 SARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 224.557 bits (571), Expect = 1.630e-72
Identity = 98/213 (46.01%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG  LR N+   TE+G  A +++    LVPD +IT L++SE++  + ++ L+DG+PRT+ QA+ LDK   ++ VI+L+IPF+ + DRL +RW H  SGR+Y+L+FNPP + G+DD+TGEPL Q++DDKP  +A RL  Y+ +A PV+  Y+ +GV+  F G  +N+IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 224.557 bits (571), Expect = 1.630e-72
Identity = 98/213 (46.01%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG  LR N+   TE+G  A +++    LVPD +IT L++SE++  + ++ L+DG+PRT+ QA+ LDK   ++ VI+L+IPF+ + DRL +RW H  SGR+Y+L+FNPP + G+DD+TGEPL Q++DDKP  +A RL  Y+ +A PV+  Y+ +GV+  F G  +N+IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Match: AK4 (adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:363])

HSP 1 Score: 224.557 bits (571), Expect = 1.630e-72
Identity = 98/213 (46.01%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG  LR N+   TE+G  A +++    LVPD +IT L++SE++  + ++ L+DG+PRT+ QA+ LDK   ++ VI+L+IPF+ + DRL +RW H  SGR+Y+L+FNPP + G+DD+TGEPL Q++DDKP  +A RL  Y+ +A PV+  Y+ +GV+  F G  +N+IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Match: AK3 (adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17376])

HSP 1 Score: 185.267 bits (469), Expect = 9.805e-58
Identity = 92/213 (43.19%), Postives = 128/213 (60.09%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            S    + +I+GAPGSGKGT+SSRI   F +K++SSGDLLR+N+   T                                        G+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y+    PVL +Y+ +GV+  F G  +N+IWP V+ FL +K+
Sbjct:    4 SARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT----------------------------------------GFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKV 176          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Match: ZK673.2 (Probable adenylate kinase isoenzyme ZK673.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09629])

HSP 1 Score: 164.081 bits (414), Expect = 2.542e-49
Identity = 81/212 (38.21%), Postives = 129/212 (60.85%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDF---SIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            ++ L+ GA GSGKGTI+  + ++F      Y ++GD +R+++A  TE G+ A  F+N G+ VPDS++   IL+E+ K     +++DGYPR + Q K+++++  +N ++ L +P +V+IDRL K+  H ASGR Y+LE NPP+  G DDITGEPL +R  D+      RLE Y    + VL +Y+ Q       G+ S  ++  V + +   L
Sbjct:    2 YRVLLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKGEHVPDSILNGAILAEMLK-AGPRVVLDGYPRNMSQLKMVEEQAPLNLIVELKVPRKVLIDRLSKQLVHPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYKKQNKCITMSGESSKAVFESVAEVMRRDL 212          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 137.502 bits (345), Expect = 1.038e-38
Identity = 70/190 (36.84%), Postives = 114/190 (60.00%), Query Frame = 3
Query:  180 KCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNE-NLLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
            + + IG PGSGKGT +    + +   ++++GDLLR  VA+ +E G      M+ GKLV D ++  LI  +++K + +   ++DG+PRT  QA+ LD     ++  ++ V+  +I   +++ R+  R  H+ASGR YHLEF PP++   DD+TGEPL +R DD   T+  RL  Y  +  P++ +Y+  GV
Sbjct:   28 RAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGV 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 137.502 bits (345), Expect = 1.038e-38
Identity = 70/190 (36.84%), Postives = 114/190 (60.00%), Query Frame = 3
Query:  180 KCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNE-NLLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
            + + IG PGSGKGT +    + +   ++++GDLLR  VA+ +E G      M+ GKLV D ++  LI  +++K + +   ++DG+PRT  QA+ LD     ++  ++ V+  +I   +++ R+  R  H+ASGR YHLEF PP++   DD+TGEPL +R DD   T+  RL  Y  +  P++ +Y+  GV
Sbjct:   28 RAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGV 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Match: F38B2.4 (Adenylate kinase isoenzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20140])

HSP 1 Score: 82.4185 bits (202), Expect = 1.712e-18
Identity = 57/186 (30.65%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLI----LSEIKKYKNENLLIDGYPRTVEQAKVLDKE-ETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQG 728
             I+G PGSGKGT   +I   + + ++SSGDLLR+ V + +  G   +  M  G LVP  ++ DL+    L  I+K  ++  LIDGYPR V Q +  + E +    V+  D+  + ++ RL  R                 + SG           R DD   TI  RL  + +   PV+ +Y  +G
Sbjct:   24 FIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEK-GSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHRA----------------QTSG-----------RADDNADTIKKRLHTFVTSTAPVVDYYESKG 181          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 70.0922 bits (170), Expect = 3.297e-14
Identity = 46/191 (24.08%), Postives = 85/191 (44.50%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANK-TELGIHASKFMNDGKLVPDSLITDLILSEIKKYKN-ENLLIDGYPRTVEQA----KVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTD 740
             ++G PGSGKGTI ++I ++ +  ++S+GDLLR     + +E G      + +G +VP  +   L+ + +K   + +  L+DG+PR  +      K +D +  +  V+ L  P  + I+R   R                              + R DD   ++  R+E Y     P++ H+   G+V +
Sbjct:    6 FVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRG-----------------------------QGRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVRE 167          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 219.935 bits (559), Expect = 3.909e-71
Identity = 100/209 (47.85%), Postives = 143/209 (68.42%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +IIGAPGSGKGTIS  I K+    +IS+GD+LR N+   TELG  A +++ +GKLVPD+++T  +L+ I +  N + ++DG+PR + QA+ L   E I+ VI LD+P  VIIDR+K RW H  SGR+Y++ F  P++ G DD+TGEPL QR+DDKP  +A RLE Y  +  PV+  Y  +G+V  F GK + EIWP +  FL+ ++
Sbjct:    6 FRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRI 214          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339379)

HSP 1 Score: 219.935 bits (559), Expect = 3.909e-71
Identity = 100/209 (47.85%), Postives = 143/209 (68.42%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +IIGAPGSGKGTIS  I K+    +IS+GD+LR N+   TELG  A +++ +GKLVPD+++T  +L+ I +  N + ++DG+PR + QA+ L   E I+ VI LD+P  VIIDR+K RW H  SGR+Y++ F  P++ G DD+TGEPL QR+DDKP  +A RLE Y  +  PV+  Y  +G+V  F GK + EIWP +  FL+ ++
Sbjct:    6 FRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRI 214          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082330)

HSP 1 Score: 219.935 bits (559), Expect = 3.909e-71
Identity = 100/209 (47.85%), Postives = 143/209 (68.42%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +IIGAPGSGKGTIS  I K+    +IS+GD+LR N+   TELG  A +++ +GKLVPD+++T  +L+ I +  N + ++DG+PR + QA+ L   E I+ VI LD+P  VIIDR+K RW H  SGR+Y++ F  P++ G DD+TGEPL QR+DDKP  +A RLE Y  +  PV+  Y  +G+V  F GK + EIWP +  FL+ ++
Sbjct:    6 FRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRI 214          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339378)

HSP 1 Score: 219.935 bits (559), Expect = 3.909e-71
Identity = 100/209 (47.85%), Postives = 143/209 (68.42%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +IIGAPGSGKGTIS  I K+    +IS+GD+LR N+   TELG  A +++ +GKLVPD+++T  +L+ I +  N + ++DG+PR + QA+ L   E I+ VI LD+P  VIIDR+K RW H  SGR+Y++ F  P++ G DD+TGEPL QR+DDKP  +A RLE Y  +  PV+  Y  +G+V  F GK + EIWP +  FL+ ++
Sbjct:    6 FRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTKEIWPMMELFLNDRI 214          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 144.821 bits (364), Expect = 1.181e-41
Identity = 81/218 (37.16%), Postives = 129/218 (59.17%), Query Frame = 3
Query:  183 CLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAK----VLDKEET-INCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDF-VGKYSNEIWPKVHQFLSSKLKPIQ 815
             +++G PGSGKGT +  + + F + ++S+GD+LR  +++ ++LG    K M+ GKLV D L+ D+I S + K + +N  L+DG+PRTV QA+    +LDK +T ++ VI   I   +++ R+  R  H ASGR YH EF PP+    DD+TGEPL +R DD    +  RLE Y     P++ +Y L+G+       K S++++  +      K +P Q
Sbjct:   21 AILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQRK-RPAQ 237          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Match: ak3 (adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2142])

HSP 1 Score: 244.973 bits (624), Expect = 1.043e-80
Identity = 110/209 (52.63%), Postives = 155/209 (74.16%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +I+GAPGSGKGT+SSRI + F +K++SSGD+LR N+  KT+LG+     ++ G+LVPD +I+ LILS ++  +  + L+DG+PRTV QA+ LD    ++ VINLD+PFQ I +RL  RW HL SGR+Y+++FNPP+  GLDD+TGEPL QRDDD P T++ RL++Y+    PVL +YR +GV+  F G  +N+IWP VH FLS K+
Sbjct:    7 FRAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISRLILSSLRGLEKTSWLLDGFPRTVAQAEALDCVYDVDSVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLSRKI 215          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 213.772 bits (543), Expect = 1.685e-68
Identity = 94/213 (44.13%), Postives = 149/213 (69.95%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
            F+ +I+G PGSGKGTIS RI  +F +K++SSGD +R N+++KT+ G+ A  ++N G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++  INL+IP + + +RL+ RW H  SGR+Y++ FNPPRI GLDDITGE L Q++DD+P  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP ++  LS+K+  IQ
Sbjct:    5 FRAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYSWLLDGFPRTLAQAEALNSSCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTETDRIWPNINTLLSTKIPAIQ 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 213.772 bits (543), Expect = 1.685e-68
Identity = 94/213 (44.13%), Postives = 149/213 (69.95%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
            F+ +I+G PGSGKGTIS RI  +F +K++SSGD +R N+++KT+ G+ A  ++N G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++  INL+IP + + +RL+ RW H  SGR+Y++ FNPPRI GLDDITGE L Q++DD+P  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP ++  LS+K+  IQ
Sbjct:    5 FRAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYSWLLDGFPRTLAQAEALNSSCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTETDRIWPNINTLLSTKIPAIQ 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 213.772 bits (543), Expect = 1.685e-68
Identity = 94/213 (44.13%), Postives = 149/213 (69.95%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
            F+ +I+G PGSGKGTIS RI  +F +K++SSGD +R N+++KT+ G+ A  ++N G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++  INL+IP + + +RL+ RW H  SGR+Y++ FNPPRI GLDDITGE L Q++DD+P  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP ++  LS+K+  IQ
Sbjct:    5 FRAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYSWLLDGFPRTLAQAEALNSSCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTETDRIWPNINTLLSTKIPAIQ 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 213.772 bits (543), Expect = 1.685e-68
Identity = 94/213 (44.13%), Postives = 149/213 (69.95%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
            F+ +I+G PGSGKGTIS RI  +F +K++SSGD +R N+++KT+ G+ A  ++N G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++  INL+IP + + +RL+ RW H  SGR+Y++ FNPPRI GLDDITGE L Q++DD+P  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP ++  LS+K+  IQ
Sbjct:    5 FRAVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEEMTKYSWLLDGFPRTLAQAEALNSSCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTETDRIWPNINTLLSTKIPAIQ 217          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 252.677 bits (644), Expect = 1.039e-83
Identity = 116/209 (55.50%), Postives = 157/209 (75.12%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +I+G PGSGKGT+S RI K+F++K++SSGDLLR NV NKTE+G+ A  +++ G+LVPD +IT L+L E+ K    N L+DG+PRTV QA  LDK   IN VI+L++PFQ I DRL  RW H ASGR+Y+ EFNPP++  +DD+TGEPL QR+DDKP T+  RL+ Y++L  PVL +Y+ +GV+  F G  +N+IWP V+ FL SKL
Sbjct:    7 FRAVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINETNWLLDGFPRTVPQAVALDKAFHINSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETVTRRLKGYEALTRPVLEYYQNKGVLETFSGTETNKIWPHVYAFLQSKL 215          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 224.557 bits (571), Expect = 7.541e-73
Identity = 102/181 (56.35%), Postives = 138/181 (76.24%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYR 719
            F+ +I+G PGSGKGT+S RI K+F++K++SSGDLLR NV NKTE+G+ A  +++ G+LVPD +IT L+L E+ K    N L+DG+PRTV QA  LDK   IN VI+L++PFQ I DRL  RW H ASGR+Y+ EFNPP++  +DD+TGEPL QR+DDKP T+  RL+ Y++L  PVL +Y+
Sbjct:    7 FRAVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINETNWLLDGFPRTVPQAVALDKAFHINSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETVTRRLKGYEALTRPVLEYYQ 187          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Match: AK4 (adenylate kinase 4 [Source:NCBI gene;Acc:100495400])

HSP 1 Score: 222.631 bits (566), Expect = 9.038e-72
Identity = 99/213 (46.48%), Postives = 149/213 (69.95%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI K+F ++++SSGD LR N+   TE+G+ A K++  G  VPDSLIT ++L E++  K +  L+DG+PRT+ QA+ LDK   ++ VI+L+IPF+ + DRL  RW H  SGR+Y+LEFNPP + G+DDI+GEPL Q++ DKP  +  RL  Y+ +A PV+  Y+ +G++  F G  +N IWP ++  LS+K+ P+ 
Sbjct:    6 LRAVILGPPGSGKGTVCQRIAKNFGLQHLSSGDFLRQNIRASTEVGVMAKKYLEQGLPVPDSLITRVMLFELETMKTQPWLLDGFPRTLAQAEALDKICDLDLVISLNIPFETLKDRLNTRWIHQPSGRVYNLEFNPPHVQGIDDISGEPLIQQEHDKPDAVISRLRQYKDVAKPVIELYKNKGILHTFSGTETNRIWPYIYTLLSTKITPVH 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 151.754 bits (382), Expect = 4.092e-44
Identity = 71/200 (35.50%), Postives = 124/200 (62.00%), Query Frame = 3
Query:  156 RSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYK-NENLLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVT 737
            R   +   + +++G PG+GKGT + ++ + + + ++++GD+LR  VA+ +ELG+     M+ GKLV D ++ +LI   +      +  L+DG+PRTV+QA++LD     ++E ++ VI   +   +++ R+  R  H +SGR YH EFNPP+ +  DD+TGEPL +R DD   T+  RLE Y ++  P++ +Y+  G+ T
Sbjct:   11 RGSVMEGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHT 210          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 151.754 bits (382), Expect = 4.410e-44
Identity = 71/200 (35.50%), Postives = 124/200 (62.00%), Query Frame = 3
Query:  156 RSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYK-NENLLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVT 737
            R   +   + +++G PG+GKGT + ++ + + + ++++GD+LR  VA+ +ELG+     M+ GKLV D ++ +LI   +      +  L+DG+PRTV+QA++LD     ++E ++ VI   +   +++ R+  R  H +SGR YH EFNPP+ +  DD+TGEPL +R DD   T+  RLE Y ++  P++ +Y+  G+ T
Sbjct:   11 RGSVMEGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHT 210          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Match: Ak3 (adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860835])

HSP 1 Score: 242.662 bits (618), Expect = 8.625e-80
Identity = 109/209 (52.15%), Postives = 155/209 (74.16%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
             + +I+GAPGSGKGT+SSRI K F +K++SSGDLLR N+   TE+G+ A  F++ GKL+PD ++T L L E+K     + L+DG+PRT+ QA+ LDK   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y++  +PVL +Y+ +GV+  F G  +N+IWP V+ FL +K+
Sbjct:    8 LRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKTLTQCSWLLDGFPRTLPQAEALDKVYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQTKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 223.787 bits (569), Expect = 2.147e-72
Identity = 100/213 (46.95%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG LLR N+   TE+G  A +++  G LVPD +IT L++SE++    ++ L+DG+PRT+ QA+ LD    ++ VI+L+IPF+ + DRL +RW H +SGR+Y+L+FNPP++ G+DDITGEPL Q++DDKP  +A RL  Y+  A PV+  Y+ +GV+  F G  +N IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 223.787 bits (569), Expect = 2.147e-72
Identity = 100/213 (46.95%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG LLR N+   TE+G  A +++  G LVPD +IT L++SE++    ++ L+DG+PRT+ QA+ LD    ++ VI+L+IPF+ + DRL +RW H +SGR+Y+L+FNPP++ G+DDITGEPL Q++DDKP  +A RL  Y+  A PV+  Y+ +GV+  F G  +N IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 223.787 bits (569), Expect = 2.147e-72
Identity = 100/213 (46.95%), Postives = 152/213 (71.36%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
             + +I+G PGSGKGT+  RI ++F ++++SSG LLR N+   TE+G  A +++  G LVPD +IT L++SE++    ++ L+DG+PRT+ QA+ LD    ++ VI+L+IPF+ + DRL +RW H +SGR+Y+L+FNPP++ G+DDITGEPL Q++DDKP  +A RL  Y+  A PV+  Y+ +GV+  F G  +N IWP V+   S+K+ PIQ
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQHWLLDGFPRTLVQAEALDGICDVDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTETNRIWPYVYTLFSNKITPIQ 218          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 147.902 bits (372), Expect = 8.923e-43
Identity = 74/191 (38.74%), Postives = 119/191 (62.30%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
             + +++G PG+GKGT + ++ ++F + ++++GD+LR  VA+ +ELG      M+ GKLV D ++ +LI   ++    +N  L+DG+PRTV QA++LD     ++E ++ VI   I   ++I R+  R  H  SGR YH EFNPP+    DDITGEPL +R DD    +  RLE Y +   P++ +YR +G+
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGI 206          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P08760|KAD3_BOVIN (GTP:AMP phosphotransferase AK3, mitochondrial OS=Bos taurus OX=9913 GN=AK3 PE=1 SV=3)

HSP 1 Score: 246.899 bits (629), Expect = 1.322e-80
Identity = 110/213 (51.64%), Postives = 156/213 (73.24%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            S    +  I+GAPGSGKGT+SSRI K F +K++SSGDLLR+N+   TE+G+ A  F++ GKL+PD ++T L+L E+K     N L+DG+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H  SGR+Y++EFNPP+  G+DD+TGEPL QR+DD+P T+  RL+ Y++  +PVL +YR +GV+  F G  +N+IWP V+ FL +KL
Sbjct:    4 SARLLRAAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDDVMTRLVLHELKNLTQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKL 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9WTP7|KAD3_MOUSE (GTP:AMP phosphotransferase AK3, mitochondrial OS=Mus musculus OX=10090 GN=Ak3 PE=1 SV=3)

HSP 1 Score: 242.662 bits (618), Expect = 6.033e-79
Identity = 109/209 (52.15%), Postives = 155/209 (74.16%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
             + +I+GAPGSGKGT+SSRI K F +K++SSGDLLR N+   TE+G+ A  F++ GKL+PD ++T L L E+K     + L+DG+PRT+ QA+ LDK   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y++  +PVL +Y+ +GV+  F G  +N+IWP V+ FL +K+
Sbjct:    8 LRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKTLTQCSWLLDGFPRTLPQAEALDKVYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIWPHVYSFLQTKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9UIJ7|KAD3_HUMAN (GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens OX=9606 GN=AK3 PE=1 SV=4)

HSP 1 Score: 238.424 bits (607), Expect = 3.273e-77
Identity = 108/213 (50.70%), Postives = 154/213 (72.30%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            S    + +I+GAPGSGKGT+SSRI   F +K++SSGDLLR+N+   TE+G+ A  F++ GKL+PD ++T L L E+K     + L+DG+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y+    PVL +Y+ +GV+  F G  +N+IWP V+ FL +K+
Sbjct:    4 SARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5RDZ0|KAD3_PONAB (GTP:AMP phosphotransferase AK3, mitochondrial OS=Pongo abelii OX=9601 GN=AK3 PE=2 SV=3)

HSP 1 Score: 238.039 bits (606), Expect = 3.729e-77
Identity = 107/213 (50.23%), Postives = 154/213 (72.30%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            S    + +I+GAPGSGKGT+SSRI   F +K++SSGDLLR+N+   TE+G+ A  F++ GKL+PD ++T L L E+K     + L+DG+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y+    PVL +Y+ +GV+  F G  +N++WP V+ FL +K+
Sbjct:    4 SARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKVWPYVYAFLQTKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P29411|KAD3_RAT (GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=2 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 9.191e-73
Identity = 106/209 (50.72%), Postives = 150/209 (71.77%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
             + +I+GAPGSGKGT SSRI K F +K++SSGDLLR N+   TE+ + A  F++ GKL+PD  +T L L E+K     + L+DG+PRT+ QA+ LD+   I+ VINL++PF+VI  RL  RW H ASGR+Y++EFNPP+  G+DD+TGEPL QR+DDKP T+  RL+ Y++  +PVL +Y+ +GV+  F G  +N+I P V+ FL  K+
Sbjct:    8 LRAVIMGAPGSGKGTGSSRITKHFELKHLSSGDLLRQNMLQGTEIAVLAKSFIDQGKLIPDDDMTRLALHELKNLTQCSWLLDGFPRTLPQAEALDRVYQIDTVINLNVPFEVIKLRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGVLETFSGTETNKIRPHVYSFLQMKV 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Match: Q564A6 (GTP:AMP phosphotransferase, mitochondrial OS=Clonorchis sinensis OX=79923 GN=AK3 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 6.427e-92
Identity = 126/217 (58.06%), Postives = 170/217 (78.34%), Query Frame = 3
Query:  180 KCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 830
            K +I+G PGSGKGTIS RI KDF +  ISSGDLLR +VA+ + +G+ A+K+M+ G+LVPD L+T ++L E  +Y++ NLL+DG+PRTVEQAK LDKE TINCVINLD+P+  II+R+K RW HL SGRIY+ EFNPP++ GLDDITGEPL QR+DD+P T+  RLE Y  +  P+  +Y+ + ++ +F G+YSNE+WP VH+  S  LKP+Q+T+YK
Sbjct:   12 KAVILGPPGSGKGTISKRITKDFPLDCISSGDLLRAHVADNSMIGVAAAKYMSKGQLVPDDLVTKMMLQECARYRDSNLLLDGFPRTVEQAKALDKETTINCVINLDVPYDEIINRVKCRWVHLPSGRIYNTEFNPPKVPGLDDITGEPLVQREDDQPETVRARLETYGRVMKPLFDYYKSRNLLHNFRGRYSNELWPLVHKAFSQYLKPLQYTEYK 228          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Match: A0A2T7NPR2 (GTP:AMP phosphotransferase, mitochondrial OS=Pomacea canaliculata OX=400727 GN=C0Q70_16421 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 2.366e-90
Identity = 126/221 (57.01%), Postives = 172/221 (77.83%), Query Frame = 3
Query:  168 LNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 830
            L   + +I+G PGSGKGTI++RI KDF + ++SSGDLLR  + ++TE G  A K+++ G LVPD LIT L+++E++K ++E+ L+DG+PRTVEQAK L+K+E ++ VINL +PF VII+R+K RWTH  SGRIYH EFNPP+ +G+DDITGEPL QR+DDK  T+  RLE+Y+ L  PVL  YR  G+V +F G YSNEIWP+VH+FLS+  +PIQ+T Y+
Sbjct:    3 LKLLRTIIMGPPGSGKGTIATRIAKDFGLVHLSSGDLLRKQIHDETEFGREAKKYIDHGHLVPDDLITHLMIAELRKIEDESWLLDGFPRTVEQAKALEKDEPVDIVINLRVPFDVIINRIKGRWTHAKSGRIYHTEFNPPKTAGIDDITGEPLIQREDDKEETVRKRLEHYRRLTHPVLTFYRNIGIVEEFEGSYSNEIWPRVHEFLSTIKQPIQYTHYE 223          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Match: A0A0B6ZK25 (GTP:AMP phosphotransferase, mitochondrial OS=Arion vulgaris OX=1028688 GN=ORF65058 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 2.188e-87
Identity = 121/218 (55.50%), Postives = 168/218 (77.06%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 830
             + +I+GAPGSGKGTISSRI  DF +K++SSGDLLR  + +KT  G+ A +FM  G+LVPD+++  ++  E+ + +N + L+DG+PRTVEQA  L ++  I+ V+NL +PF+VIIDR+K RWTHLASGRIYH EFNPP++ GLDD+T EPL QR+DDK  T+  RLE+Y+ L  PVL ++R +G+V +F GKYSNE+WP+VH  LS  +KPI++T Y+
Sbjct:    7 LRAIIMGAPGSGKGTISSRIMHDFDVKHLSSGDLLRKQIHDKTANGLTAKRFMESGELVPDNVMLRMVTYELSQLQNTSWLLDGFPRTVEQAHALLRDYPIDVVLNLRVPFEVIIDRIKGRWTHLASGRIYHTEFNPPKVPGLDDVTNEPLVQREDDKEETVRARLEHYRRLTHPVLQYFRNKGMVDEFTGKYSNELWPQVHGSLSKLVKPIKYTHYE 224          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Match: R7VJR0 (GTP:AMP phosphotransferase, mitochondrial OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_5941 PE=3 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.455e-85
Identity = 120/217 (55.30%), Postives = 162/217 (74.65%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQY 827
             + +I+G PGSGKGTIS RI KDF +K++SSGD+LR+ +   T +GI A  F++ G LVPD ++  L+++E++  K ++ L+DG+PRTV QA+ L      + V+NL +PF+VII+R++ RW H ASGRIYH EFNPP+  G DD TG+PL QRDDDKPAT+  RLE YQ L  PVL  YR QGV+ +FVG YSNEIWPKVH++L++K +P+ FTQY
Sbjct:    6 LRTIIMGPPGSGKGTISERIVKDFDMKHLSSGDVLRSQMLKATSVGIEAKSFIDKGLLVPDDVMVKLMVTELEDLKEDSWLLDGFPRTVPQAEALQNNAPSDLVLNLAVPFEVIIERIQGRWLHAASGRIYHTEFNPPKKPGFDDETGDPLIQRDDDKPATVRARLETYQKLTQPVLDFYRSQGVLEEFVGSYSNEIWPKVHKYLATKKEPMHFTQY 222          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Match: A0A5J4NDU8 (GTP:AMP phosphotransferase, mitochondrial OS=Paragonimus westermani OX=34504 GN=DEA37_0010648 PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 4.744e-85
Identity = 122/228 (53.51%), Postives = 169/228 (74.12%), Query Frame = 3
Query:  150 MFRSRSLNS-FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 830
            M  SRSL S  K +I+G PGSGKGTIS+R+ KDF + ++SSGDLLR +VA+ T +G+ AS +MN G  VPD ++T ++L+E +KY++ +LL+DG+PRTV QAK LD E  + CV+NLD+PF  II+R+K RW HL SGRIY+ EFNPP+  G+DDITGE L QR DD+P  +  RLE YQ     +  +Y+ + ++ +F G+YSNE+WP+VH+  S  LKP+Q+T+YK
Sbjct:    1 MRLSRSLCSTVKAIILGPPGSGKGTISNRLKKDFPLTWLSSGDLLRAHVADNTTIGLTASTYMNKGLFVPDEVVTKMMLAECEKYRDSHLLLDGFPRTVAQAKALDSELVVACVLNLDVPFDEIINRIKCRWVHLPSGRIYNTEFNPPKRPGIDDITGEALIQRKDDQPDAVRTRLETYQRSMQALFDYYKSKNLLHNFRGRYSNELWPQVHKAFSEYLKPLQYTEYK 228          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:103033473])

HSP 1 Score: 243.432 bits (620), Expect = 3.562e-80
Identity = 111/216 (51.39%), Postives = 155/216 (71.76%), Query Frame = 3
Query:  168 LNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQ 815
            L  F+ +I+G PGSGKGT+S+RI   F +K++SSGD+LR N+  KTELG+     ++ G+LVPD +I+ LILS ++   + + L+DG+PRTV QA+ LD   T++ VINLD+PFQ I +RL  RW HL SGR+Y+ +FNPP+I GLDD+TGEPL QR+DD P T+  RL+ Y+    PVL +YR +GV+  F G  +N+IWP VH FL+ K+  +Q
Sbjct:    4 LRVFRAVIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRANIKAKTELGLLMKSCIDQGQLVPDDVISRLILSNLRNMDHSSWLLDGFPRTVAQAESLDSMCTVDTVINLDVPFQTIKERLTSRWLHLPSGRVYNTDFNPPKIPGLDDVTGEPLIQREDDTPETVTRRLKAYEFQTQPVLEYYRSKGVLETFSGTETNKIWPHVHTFLTRKIPHVQ 219          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 213.001 bits (541), Expect = 2.622e-68
Identity = 94/209 (44.98%), Postives = 146/209 (69.86%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +I+G PGSGKGTIS RI + F ++++SSGD LR N+A+ TE G+ A  ++  G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++ VI+L+IP + + +RL  RW H ASGR+Y++ FNPPR+ G+DDITGEPL Q+DDDKP  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP +   LS+K+
Sbjct:    5 FRAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHSWLLDGFPRTLAQAEALNSSCELDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHYKDVAKPVIDVYKAKGILHTFSDTDTDRIWPYISSLLSAKI 213          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 213.001 bits (541), Expect = 3.457e-68
Identity = 94/209 (44.98%), Postives = 146/209 (69.86%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+ +I+G PGSGKGTIS RI + F ++++SSGD LR N+A+ TE G+ A  ++  G LVPD ++T L+L  +++    + L+DG+PRT+ QA+ L+    ++ VI+L+IP + + +RL  RW H ASGR+Y++ FNPPR+ G+DDITGEPL Q+DDDKP  +  RL +Y+ +A PV+  Y+ +G++  F    ++ IWP +   LS+K+
Sbjct:   12 FRAVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTCHSWLLDGFPRTLAQAEALNSSCELDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHYKDVAKPVIDVYKAKGILHTFSDTDTDRIWPYISSLLSAKI 220          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 145.206 bits (365), Expect = 9.671e-42
Identity = 71/191 (37.17%), Postives = 118/191 (61.78%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
             + +++G PG+GKGT + R+ + F + ++++GD+LR  VA+ +ELG    + M+ GKLV D ++ +LI   +     +N  L+DG+PRTV+QA++LD     + E ++ V+   +   +++ R+  R  H  SGR YH EFNPP+    DD+TGEPL +R DD   T+  RLE+Y     P++ +Y  +G+
Sbjct:   18 IRAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKNGFLLDGFPRTVKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEHMKDDVTGEPLSRRSDDNENTLRSRLESYHRQTAPLVEYYSARGL 208          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 145.206 bits (365), Expect = 1.091e-41
Identity = 71/190 (37.37%), Postives = 118/190 (62.11%), Query Frame = 3
Query:  180 KCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
            + +++G PG+GKGT + R+ + F + ++++GD+LR  VA+ +ELG    + M+ GKLV D ++ +LI   +     +N  L+DG+PRTV+QA++LD     + E ++ V+   +   +++ R+  R  H  SGR YH EFNPP+    DD+TGEPL +R DD   T+  RLE+Y     P++ +Y  +G+
Sbjct:   19 RAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKNGFLLDGFPRTVKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEHMKDDVTGEPLSRRSDDNENTLRSRLESYHRQTAPLVEYYSARGL 208          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:321793])

HSP 1 Score: 66.6254 bits (161), Expect = 2.768e-14
Identity = 30/67 (44.78%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  537 RWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVT 737
            R  H  SGR YH EFNPP +   DD+TGEPL +R DD    +A RL +Y +   P++ +Y+ +G+ T
Sbjct:    4 RLIHKESGRSYHEEFNPPIVPMRDDVTGEPLIRRSDDNEQALASRLASYHTQTSPLVGYYQRRGLHT 70          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 59.6918 bits (143), Expect = 5.157e-11
Identity = 49/208 (23.56%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  195 GAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIH---ASKFMNDGKLVP-DSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDF-VGKYSNEIWPKVHQFLSSKL 803
            G PGSGKGT S ++++ + +  +S G++LR +V  +          ++ ++ G+L P ++ I +L    ++       +IDG+PR + QA   +++        +  P  VI+          AS R+        R+    D  G P     DD P  +  RL  ++    P++ HY+ +G++  F   +   E++  +   + S+L
Sbjct:    1 GGPGSGKGTQSRKLSESYGLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPDAPGFVIDGFPREISQALAFEEQ--------VGAPDAVIL-------LACASERLRQ------RLGERADRHGRP-----DDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELFGDIGAAVESRL 182          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: spef2 (sperm flagellar 2 [Source:NCBI gene;Acc:553375])

HSP 1 Score: 51.6026 bits (122), Expect = 1.596e-7
Identity = 26/67 (38.81%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  279 LRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLDKEET 476
            L N  +N  ELG  AS+ +  G +VPD L+  L+L  +++   +   ++DG+P TV+QAK+L+K  T
Sbjct:  575 LSNITSNVVELGRQASEVLAQGGVVPDQLLVFLVLQALRELPEQTGWILDGFPATVQQAKLLEKALT 641          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 161.384 bits (407), Expect = 4.412e-49
Identity = 85/202 (42.08%), Postives = 129/202 (63.86%), Query Frame = 3
Query:  195 GAPGSGKGTISSRINKDF-SIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLI---LSEIKKYKNENL-LIDGYPRTVEQAKVLDK-----EETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIW 770
            GAPGSGKGT +SR+ K    +  ISSGD+LR  + +++ LG  A+ ++  GKL+PD LIT LI   LS +   K   + L+DG+PRT  QA  LD+     + ++N V+ LD+P   I++R++ R+ H+ SGR+Y+L++NPP++ GLDDITGEPL +R DD       RLE Y+   +P+  +Y+  G+     G+ S+ I+
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIF 222          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 135.191 bits (339), Expect = 6.375e-39
Identity = 72/197 (36.55%), Postives = 116/197 (58.88%), Query Frame = 3
Query:  165 SLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIK---KYKNENLLIDGYPRTVEQAKVLD---KEE--TINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
            S  S + ++IG PG+GKGT +  + + F   ++++GD+LR+ +A  T+LG+ A K M+ G LV D ++ ++I  E+      KN   ++DG+PRT+ QA+ LD   KE+   +   I L +  ++++ R+  R  H ASGR YH  FNPP+    DD+TGE L QR DD    +  RL  Y +  +P++  Y+  G+
Sbjct:    3 SSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKN-GFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGI 198          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 64.6994 bits (156), Expect = 5.552e-13
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANK-TELGIHASKFMNDGKLVPDSLITDLILSEIK---KYKNENLLIDGYPRTVEQAKVLDKE-ETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVV 734
             ++G PG+GKGT   ++ KD+S  ++S+GDLLR       ++ G      + +G++VP  +   L+ + I    K      LIDG+PR ++QA   +++      ++  D P  ++++RL +R                 + SG           R DD   +I  R   ++  + PV+ ++  +  V
Sbjct:   20 FVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLERG----------------KTSG-----------RSDDNIESIKKRFNTFKETSMPVIEYFETKSKV 180          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 229.18 bits (583), Expect = 3.059e-75
Identity = 102/202 (50.50%), Postives = 147/202 (72.77%), Query Frame = 3
Query:  192 IGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSS 797
            +G PGSGKGT+S RI +DF ++++SSG+LLR++V N T+LG  A  ++  G+LVPD L+ DLIL E+   K  N L+DG+PRTV QA+ L ++  I+ V+N+D+PF  I+DR+K+RW H  SGR+Y+LEFNPP++ G DDITGEPL QR+DDKP T+  RL+ Y+    P++ +Y  +GV+  F G  +N IWP+V ++L  
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNHTDLGEEAQAYILKGELVPDELMVDLILHELDAKKG-NWLLDGFPRTVGQAETLSEKHKIDVVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETVMARLKKYEEQTKPLIEYYNKKGVLASFSGTETNVIWPRVKKYLQE 201          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 132.88 bits (333), Expect = 2.003e-37
Identity = 73/190 (38.42%), Postives = 111/190 (58.42%), Query Frame = 3
Query:  180 KCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGV 731
            + +++G PGSGKGT   R      +  +   D+LR  VA+ + LG      M+ G+LV D L+ +LI   + K + +N  L+DG+PRTV QA+ LD     +   ++ V+  +I   +++ R+  R  H +SGR YH EFNPP+    DDITGEPLE+R DD  AT+  RL+ Y S   P++ +Y  +G+
Sbjct:   16 RAILLGPPGSGKGTQVKRRRISIVVCLLFC-DMLRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTKPECQNGWLLDGFPRTVAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDITGEPLERRSDDNEATLTKRLQAYHSQTTPLIDYYTKRGI 204          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 92.0485 bits (227), Expect = 1.228e-22
Identity = 64/204 (31.37%), Postives = 98/204 (48.04%), Query Frame = 3
Query:  192 IGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLI-LSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLA--SGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYS-NEIWPKVHQFL 791
            +G PGSGKGT  +RI + F   + S+GDLLR  V + +E G +    M  G+LVP+ +I +L+ L+ +K+      LIDG+PR +EQ    +KE  +     L + F+   D +K R       SGR+                         DD   TI  RLE + +   PV+ HY+ +G V     +   +E++ KV + L
Sbjct:    1 LGGPGSGKGTQCARIVEKFGYTHFSTGDLLREEVNSGSERGKNIVAMMEKGELVPNGIILELLRLAMVKQPNTTGFLIDGFPRELEQGLEFEKELAL---CELLLYFECSPDTMKARLLKRGETSGRV-------------------------DDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVFKKVSRVL 176          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 80.1073 bits (196), Expect = 4.597e-18
Identity = 53/182 (29.12%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKN-ENLLIDGYPRTVEQAKVLDKEET-INCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQ 725
            + +G PG+GKGTI   + K ++  ++S+GDLLR  V    E G   ++ M +GKLVP  +   L+   ++++K+    LIDG+PR ++Q    +++ T  + V+ L+   +V+ +RL KR                       + +G P     DD   TI  R   +     PV+ HY  Q
Sbjct:    5 ITLGGPGAGKGTICDSVVKKYNYCHLSAGDLLREEVTRGNERGQMITEMMREGKLVPKEITIGLLQDAMREHKDMPGFLIDGFPRDIDQGITFEEQVTDSDFVLYLECTEEVMQERLLKRA----------------------ETSGRP-----DDNIETIKKRFVTFLEKTVPVVEHYEKQ 159          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 76.2554 bits (186), Expect = 1.055e-16
Identity = 53/210 (25.24%), Postives = 99/210 (47.14%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVE-----QAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYS-NEIWPKVHQFLSS 797
             ++G PG+GKGT   RI K++   ++S+G+LLR    + ++ G      M +GK+VP ++   L+   + K   +  LIDG+PR  +     ++++ DK + +  V+  + P  + I R+  R    +SG                         R DD   ++  R   +++   P++ HYR QG+V    G  + +E++ +V +   S
Sbjct:   11 FVLGGPGAGKGTQCERIVKEYGYVHLSAGELLREERRSGSKDGDLIENCMTEGKIVPVAITVSLLQKAMAKSDVQKFLIDGFPRNEDNLQGWESRMNDKVD-VKAVLFFECPEDICIGRIMSRGQ--SSG-------------------------RPDDNIESLRKRFHTHENSTMPIIEHYRRQGLVKPISGAPTPDEVFLQVKRVFES 192          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:101160331])

HSP 1 Score: 246.899 bits (629), Expect = 1.251e-81
Identity = 108/209 (51.67%), Postives = 155/209 (74.16%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
             + +I+G PGSGKGT+S+RI K F +K+ISSGD+LR N+  +TELG+     M+ G+LVPD L++ LIL ++K  ++ + L+DG+PRTV QA+ LD+  T++ VINL++PFQ I +RL  RWTH++SGR+Y+ +FNPP++ G DD+TGEPL QRDDDKP T+  RL+ Y++   PVL  YR +GVV  F G  +N+IWP V +FL  ++
Sbjct:    8 LRAVIMGPPGSGKGTVSARIVKSFGVKHISSGDILRANIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSMEHISWLLDGFPRTVSQAEALDQAYTLDTVINLNVPFQTIKERLTSRWTHISSGRVYNTDFNPPKVPGFDDVTGEPLVQRDDDKPDTVTQRLKAYETQTQPVLEFYRSKGVVKTFTGTETNKIWPHVEEFLHQRI 216          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:101175146])

HSP 1 Score: 217.624 bits (553), Expect = 5.019e-70
Identity = 97/209 (46.41%), Postives = 143/209 (68.42%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKL 803
            F+  I+G PGSGKGTIS RI + F ++Y+SSGD LR  +   TE G+    ++  G  VPD ++T L+L ++++  + + L+DG+PRT+ QA VL+    ++ VI+L+IP++ + DRL  RW H ASGR+Y++ FNPPR+ G DDITGEPL Q DDDKP  +  RL  Y+ +A PV+  Y+ QG++  F G  +N+IWP ++  LS+KL
Sbjct:    5 FRAAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHVVTGLVLPKLEQLSSHSWLLDGFPRTLAQALVLNNVYQLDLVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEALMSRLRQYKEVAKPVIDLYKTQGILHSFSGTETNKIWPYINSLLSTKL 213          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:101169712])

HSP 1 Score: 145.591 bits (366), Expect = 8.690e-42
Identity = 71/193 (36.79%), Postives = 119/193 (61.66%), Query Frame = 3
Query:  177 FKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVT 737
             + +++G PG+GKGT + R+ + + + ++++GD+LR  VA+ +ELG    + M+ GKLV D ++ +LI   +     +N  L+DG+PRTV+QA++LD     ++E ++ VI   +   +++ R+  R  H  SGR YH EFNPP+    DD+TGEPL +R DD   T+  RL+ Y     P++ +Y  +G+ T
Sbjct:   18 IRAILLGPPGAGKGTQAPRLAEKYCVCHLATGDMLRAMVASGSELGKRLKQTMDSGKLVSDEMVVELIEKNLDTAACKNGFLLDGFPRTVKQAEMLDDLLDKRQEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDVTGEPLIRRSDDNETTLRSRLDAYHRQTAPLVQYYSARGIHT 210          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 89.7373 bits (221), Expect = 3.661e-21
Identity = 67/212 (31.60%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEI--KKYKNENLLIDGYPRTVEQAKVLDKEETINC-VINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYS-NEIWPKVHQFLSSKLKP 809
             ++G PGSGKGT   RI   +   ++SSGDLLR  VA+ ++ G      M  G+LVP   + D+I   +  K   ++  LIDGYPR V+Q +  +K+    C ++ +D   + +I RL KR     SG                         R DD   TI  RL+ Y    +PV+  Y  +G+V     +   +E++ +V Q + S LKP
Sbjct:   12 FVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKRGE--TSG-------------------------RSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDS-LKP 195          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 89.7373 bits (221), Expect = 3.817e-21
Identity = 67/212 (31.60%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEI--KKYKNENLLIDGYPRTVEQAKVLDKEETINC-VINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYS-NEIWPKVHQFLSSKLKP 809
             ++G PGSGKGT   RI   +   ++SSGDLLR  VA+ ++ G      M  G+LVP   + D+I   +  K   ++  LIDGYPR V+Q +  +K+    C ++ +D   + +I RL KR     SG                         R DD   TI  RL+ Y    +PV+  Y  +G+V     +   +E++ +V Q + S LKP
Sbjct:   18 FVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIKRLLKRGE--TSG-------------------------RSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDS-LKP 201          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000061897.1 (SMESG000061897.1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.579e-168
Identity = 227/227 (100.00%), Postives = 227/227 (100.00%), Query Frame = 3
Query:  150 MFRSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 830
            MFRSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK
Sbjct:    1 MFRSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQAKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVGKYSNEIWPKVHQFLSSKLKPIQFTQYK 227          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.377e-33
Identity = 69/196 (35.20%), Postives = 113/196 (57.65%), Query Frame = 3
Query:  147 NMFRSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHY 716
            N+F S+  +S   +++G  GSGKGT + ++ + F I ++S+GD+LR  V++ + LG   ++ M  G L+ D ++  LI   +      N  ++DG+PRTV QA+ LD     +   I+ VI L     ++  R+  R  H+ SGR YH EF PP+   +DDITGE L +R DD   T+   L +Y++  +P++ +Y
Sbjct:    3 NLFISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLRSYRTEMEPLVCYY 198          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.984e-21
Identity = 61/183 (33.33%), Postives = 83/183 (45.36%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKY--KNENLLIDGYPRTVEQAKVLDKEET-INCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQ 725
             ++G PGSGKGT   +I   +   ++SSGDLLR  V + +E G    + M  G+LV   ++ DLI   + K    +   LIDGYPR +EQ K  + E     CVI   +   V+  RL KR     SGR+                         DD   TI  RL+ +  L  PV+ HY  Q
Sbjct:   20 FVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGE--TSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQ 175          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000027219.1 (SMESG000027219.1)

HSP 1 Score: 79.337 bits (194), Expect = 2.600e-16
Identity = 59/197 (29.95%), Postives = 103/197 (52.28%), Query Frame = 3
Query:  156 RSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKY--KNENLLIDGYPRTVEQAKVLDKEE-TINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPP-RISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVV 734
            R  +L + + +++G  GSGK TI++ I K +SI  ++ GDL+R  +A++ + G+    ++     VPD ++  LI   +          L+ GYP +V+QA++LD  +   N V  L++P  V ++RL +R     +G  YHL +NPP   S  + ++  P   +DD K   I  +L  Y S    +  +Y+   V+
Sbjct:  262 RLPALRTPRIILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERLCERRLDPVTGDQYHLSYNPPVNQSAFNRMSKHP---KDDVK--VIKHKLAVYNSTVIELKEYYKDHVVI 453          
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000031478.1 (SMESG000031478.1)

HSP 1 Score: 63.929 bits (154), Expect = 5.318e-12
Identity = 39/124 (31.45%), Postives = 67/124 (54.03%), Query Frame = 3
Query:  186 LIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVAN-KTELGIHASKFMNDGKLVPDSLITDLILSEIK-KYKNENLLIDGYPRTVEQ----AKVLDKEETINCVINLDIPFQVIIDRLKKR 539
            +++G PGSGKGT  ++I K+++  +IS+G LL+    N + + G       + G +VP  +   LIL E+K   K++  +IDG+PR  +        L K  ++ CV+ +D   +V   R  +R
Sbjct:   11 IVLGYPGSGKGTQCNKIEKEYNYHHISAGYLLQKETLNPQMKYGEIIKSHRSKGTIVPHEITCKLILQEMKSSQKSKKFVIDGFPRNEDNFIGWKSFLVKHCSLQCVLFIDCSEEVCRKRCLQR 134          
The following BLAST results are available for this feature:
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK36.815e-7850.70adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17... [more]
AK41.630e-7246.01adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK41.630e-7246.01adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK41.630e-7246.01adenylate kinase 4 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK39.805e-5843.19adenylate kinase 3 [Source:HGNC Symbol;Acc:HGNC:17... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZK673.22.542e-4938.21Probable adenylate kinase isoenzyme ZK673.2 [Sour... [more]
let-7541.038e-3836.84Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
let-7541.038e-3836.84Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
F38B2.41.712e-1830.65Adenylate kinase isoenzyme 1 [Source:UniProtKB/Sw... [more]
F40F8.13.297e-1424.08UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk33.909e-7147.85gene:FBgn0042094 transcript:FBtr0082331[more]
Adk33.909e-7147.85gene:FBgn0042094 transcript:FBtr0339379[more]
Adk33.909e-7147.85gene:FBgn0042094 transcript:FBtr0082330[more]
Adk33.909e-7147.85gene:FBgn0042094 transcript:FBtr0339378[more]
Adk21.181e-4137.16gene:FBgn0283494 transcript:FBtr0072163[more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak31.043e-8052.63adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.685e-6844.13adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.685e-6844.13adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.685e-6844.13adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.685e-6844.13adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak31.039e-8355.50adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak37.541e-7356.35adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
AK49.038e-7246.48adenylate kinase 4 [Source:NCBI gene;Acc:100495400... [more]
ak24.092e-4435.50adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
ak24.410e-4435.50adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak38.625e-8052.15adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860... [more]
Ak42.147e-7246.95adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak42.147e-7246.95adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak42.147e-7246.95adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak28.923e-4338.74adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08760|KAD3_BOVIN1.322e-8051.64GTP:AMP phosphotransferase AK3, mitochondrial OS=B... [more]
sp|Q9WTP7|KAD3_MOUSE6.033e-7952.15GTP:AMP phosphotransferase AK3, mitochondrial OS=M... [more]
sp|Q9UIJ7|KAD3_HUMAN3.273e-7750.70GTP:AMP phosphotransferase AK3, mitochondrial OS=H... [more]
sp|Q5RDZ0|KAD3_PONAB3.729e-7750.23GTP:AMP phosphotransferase AK3, mitochondrial OS=P... [more]
sp|P29411|KAD3_RAT9.191e-7350.72GTP:AMP phosphotransferase AK3, mitochondrial OS=R... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q564A66.427e-9258.06GTP:AMP phosphotransferase, mitochondrial OS=Clono... [more]
A0A2T7NPR22.366e-9057.01GTP:AMP phosphotransferase, mitochondrial OS=Pomac... [more]
A0A0B6ZK252.188e-8755.50GTP:AMP phosphotransferase, mitochondrial OS=Arion... [more]
R7VJR01.455e-8555.30GTP:AMP phosphotransferase, mitochondrial OS=Capit... [more]
A0A5J4NDU84.744e-8553.51GTP:AMP phosphotransferase, mitochondrial OS=Parag... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak33.562e-8051.39adenylate kinase 3 [Source:NCBI gene;Acc:103033473... [more]
ak42.622e-6844.98adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak43.457e-6844.98adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak29.671e-4237.17adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
ak21.091e-4137.37adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ak22.768e-1444.78adenylate kinase 2 [Source:NCBI gene;Acc:321793][more]
ak5l5.157e-1123.56adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
spef21.596e-738.81sperm flagellar 2 [Source:NCBI gene;Acc:553375][more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ADK24.412e-4942.08Mitochondrial adenylate kinase; catalyzes the reve... [more]
ADK16.375e-3936.55Adenylate kinase, required for purine metabolism; ... [more]
URA65.552e-1324.47Uridylate kinase; catalyzes the seventh enzymatic ... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425833.059e-7550.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305502.003e-3738.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388641.228e-2231.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388634.597e-1829.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361601.055e-1625.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak31.251e-8151.67adenylate kinase 3 [Source:NCBI gene;Acc:101160331... [more]
ak45.019e-7046.41adenylate kinase 4 [Source:NCBI gene;Acc:101175146... [more]
ak28.690e-4236.79adenylate kinase 2 [Source:NCBI gene;Acc:101169712... [more]
ak13.661e-2131.60adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak13.817e-2131.60adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
back to top
BLAST of GTP:AMP phosphotransferase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061897.11.579e-168100.00SMESG000061897.1[more]
SMESG000037481.11.377e-3335.20SMESG000037481.1[more]
SMESG000060686.15.984e-2133.33SMESG000060686.1[more]
SMESG000027219.12.600e-1629.95SMESG000027219.1[more]
SMESG000031478.15.318e-1231.45SMESG000031478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034168 ID=SMED30034168|Name=GTP:AMP phosphotransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=926bp
GTTTGAAATAAGCAATTAAATAAATAAAATACAAGTACTTTTTAAAAATA
ATAAATTTCTAATCGTGTTTTTATTAAATTTATTAAAGTTACATTCTAAA
GCTCTTTCCAAACAATTTGCTTAGAAAATAATTTTCAAAATTGTTAAATA
TGTTCAGAAGTCGCTCATTGAATTCATTTAAATGCTTGATAATTGGAGCA
CCCGGATCTGGGAAAGGTACAATTTCATCTAGAATCAATAAAGATTTCTC
AATTAAATATATATCAAGTGGAGATTTACTGCGAAATAATGTTGCAAATA
AAACTGAATTAGGAATACATGCAAGTAAATTTATGAATGACGGAAAACTA
GTTCCAGATAGTTTAATAACGGATTTAATTTTGTCAGAAATTAAAAAATA
TAAAAACGAAAATCTTTTAATCGATGGCTACCCACGAACGGTTGAACAAG
CAAAAGTGCTTGATAAAGAAGAAACTATCAACTGTGTTATAAATCTCGAT
ATTCCATTTCAAGTAATCATAGATCGATTGAAAAAACGCTGGACACATTT
AGCAAGTGGTAGAATATATCATTTAGAGTTTAATCCTCCTAGGATTTCGG
GACTGGATGATATTACCGGTGAACCATTAGAACAACGAGATGATGATAAA
CCCGCTACGATTGCTTTACGATTGGAAAATTACCAAAGCTTAGCAGATCC
CGTCTTGTATCATTATAGATTACAAGGAGTGGTAACTGATTTCGTGGGCA
AATATTCCAACGAAATTTGGCCAAAGGTTCACCAATTTCTGTCATCCAAA
CTGAAGCCGATACAGTTTACTCAATATAAATAAGAGGACTACATTCCGTA
TTTAGTATTCTTGCCAGTTATCTCCACCAATTGTGGATTGTTTGTGATTA
ATAAATCTACATATTTTAAAAAAAAA
back to top

protein sequence of SMED30034168-orf-1

>SMED30034168-orf-1 ID=SMED30034168-orf-1|Name=SMED30034168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
MFRSRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVAN
KTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNENLLIDGYPRTVEQ
AKVLDKEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRIS
GLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHYRLQGVVTDFVG
KYSNEIWPKVHQFLSSKLKPIQFTQYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0006172ADP biosynthetic process
GO:0016310phosphorylation
GO:0046033AMP metabolic process
GO:0046039GTP metabolic process
GO:0046041ITP metabolic process
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006259Adenyl_kin_sub
IPR033690Adenylat_kinase_CS
IPR036193ADK_active_lid_dom_sf
IPR000850Adenylat/UMP-CMP_kin
IPR007862Adenylate_kinase_lid-dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0019205nucleobase-containing compound kinase activity
GO:0005524ATP binding
GO:0004017adenylate kinase activity
GO:0000166nucleotide binding
GO:0005525GTP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0016776phosphotransferase activity, phosphate group as acceptor
GO:0046899nucleoside triphosphate adenylate kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 180..194
score: 23.05
coord: 89..105
score: 51.84
coord: 13..26
score: 58.6
coord: 41..55
score: 49.27
coord: 163..178
score: 45.02
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 8..222
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 13..195
e-value: 2.99375E-69
score: 208.63
IPR007862Adenylate kinase, active site lid domainPFAMPF05191ADK_lidcoord: 130..165
e-value: 3.4E-14
score: 52.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 5..223
e-value: 2.1E-69
score: 235.5
NoneNo IPR availablePFAMPF00406ADKcoord: 14..193
e-value: 6.9E-43
score: 146.6
NoneNo IPR availablePANTHERPTHR23359:SF68GTP:AMP PHOSPHOTRANSFERASE AK3, MITOCHONDRIALcoord: 8..222
IPR006259Adenylate kinase subfamilyTIGRFAMTIGR01351TIGR01351coord: 12..214
e-value: 1.0E-63
score: 212.7
IPR033690Adenylate kinase, conserved sitePROSITEPS00113ADENYLATE_KINASEcoord: 89..100
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 11..216
IPR036193Adenylate kinase, active site lid domain superfamilySUPERFAMILYSSF57774Microbial and mitochondrial ADK, insert "zinc finger" domaincoord: 130..166