SMED30034162

Overview
NameSMED30034162
Smed IDSMED30034162
Length (bp)2466
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034162 (SMED30034162) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034162 (SMED30034162) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034162 (SMED30034162) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034162 (SMED30034162) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034162

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034162h1SMcG0016099 Contig6015uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034162h1SMcG0016099 Contig6015newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30034162h1SMcG0016099 SmedASXL_014832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034162h1SMcG0016099 SmedASXL_014832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034162h1SMcG0016099 SmedASXL_025037SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034162h1SMcG0016099 SmedASXL_014833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034162h1SMcG0016099 SmedASXL_014833SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034162h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034162h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034162h1SMcG0016099 dd_Smed_v4_9264_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034162 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002855:21332..26131 +11090
Homology
BLAST of SMED30034162 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 80.4925 bits (197), Expect = 8.241e-15
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  400 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 663          
BLAST of SMED30034162 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 80.4925 bits (197), Expect = 9.003e-15
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  618 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 881          
BLAST of SMED30034162 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 80.4925 bits (197), Expect = 1.041e-14
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct:  661 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 924          
BLAST of SMED30034162 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 79.7221 bits (195), Expect = 1.827e-14
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1456 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1719          
BLAST of SMED30034162 vs. Ensembl Human
Match: ZNF106 (zinc finger protein 106 [Source:HGNC Symbol;Acc:HGNC:12886])

HSP 1 Score: 79.7221 bits (195), Expect = 1.870e-14
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1433 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1696          
BLAST of SMED30034162 vs. Ensembl Zebrafish
Match: znf106a (zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE-040718-21])

HSP 1 Score: 78.9518 bits (193), Expect = 1.777e-14
Identity = 47/197 (23.86%), Postives = 98/197 (49.75%), Query Frame = 1
Query: 1453 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            S   M+++   + + +  E +L T    E  +  +  M + N  L+  +    +R + L T +C+  ++GH S ++CLL +      +R+ SG  D+T+  + + +   ++++     +L + ++ + +Y G A G V T SL  +K++  F     + +SCL   +EG   +L VG+     SV +A + + L+ +
Sbjct: 1253 SASAMLESKVPSDMSDPGEEELPTEGDFEGHQEAVNGMHIHNGLLYTCSGDRTIRAFSLITRKCVAVFEGHSSKVNCLLVSCGGGLQQRLYSGSSDQTIRCYSLKTKECVEQLSLPDRVLCLHNRWKILYIGLANGSVITLSLRNNKQLDVFECHGPRAVSCLATAQEGARRILLVGSYDTTISVRDAKSGLLLRTL 1449          
BLAST of SMED30034162 vs. Ensembl Zebrafish
Match: znf106a (zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE-040718-21])

HSP 1 Score: 78.9518 bits (193), Expect = 1.777e-14
Identity = 47/197 (23.86%), Postives = 98/197 (49.75%), Query Frame = 1
Query: 1453 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            S   M+++   + + +  E +L T    E  +  +  M + N  L+  +    +R + L T +C+  ++GH S ++CLL +      +R+ SG  D+T+  + + +   ++++     +L + ++ + +Y G A G V T SL  +K++  F     + +SCL   +EG   +L VG+     SV +A + + L+ +
Sbjct: 1253 SASAMLESKVPSDMSDPGEEELPTEGDFEGHQEAVNGMHIHNGLLYTCSGDRTIRAFSLITRKCVAVFEGHSSKVNCLLVSCGGGLQQRLYSGSSDQTIRCYSLKTKECVEQLSLPDRVLCLHNRWKILYIGLANGSVITLSLRNNKQLDVFECHGPRAVSCLATAQEGARRILLVGSYDTTISVRDAKSGLLLRTL 1449          
BLAST of SMED30034162 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 63.929 bits (154), Expect = 1.233e-9
Identity = 38/163 (23.31%), Postives = 77/163 (47.24%), Query Frame = 1
Query: 1555 ITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +  +++    L+  ++   +R Y+L T +C+  ++GH S ++CL+ T        + +G  D T+  + + +            +L    + + ++ G A G V TFSL+  K+   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1359 VNTVQIHQGLLYTCSADKTVRVYNLTTRQCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1521          
BLAST of SMED30034162 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 63.5438 bits (153), Expect = 1.367e-9
Identity = 38/163 (23.31%), Postives = 77/163 (47.24%), Query Frame = 1
Query: 1555 ITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +  +++    L+  ++   +R Y+L T +C+  ++GH S ++CL+ T        + +G  D T+  + + +            +L    + + ++ G A G V TFSL+  K+   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1457 VNTVQIHQGLLYTCSADKTVRVYNLTTRQCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1619          
BLAST of SMED30034162 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 63.5438 bits (153), Expect = 1.496e-9
Identity = 38/163 (23.31%), Postives = 77/163 (47.24%), Query Frame = 1
Query: 1555 ITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +  +++    L+  ++   +R Y+L T +C+  ++GH S ++CL+ T        + +G  D T+  + + +            +L    + + ++ G A G V TFSL+  K+   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1341 VNTVQIHQGLLYTCSADKTVRVYNLTTRQCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1503          
BLAST of SMED30034162 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 55.4546 bits (132), Expect = 3.766e-7
Identity = 37/164 (22.56%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1555 ITDMKVFNNRLFVSASHGLLRQYHLG-THECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +  +++    L+  ++   +R Y+L  +  C+  ++GH S ++CL+ T        + +G  D T+  + + +            +L    + + ++ G A G V TFSL+  K+   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct:  625 VNTVQIHQGLLYTCSADKTVRVYNLTVSCLCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 788          
BLAST of SMED30034162 vs. Ensembl Xenopus
Match: znf106 (zinc finger protein 106 [Source:NCBI gene;Acc:100145205])

HSP 1 Score: 54.299 bits (129), Expect = 9.235e-7
Identity = 37/164 (22.56%), Postives = 76/164 (46.34%), Query Frame = 1
Query: 1555 ITDMKVFNNRLFVSASHGLLRQYHLG-THECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +  +++    L+  ++   +R Y+L  +  C+  ++GH S ++CL+ T        + +G  D T+  + + +            +L    + + ++ G A G V TFSL+  K+   F     + +SC+   +EG+  LL VG+     SV +A   + L+ +
Sbjct: 1368 VNTVQIHQGLLYTCSADKTVRVYNLTVSCLCVAVFEGHTSKVNCLVVTCTYKKSLAVFTGSSDHTIRCYSVKTREFQTAWNLGERVLCFHVRWKILFAGLANGNVVTFSLKSKKQTDVFECHGPRAVSCMATAQEGSRKLLLVGSYDCTISVRDACNGLLLRTL 1531          
BLAST of SMED30034162 vs. Ensembl Mouse
Match: Zfp106 (zinc finger protein 106 [Source:MGI Symbol;Acc:MGI:1270153])

HSP 1 Score: 79.7221 bits (195), Expect = 1.406e-14
Identity = 46/170 (27.06%), Postives = 91/170 (53.53%), Query Frame = 1
Query: 1537 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            E  +  +  +++F N L+  ++   +R Y+L + +C+  ++GH S ++CLL T H  G   +L +G  D T+  ++I +   +++++ +  +L + ++   +Y G A G V TF ++ +KR   F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1510 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1678          
BLAST of SMED30034162 vs. Ensembl Mouse
Match: Zfp106 (zinc finger protein 106 [Source:MGI Symbol;Acc:MGI:1270153])

HSP 1 Score: 79.337 bits (194), Expect = 1.522e-14
Identity = 46/170 (27.06%), Postives = 91/170 (53.53%), Query Frame = 1
Query: 1537 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            E  +  +  +++F N L+  ++   +R Y+L + +C+  ++GH S ++CLL T H  G   +L +G  D T+  ++I +   +++++ +  +L + ++   +Y G A G V TF ++ +KR   F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1533 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1701          
BLAST of SMED30034162 vs. UniProt/SwissProt
Match: sp|Q9H2Y7|ZN106_HUMAN (Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.978e-14
Identity = 67/274 (24.45%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1231 LQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINI--KNNIPKCV-DTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            L+  A+  S   +  P   S KD   ++      TS      V S S+I    K+ IP  V +T  ++ S +    +S +     D+        EP   +    E  +  +  +++F N L+  ++   +R Y+L + +CI  ++GH S ++CLL T        + +G  D T+  +++ S   +++++ +  +L +  +   +Y G A G V TF+++ +KR+  F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1433 LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVSVAETQTVISSIKGSKNSSEISSEPGDDD-------EPTEGSF---EGHQAAVNAIQIFGNLLYTCSADKTVRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQLQLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1696          
BLAST of SMED30034162 vs. UniProt/SwissProt
Match: sp|O88466|ZN106_MOUSE (Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3)

HSP 1 Score: 79.337 bits (194), Expect = 1.273e-13
Identity = 46/170 (27.06%), Postives = 91/170 (53.53%), Query Frame = 1
Query: 1537 EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRIL-SGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            E  +  +  +++F N L+  ++   +R Y+L + +C+  ++GH S ++CLL T H  G   +L +G  D T+  ++I +   +++++ +  +L + ++   +Y G A G V TF ++ +KR   F     + +SCL   +EG   LL VG+     SV +A   + L+ +
Sbjct: 1533 EGHQAAVNAIQIFGNFLYTCSADTTVRVYNLVSRKCVGVFEGHTSKVNCLLVT-HTSGKSSVLYTGSSDHTIRCYNIKTRECMEQLQLEDRVLCLHNRWRTLYAGLANGTVVTFDIKNNKRQEIFECHGPRAVSCLATAQEGARKLLVVGSYDCTISVRDARNGLLLRTL 1701          
BLAST of SMED30034162 vs. TrEMBL
Match: A0A2D0RL50 (zinc finger protein 106 OS=Ictalurus punctatus OX=7998 GN=znf106 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.456e-15
Identity = 56/214 (26.17%), Postives = 114/214 (53.27%), Query Frame = 1
Query: 1405 VDTCFLLGSAQTDLPNSLLVMVKAD-EQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +DT  ++ S ++    +L VM ++    N   +A E ++ T    E  +  +  M++ N+ LF  +    +R ++L + +C+  + GH S ++CL+ +  P   +R+ SG  D+T+  ++I + A +Q++     +L + ++ + +Y G A G V TFSL+ +K++  F     + +SCL   +EG   +L VG+     SV +A + + L+ +
Sbjct: 1299 IDTSSVVTSCKSAKNLTLAVMKESKASSNASSDAGEEEMPTEGSFEGHQEAVNGMQIHNDLLFTCSGDRTIRAFNLMSRKCVAVFDGHSSKVNCLVVSSGPGLPQRLYSGSSDQTIRCYNIKTRACVQQLSLSDRVLCLHNRWKVLYAGLANGSVVTFSLKNNKQLDVFECHGPRAVSCLATVQEGARRVLLVGSYDTTISVRDAKSGLLLRTL 1512          
BLAST of SMED30034162 vs. TrEMBL
Match: A0A1A7XDS1 (WD_REPEATS_REGION domain-containing protein OS=Iconisemion striatum OX=60296 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.037e-15
Identity = 60/240 (25.00%), Postives = 117/240 (48.75%), Query Frame = 1
Query: 1324 APVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            AP   S   P   + +KIN  +++  C        S+++D P    V +  +  + L +  + +L T  + +  +  +  +++ N  L+  ++   +R + L +HEC+  ++GH S + CLL +  P    R+ S   DKT+  + + +  + Q+      +L +  + + +Y G A G V TF+L  +K+M  F     +G+SCL +++EG   +L VG+     SV  A   + L+ +
Sbjct: 1236 APAPPSALEPQSLACNKINSTSDMDLC-------KSSESDFP--FAVTLPKNSSDALSDQCDDELLTEGVFDGHQEVVNALQIHNGLLYTCSADRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPCLHHRLYSASSDKTIRCYSLKTRELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSYDSTISVRAAKHGLLLRTL 1466          
BLAST of SMED30034162 vs. TrEMBL
Match: A0A1A7YPI5 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Iconisemion striatum OX=60296 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.768e-15
Identity = 60/240 (25.00%), Postives = 117/240 (48.75%), Query Frame = 1
Query: 1324 APVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            AP   S   P   + +KIN  +++  C        S+++D P    V +  +  + L +  + +L T  + +  +  +  +++ N  L+  ++   +R + L +HEC+  ++GH S + CLL +  P    R+ S   DKT+  + + +  + Q+      +L +  + + +Y G A G V TF+L  +K+M  F     +G+SCL +++EG   +L VG+     SV  A   + L+ +
Sbjct:  963 APAPPSALEPQSLACNKINSTSDMDLC-------KSSESDFP--FAVTLPKNSSDALSDQCDDELLTEGVFDGHQEVVNALQIHNGLLYTCSADRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPCLHHRLYSASSDKTIRCYSLKTRELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSYDSTISVRAAKHGLLLRTL 1193          
BLAST of SMED30034162 vs. TrEMBL
Match: A0A1A8CW20 (WD_REPEATS_REGION domain-containing protein OS=Nothobranchius kadleci OX=1051664 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.134e-14
Identity = 54/213 (25.35%), Postives = 109/213 (51.17%), Query Frame = 1
Query: 1405 VDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +D C    S+++DLP  L V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HEC+  ++GH S + CLL +  P   +R+ S   D+T+  + + +  + Q+      +L +  + + +Y G A G V TF+L  +K+M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1229 MDVC---KSSESDLP--LAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1436          
BLAST of SMED30034162 vs. TrEMBL
Match: A0A1A8DCZ2 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Nothobranchius kadleci OX=1051664 GN=WDR86 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.246e-14
Identity = 54/213 (25.35%), Postives = 109/213 (51.17%), Query Frame = 1
Query: 1405 VDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +D C    S+++DLP  L V +  +  +   +  + +L T  + +  +  +  +++ N  L+  +    +R + L +HEC+  ++GH S + CLL +  P   +R+ S   D+T+  + + +  + Q+      +L +  + + +Y G A G V TF+L  +K+M  F     +G+SCL +++EG   +L VG++    SV  A   + L+ +
Sbjct: 1106 MDVC---KSSESDLP--LAVTLPKNSSDVFSDQCDDELPTEGVFDGHREVVNALQIQNGLLYTCSGDRTVRAFDLVSHECVGVFEGHSSKVTCLLISTAPSLYRRLYSASCDQTIRCYSLKTQELEQQFSLPDRVLCLHSRWKTLYAGLANGTVVTFNLRTNKQMDVFECHGPRGVSCLASSQEGAQRILLVGSSDSTISVRAAKHGLLLRTL 1313          
BLAST of SMED30034162 vs. Ensembl Nematostella
Match: EDO49439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK1])

HSP 1 Score: 49.2914 bits (116), Expect = 3.856e-6
Identity = 42/187 (22.46%), Postives = 79/187 (42.25%), Query Frame = 1
Query: 1528 TISEVKK--TFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIE----------------NDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLK 2034
            TI E++    +I  +   +   F  AS   +R++ L T  CI  +KGH S +H +L          + S  +DKT  +   D+G  ++  +                N    + + +  + +  G+A+     + +  ++ M++F+  +  I CL    +G   LLF G++      W+  TY  LK
Sbjct:   66 TIGELQGHVGYINGVCASDKYAFTCASDKTIRKWSLETGRCIKVFKGHASTVHRVLYVCDF-----LFSTSYDKTAKLWQADTGECVRTFKGHKRGVYPLIFVPSEINRGTYIDLDNNDDILVTGSADNTAKAWGMNSNECMNTFKGHEGAILCLAV--DGKGRLLFTGSSDSTIRSWDLHTYSPLK 245          
BLAST of SMED30034162 vs. Ensembl Medaka
Match: znf106a (zinc finger protein 106 [Source:NCBI gene;Acc:101165188])

HSP 1 Score: 77.0258 bits (188), Expect = 7.547e-14
Identity = 48/209 (22.97%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1453 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITD------------MKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASD-KGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            S + + K+ E +  ++ V P+ S+++         T+            M + +  L+  +    +R + L TH+C+   +GH S + CLL +  P    R+ SG  D+++  + + +  + Q+      +L +  +   +Y G A G V TF L+ +K+M  +     +G+SCL  ++EG   +L VG+     +V +A + +  + +
Sbjct: 1535 SDMDLCKSSESDFPFSVVHPRNSSVSSDHGGDQGPTEGAFSGHQEAVNGMDIHDGLLYTCSGDRTVRVFDLVTHQCVGVMEGHASKVTCLLVSASPSLPHRLYSGSSDQSIRCYSLQTRELEQQFVVSERVLCLHSRWTLLYAGLANGSVVTFDLKTNKQMDVWDCHGLRGVSCLATSQEGACRILLVGSYDSTITVRDAGSGLLFRTL 1743          
BLAST of SMED30034162 vs. Ensembl Medaka
Match: znf106a (zinc finger protein 106 [Source:NCBI gene;Acc:101165188])

HSP 1 Score: 77.0258 bits (188), Expect = 7.668e-14
Identity = 48/209 (22.97%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1453 SLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITD------------MKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASD-KGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            S + + K+ E +  ++ V P+ S+++         T+            M + +  L+  +    +R + L TH+C+   +GH S + CLL +  P    R+ SG  D+++  + + +  + Q+      +L +  +   +Y G A G V TF L+ +K+M  +     +G+SCL  ++EG   +L VG+     +V +A + +  + +
Sbjct: 1524 SDMDLCKSSESDFPFSVVHPRNSSVSSDHGGDQGPTEGAFSGHQEAVNGMDIHDGLLYTCSGDRTVRVFDLVTHQCVGVMEGHASKVTCLLVSASPSLPHRLYSGSSDQSIRCYSLQTRELEQQFVVSERVLCLHSRWTLLYAGLANGSVVTFDLKTNKQMDVWDCHGLRGVSCLATSQEGACRILLVGSYDSTITVRDAGSGLLFRTL 1732          
BLAST of SMED30034162 vs. Ensembl Medaka
Match: ENSORLT00000015533.2 (zinc finger protein 106-like [Source:NCBI gene;Acc:101157503])

HSP 1 Score: 75.485 bits (184), Expect = 2.010e-13
Identity = 44/160 (27.50%), Postives = 82/160 (51.25%), Query Frame = 1
Query: 1564 MKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +++ +  L+  ++    R Y+L T EC   ++GH + ++CLL ++ P    R+ +G  D+T+  + + S   LQ+I     +L +      +Y G A G V ++ L+  K +  F     +G+SCL   +EG   LL VG+     SV +A + + L+ +
Sbjct:  977 LQIHDGILYTCSADNTARAYNLVTRECQAVFQGHTNKVNCLLVSIVPYLPARLYTGSSDQTIRCYSLKSKRCLQQISLPDRVLCLHVAWNILYAGLASGSVFSYDLKTLKELDVFECHGPRGVSCLGTAQEGARRLLLVGSYDSTISVRDAKSGLLLRSL 1136          
BLAST of SMED30034162 vs. Ensembl Medaka
Match: ENSORLT00000034363.1 (zinc finger protein 106-like [Source:NCBI gene;Acc:101157503])

HSP 1 Score: 75.0998 bits (183), Expect = 2.709e-13
Identity = 44/160 (27.50%), Postives = 82/160 (51.25%), Query Frame = 1
Query: 1564 MKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRA-SDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKII 2040
            +++ +  L+  ++    R Y+L T EC   ++GH + ++CLL ++ P    R+ +G  D+T+  + + S   LQ+I     +L +      +Y G A G V ++ L+  K +  F     +G+SCL   +EG   LL VG+     SV +A + + L+ +
Sbjct:  942 LQIHDGILYTCSADNTARAYNLVTRECQAVFQGHTNKVNCLLVSIVPYLPARLYTGSSDQTIRCYSLKSKRCLQQISLPDRVLCLHVAWNILYAGLASGSVFSYDLKTLKELDVFECHGPRGVSCLGTAQEGARRLLLVGSYDSTISVRDAKSGLLLRSL 1101          
BLAST of SMED30034162 vs. Planmine SMEST
Match: SMESG000069576.1 (SMESG000069576.1)

HSP 1 Score: 1360.51 bits (3520), Expect = 0.000e+0
Identity = 733/800 (91.62%), Postives = 751/800 (93.88%), Query Frame = 1
Query:   37 MSYRQFDK-------------YYEXXXXXXXXXXXXXXXXXXPIISNYYDPRRYNEPYNNHNRTIYPETRTPRLESKPAYVTHKHTYHSSRWGPPTTNSDSFHNLSSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIXXXXXXXXXXXXXXXAEQGESGSAVAANRAVXXXXXXXXXXXXGPDVPQVAVGKNDRRAFQXXXXXXXXXXXXXXVQAAVGKPPPPPLQLQHAXXXXXXXXXNEEQSLQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 2397
            MSYRQFDK             Y    RNHNYNNDNRNLNRNLPIISNYYDPRRYNEPYNNHNRTIYPETRT RLESKPAY THKHTY +SRWGPPTTNSDSFHN+SSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIENDDD     P    AEQGESGSAVAANRAVSISSSDSCSSSDGPDVPQVAVGKNDRRAFQSSMSESDSDSDSSDVQAAVGKPPP  LQLQHADSSSSDCDS+EEQS QPTAVVISNLAKSN AQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIKNNIP+CVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHE IMDYKGHQSLIHCLLPTVHPVGVKRILSGG D  LFVHDIDSG IL +I + SAILSICD L+FVYYGTAEGKVATFSLEK++ MSSF ASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSH+E+P +FIVLQKQRLLAYTRNNVHFIQY K +STSTFNHFD+IS+LCLTRNY I+GGV GK+S+YKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES
Sbjct:    1 MSYRQFDKLIYFFKLIRLIIKYLGITRNHNYNNDNRNLNRNLPIISNYYDPRRYNEPYNNHNRTIYPETRTSRLESKPAYGTHKHTYQASRWGPPTTNSDSFHNISSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIENDDDSESEPPNGE-AEQGESGSAVAANRAVSISSSDSCSSSDGPDVPQVAVGKNDRRAFQSSMSESDSDSDSSDVQAAVGKPPP--LQLQHADSSSSDCDSDEEQSQQPTAVVISNLAKSNQAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIKNNIPECVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 797          
BLAST of SMED30034162 vs. Planmine SMEST
Match: SMESG000069576.1 (SMESG000069576.1)

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 720/800 (90.00%), Postives = 737/800 (92.12%), Query Frame = 1
Query:   37 MSYRQFDK-------------YYEXXXXXXXXXXXXXXXXXXPIISNYYDPRRYNEPYNNHNRTIYPETRTPRLESKPAYVTHKHTYHSSRWGPPTTNSDSFHNLSSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIXXXXXXXXXXXXXXXAEQGESGSAVAANRAVXXXXXXXXXXXXGPDVPQVAVGKNDRRAFQXXXXXXXXXXXXXXVQAAVGKPPPPPLQLQHAXXXXXXXXXNEEQSLQPTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 2397
            MSYRQFDK             Y    RNHNYNNDNRNLNRNLPIISNYYDPRRYNEPYNNHNRTIYPETRT RLESKPAY THKHTY +SRWGPPTTNSDSFHN+SSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIENDDD     P    AEQGESGSAVAANRAVSISSSDSCSSSDGPDVPQVAVGKNDRRAFQSSMSESDSDSDSSDVQAAVGKPPP  LQLQHADSSSSDCDS+EEQS QPTAVVISNLAKSN AQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIK              SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHE IMDYKGHQSLIHCLLPTVHPVGVKRILSGG D  LFVHDIDSG IL +I + SAILSICD L+FVYYGTAEGKVATFSLEK++ MSSF ASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSH+E+P +FIVLQKQRLLAYTRNNVHFIQY K +STSTFNHFD+IS+LCLTRNY I+GGV GK+S+YKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES
Sbjct:    1 MSYRQFDKLIYFFKLIRLIIKYLGITRNHNYNNDNRNLNRNLPIISNYYDPRRYNEPYNNHNRTIYPETRTSRLESKPAYGTHKHTYQASRWGPPTTNSDSFHNISSQRYNTNTSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIENDDDSESEPPNGE-AEQGESGSAVAANRAVSISSSDSCSSSDGPDVPQVAVGKNDRRAFQSSMSESDSDSDSSDVQAAVGKPPP--LQLQHADSSSSDCDSDEEQSQQPTAVVISNLAKSNQAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIKR-------------SAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHEWIMDYKGHQSLIHCLLPTVHPVGVKRILSGGCDMALFVHDIDSGTILHRIADSSAILSICDLLDFVYYGTAEGKVATFSLEKNREMSSFHASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHVEVPYEFIVLQKQRLLAYTRNNVHFIQYTKIRSTSTFNHFDTISTLCLTRNYAIVGGVNGKLSIYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 784          
BLAST of SMED30034162 vs. Planmine SMEST
Match: SMESG000052755.1 (SMESG000052755.1)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 449/712 (63.06%), Postives = 521/712 (73.17%), Query Frame = 1
Query:  370 YKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIXXXXXXXXXXXXXXXAEQGESG----SAVA-----------------ANRAVXXXXXXXXXXXXGPDVPQVAVGKNDRR-AFQXXXXXXXXXXXXXXVQAAVGKPPPPPLQLQHAXXXXXXXXXNEEQSLQPTAVVISNLAKSNPAQ---SSHKDTNQA-----------SRLGAPVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 2397
            +K NLP  F E N   SMN  R  T NR      +N    + K  EN +S + S  N    +NLNKR+N LSM E  K S   D++    N P+KK K++++STN + Q + + S +N+ +K+L+AYGKE AK+ QE+N LL +YR + +E+M+KF+A+RE K+++KT+  KMK IC+ IE +DD            +   G     +VA                 A   +   +  + SSS G DV  +AV ++ RR +  S+ S SDSDS +SDVQ   G    PP+             ++++Q  Q TAVV  N A  NP Q   SSH+D  ++           S L  P+ SS S    KSESKINIKN IP+CVDT F+L + QTDL ++L VM+KAD +NGL++A+EPKL+TI IS+ +KTFITD+KVFNNRLF SASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEG VATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGK+YFNRLVES
Sbjct:   94 FKLNLPQQFNEYNVPVSMNKPR--TANRDY---KDNTHLGIIKPDENPLSIKSSKQNLSTTENLNKRRNELSMEEALKLSASIDSN----NQPEKKIKVDRESTNYDIQSDAKFSKKNRLLKELEAYGKESAKMGQEVNELLDEYRGMAKETMKKFDAFREKKIQQKTMKAKMKKICRAIEKEDDSESDSSGVDANIRSIGGEMNIGSVAGSSDSSDGSDVQMVELPATGRIGSRNISTSSSSTGSDVLLIAVDESGRRISVSSTSSSSDSDSHNSDVQVVSGVLQQPPI-----------ASNSDDQRQQRTAVVNGNTA--NPDQVVPSSHEDIKESPQTRKLLPTSSSALNTPIISSDSFAIEKSESKINIKNRIPECVDTSFMLETPQTDLSSNLHVMMKADGENGLFHAIEPKLNTIIISDEEKTFITDIKVFNNRLFASASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGLVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKVYFNRLVES 783          
BLAST of SMED30034162 vs. Planmine SMEST
Match: SMESG000052755.1 (SMESG000052755.1)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 449/712 (63.06%), Postives = 521/712 (73.17%), Query Frame = 1
Query:  370 YKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIXXXXXXXXXXXXXXXAEQGESG----SAVA-----------------ANRAVXXXXXXXXXXXXGPDVPQVAVGKNDRR-AFQXXXXXXXXXXXXXXVQAAVGKPPPPPLQLQHAXXXXXXXXXNEEQSLQPTAVVISNLAKSNPAQ---SSHKDTNQA-----------SRLGAPVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 2397
            +K NLP  F E N   SMN  R  T NR      +N    + K  EN +S + S  N    +NLNKR+N LSM E  K S   D++    N P+KK K++++STN + Q + + S +N+ +K+L+AYGKE AK+ QE+N LL +YR + +E+M+KF+A+RE K+++KT+  KMK IC+ IE +DD            +   G     +VA                 A   +   +  + SSS G DV  +AV ++ RR +  S+ S SDSDS +SDVQ   G    PP+             ++++Q  Q TAVV  N A  NP Q   SSH+D  ++           S L  P+ SS S    KSESKINIKN IP+CVDT F+L + QTDL ++L VM+KAD +NGL++A+EPKL+TI IS+ +KTFITD+KVFNNRLF SASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEG VATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGK+YFNRLVES
Sbjct:   98 FKLNLPQQFNEYNVPVSMNKPR--TANRDY---KDNTHLGIIKPDENPLSIKSSKQNLSTTENLNKRRNELSMEEALKLSASIDSN----NQPEKKIKVDRESTNYDIQSDAKFSKKNRLLKELEAYGKESAKMGQEVNELLDEYRGMAKETMKKFDAFREKKIQQKTMKAKMKKICRAIEKEDDSESDSSGVDANIRSIGGEMNIGSVAGSSDSSDGSDVQMVELPATGRIGSRNISTSSSSTGSDVLLIAVDESGRRISVSSTSSSSDSDSHNSDVQVVSGVLQQPPI-----------ASNSDDQRQQRTAVVNGNTA--NPDQVVPSSHEDIKESPQTRKLLPTSSSALNTPIISSDSFAIEKSESKINIKNRIPECVDTSFMLETPQTDLSSNLHVMMKADGENGLFHAIEPKLNTIIISDEEKTFITDIKVFNNRLFASASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGLVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKVYFNRLVES 787          
BLAST of SMED30034162 vs. Planmine SMEST
Match: SMESG000052755.1 (SMESG000052755.1)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 449/712 (63.06%), Postives = 521/712 (73.17%), Query Frame = 1
Query:  370 YKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTAEVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDGSNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMNALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIXXXXXXXXXXXXXXXAEQGESG----SAVA-----------------ANRAVXXXXXXXXXXXXGPDVPQVAVGKNDRR-AFQXXXXXXXXXXXXXXVQAAVGKPPPPPLQLQHAXXXXXXXXXNEEQSLQPTAVVISNLAKSNPAQ---SSHKDTNQA-----------SRLGAPVTSSGSLPAVKSESKINIKNNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITISEVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES 2397
            +K NLP  F E N   SMN  R  T NR      +N    + K  EN +S + S  N    +NLNKR+N LSM E  K S   D++    N P+KK K++++STN + Q + + S +N+ +K+L+AYGKE AK+ QE+N LL +YR + +E+M+KF+A+RE K+++KT+  KMK IC+ IE +DD            +   G     +VA                 A   +   +  + SSS G DV  +AV ++ RR +  S+ S SDSDS +SDVQ   G    PP+             ++++Q  Q TAVV  N A  NP Q   SSH+D  ++           S L  P+ SS S    KSESKINIKN IP+CVDT F+L + QTDL ++L VM+KAD +NGL++A+EPKL+TI IS+ +KTFITD+KVFNNRLF SASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEG VATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGK+YFNRLVES
Sbjct:   96 FKLNLPQQFNEYNVPVSMNKPR--TANRDY---KDNTHLGIIKPDENPLSIKSSKQNLSTTENLNKRRNELSMEEALKLSASIDSN----NQPEKKIKVDRESTNYDIQSDAKFSKKNRLLKELEAYGKESAKMGQEVNELLDEYRGMAKETMKKFDAFREKKIQQKTMKAKMKKICRAIEKEDDSESDSSGVDANIRSIGGEMNIGSVAGSSDSSDGSDVQMVELPATGRIGSRNISTSSSSTGSDVLLIAVDESGRRISVSSTSSSSDSDSHNSDVQVVSGVLQQPPI-----------ASNSDDQRQQRTAVVNGNTA--NPDQVVPSSHEDIKESPQTRKLLPTSSSALNTPIISSDSFAIEKSESKINIKNRIPECVDTSFMLETPQTDLSSNLHVMMKADGENGLFHAIEPKLNTIIISDEEKTFITDIKVFNNRLFASASHGLLRQYHLGTHECIMDYKGHQSLIHCLLPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEFVYYGTAEGLVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGANTGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQYVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPIRTITNSNSPVVSLTFYNNTIITGDKTGKVYFNRLVES 785          
The following BLAST results are available for this feature:
BLAST of SMED30034162 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF1068.241e-1524.45zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1069.003e-1524.45zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1061.041e-1424.45zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1061.827e-1424.45zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1061.870e-1424.45zinc finger protein 106 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30034162 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034162 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034162 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf106a1.777e-1423.86zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE... [more]
znf106a1.777e-1423.86zinc finger protein 106a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30034162 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf1061.233e-923.31zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
znf1061.367e-923.31zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
znf1061.496e-923.31zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
znf1063.766e-722.56zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
znf1069.235e-722.56zinc finger protein 106 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of SMED30034162 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zfp1061.406e-1427.06zinc finger protein 106 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1061.522e-1427.06zinc finger protein 106 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30034162 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9H2Y7|ZN106_HUMAN8.978e-1424.45Zinc finger protein 106 OS=Homo sapiens OX=9606 GN... [more]
sp|O88466|ZN106_MOUSE1.273e-1327.06Zinc finger protein 106 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of SMED30034162 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D0RL503.456e-1526.17zinc finger protein 106 OS=Ictalurus punctatus OX=... [more]
A0A1A7XDS18.037e-1525.00WD_REPEATS_REGION domain-containing protein OS=Ico... [more]
A0A1A7YPI59.768e-1525.00WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A1A8CW201.134e-1425.35WD_REPEATS_REGION domain-containing protein OS=Not... [more]
A0A1A8DCZ21.246e-1425.35WD_REPEATS_REGION domain-containing protein (Fragm... [more]
back to top
BLAST of SMED30034162 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034162 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034162 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034162 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO494393.856e-622.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30034162 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
znf106a7.547e-1422.97zinc finger protein 106 [Source:NCBI gene;Acc:1011... [more]
znf106a7.668e-1422.97zinc finger protein 106 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000015533.22.010e-1327.50zinc finger protein 106-like [Source:NCBI gene;Acc... [more]
ENSORLT00000034363.12.709e-1327.50zinc finger protein 106-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of SMED30034162 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069576.10.000e+091.63SMESG000069576.1[more]
SMESG000069576.10.000e+090.00SMESG000069576.1[more]
SMESG000052755.10.000e+063.06SMESG000052755.1[more]
SMESG000052755.10.000e+063.06SMESG000052755.1[more]
SMESG000052755.10.000e+063.06SMESG000052755.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034162 ID=SMED30034162|Name=SMED30034162|organism=Schmidtea mediterranea sexual|type=transcript|length=2466bp
TTCCTTTGAATTAAGTAGTTATTTAAGAATTATTTAATGTCATATAGACA
ATTTGACAAGTATTACGAGGATTATAGGAATCACAATTATAATAACGATA
ACAGAAACTTAAATCGTAATTTACCTATTATTTCAAATTACTATGATCCA
AGAAGATATAATGAGCCTTACAATAATCATAATAGAACTATTTACCCAGA
AACAAGAACGCCAAGATTAGAGTCTAAACCGGCCTACGTCACACACAAGC
ACACCTATCACTCATCTAGATGGGGTCCTCCAACCACTAACAGTGATTCG
TTTCATAATCTTTCTAGTCAAAGATACAATACTAACACATCTAACGAAGT
ACGAATAAATATAAATACTTATAAACCAAATCTTCCAATACATTTTACTG
AACGAAATACGAAACCTTCAATGAATGATCTCAGAAAAATGACTACAAAC
CGACAAGAATTTATTGAAAACAACAATAAAACTGCAGAAGTTGCCAAAAA
AATTGAAAATTCCGTTTCAACGGAATTCAGCAATTCAAATCGACCTCCAC
TGGATAATTTAAATAAAAGAAAAAACCATTTATCCATGGGAGAAGAGCCA
AAACCATCAACACTCACTGATACCGATGAAGATGGATCAAATCCACCGAA
AAAGAAACCGAAAATCGAACAAGATTCCACAAATGGTAACACGCAACCGA
ACGAGGAATTATCGATGGAAAATCAGCAAATAAAAGATCTGAAAGCCTAC
GGGAAGGAATTAGCGAAATTAGAACAAGAAATGAATGCGCTGCTGGTGGA
TTATCGGCGCCTGAAGGAAGAGTCGATGAGGAAGTTCGAAGCGTACAGAG
AACTGAAACTGAAGCGGAAAACATTAATGGTGAAAATGAAAAATATCTGC
AAAACTATTGAGAATGATGATGATGATTCTGAATCTGAACCGCCGAATGG
GGAAGCAGAACAAGGCGAATCCGGTAGTGCAGTAGCGGCCAATCGGGCAG
TCTCCATCAGTAGCAGCGACAGCTGCAGTAGCAGTGACGGTCCCGATGTT
CCGCAGGTTGCGGTGGGCAAGAATGACCGACGCGCTTTCCAATCATCTAT
GAGTGAAAGCGATTCCGACAGCGACAGTTCTGATGTCCAGGCCGCTGTTG
GTAAGCCGCCACCGCCGCCGCTGCAACTGCAGCACGCCGATAGCTCCAGT
TCCGACTGCGACAGTAACGAGGAGCAAAGTCTGCAACCAACAGCCGTAGT
TATTAGCAACCTAGCCAAGTCTAACCCGGCCCAGAGCTCACACAAGGACA
CCAATCAGGCATCTAGACTGGGTGCTCCAGTCACCAGCAGCGGGTCGCTT
CCAGCAGTCAAATCGGAATCTAAAATCAATATTAAAAACAATATTCCCAA
ATGCGTTGACACTTGTTTTTTGCTAGGAAGCGCTCAAACAGATTTGCCCA
ATAGTTTACTTGTAATGGTAAAAGCCGATGAACAAAACGGCCTATATAAT
GCCGTTGAACCGAAATTGAGCACGATAACCATAAGTGAAGTGAAGAAAAC
CTTCATTACAGATATGAAAGTGTTCAACAATCGGTTGTTTGTCAGTGCAT
CTCACGGGTTACTGAGGCAGTACCACCTGGGCACCCATGAATGCATTATG
GATTATAAAGGCCACCAATCATTGATCCATTGCCTGTTACCGACAGTCCA
CCCGGTCGGTGTCAAGCGGATTCTCAGCGGGGGATTCGATAAGACCTTGT
TCGTTCACGATATCGACTCAGGTGCCATCTTGCAAAAAATCGAAAACGAC
AGCGCAATTTTATCGATATGTGATCAGCTGGAATTCGTTTACTACGGAAC
TGCCGAGGGAAAGGTCGCGACATTCTCATTGGAGAAGGATAAACGAATGA
GCAGTTTCCGAGCATCCGATAAGGGGATTTCCTGCCTGACCGCAACAAAG
GAAGGCAATGTCCACCTGCTGTTTGTCGGTGCAAACACCGGCGAATACAG
CGTCTGGAACGCAATCACGTATATCAAACTGAAGATCATCACTCCAGTGT
CCCACTTAGAAATCCCCATCGATTTCATAGTTCTCCAGAAGCAGCGGCTG
CTGGCATACACAAGGAATAATGTCCATTTCATTCAATATGTCAAAACAAA
GTCAACGTCAACGTTCAATCATTTCGATTCAATCAGCAGTCTGTGTCTGA
CTAGGAATTACGTTATCATCGGAGGGGTGTGTGGGAAAGTTTCTGTATAC
AAAATAAAAGGCTCCTGCATACATAAAACTCCAATCCGAACCATTACCAA
TTCTAATTCTCCTGTAGTTTCATTGACATTCTACAACAACACAATCATAA
CCGGGGATAAGACTGGGAAAATCTATTTCAATCGGTTGGTAGAATCGTAA
CAGATGAAGATTTTTAATTATTTTACAGATTGTAAATAAAATATAATATT
GTTGTCTTATTAATGG
back to top

protein sequence of SMED30034162-orf-1

>SMED30034162-orf-1 ID=SMED30034162-orf-1|Name=SMED30034162-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=788bp
MSYRQFDKYYEDYRNHNYNNDNRNLNRNLPIISNYYDPRRYNEPYNNHNR
TIYPETRTPRLESKPAYVTHKHTYHSSRWGPPTTNSDSFHNLSSQRYNTN
TSNEVRININTYKPNLPIHFTERNTKPSMNDLRKMTTNRQEFIENNNKTA
EVAKKIENSVSTEFSNSNRPPLDNLNKRKNHLSMGEEPKPSTLTDTDEDG
SNPPKKKPKIEQDSTNGNTQPNEELSMENQQIKDLKAYGKELAKLEQEMN
ALLVDYRRLKEESMRKFEAYRELKLKRKTLMVKMKNICKTIENDDDDSES
EPPNGEAEQGESGSAVAANRAVSISSSDSCSSSDGPDVPQVAVGKNDRRA
FQSSMSESDSDSDSSDVQAAVGKPPPPPLQLQHADSSSSDCDSNEEQSLQ
PTAVVISNLAKSNPAQSSHKDTNQASRLGAPVTSSGSLPAVKSESKINIK
NNIPKCVDTCFLLGSAQTDLPNSLLVMVKADEQNGLYNAVEPKLSTITIS
EVKKTFITDMKVFNNRLFVSASHGLLRQYHLGTHECIMDYKGHQSLIHCL
LPTVHPVGVKRILSGGFDKTLFVHDIDSGAILQKIENDSAILSICDQLEF
VYYGTAEGKVATFSLEKDKRMSSFRASDKGISCLTATKEGNVHLLFVGAN
TGEYSVWNAITYIKLKIITPVSHLEIPIDFIVLQKQRLLAYTRNNVHFIQ
YVKTKSTSTFNHFDSISSLCLTRNYVIIGGVCGKVSVYKIKGSCIHKTPI
RTITNSNSPVVSLTFYNNTIITGDKTGKIYFNRLVES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0017124SH3 domain binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005829cytosol
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0008286insulin receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 228..262
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 378..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..366
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..226
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 291..434
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..212
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..335
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 614..655
e-value: 13.0
score: 10.0
coord: 743..780
e-value: 15.0
score: 9.5
coord: 700..736
e-value: 13.0
score: 9.9
coord: 530..572
e-value: 28.0
score: 7.9
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 502..778