Protein kinase

Overview
NameProtein kinase
Smed IDSMED30034146
Length (bp)1698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30034146) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30034146) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30034146) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30034146) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034146

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30034146SMESG000040086.1 dd_Smed_v4_3518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034146SMESG000040086.1 Contig37737newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034146SMESG000040086.1 Contig37737uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30034146SMESG000040086.1 dd_Smed_v4_3518_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: MAP2K1 (mitogen-activated protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:6840])

HSP 1 Score: 403.29 bits (1035), Expect = 2.245e-136
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP2K2 (mitogen-activated protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6842])

HSP 1 Score: 389.808 bits (1000), Expect = 4.265e-131
Identity = 187/334 (55.99%), Postives = 249/334 (74.55%), Query Frame = 3
Query:  255 EIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQ---DRQANLAEHLE--AALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            ++ KKLE  +LD+ Q+++L  F+ +K  + EL  DDFE I+ELG GNGGVV+KV+++P+ LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYMAPERL G  Y+V+SD+WS+GLSL+EL+ GRYPIPP   ++  + F +   D +      +       G+ +    +     MAIFELL YIV+ PPP++P   F+ DF  FV+ CL +N ++R  L+ L  +  +
Sbjct:   36 DLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFI 369          
BLAST of Protein kinase vs. Ensembl Human
Match: AC011005.1 (novel protein similar to mitogen-activated protein kinase kinase 2 MAP2K2)

HSP 1 Score: 363.614 bits (932), Expect = 9.565e-121
Identity = 186/375 (49.60%), Postives = 253/375 (67.47%), Query Frame = 3
Query:  195 PLRLSLISSNRVSTGPMDVEE---------IHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQ---DRQANLAEHLEA--ALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHK 1277
            P+  +L  +  ++ GP    E         + KKLE  +LD+ Q+++L  F+ +K  + EL  DDFE  +EL  GNGGVV+KV+++P+ LIMARK IHLEIKPA++ QIIRE QVLH+CNSPYIVG++GAF+ D +IS CME+M+ GSLD  +K A R+PE I+ K++++V+ GL YLRE+  I+HR+VKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYMAPERL G  Y+V+S +WS+ LSL+EL+  RYPIPP   ++  + F Q   DR+      + +     G+      +     MAIFELL YIV  PPP++P   F+ DF  FV+ CL +N ++R  L+ L  +  +      L  +H+
Sbjct:    7 PMLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDE-QQKRLEAFLTQKAKVGELKDDDFERTSELDAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIREHQVLHECNSPYIVGFYGAFYCDREISICMEHMDGGSLDQGLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRNVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSVIWSMDLSLVELAIERYPIPPPDAKELEAIFGQPVVDREEGEPHSISSWPGSPGRPNSGYGMDSLPAMAIFELLDYIVKEPPPKLPNGVFTPDFQEFVNKCLIKNPTERADLKMLTNHAFIKRSEACLLSNHQ 380          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP2K2 (mitogen-activated protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6842])

HSP 1 Score: 322.013 bits (824), Expect = 5.276e-106
Identity = 156/272 (57.35%), Postives = 202/272 (74.26%), Query Frame = 3
Query:  441 MARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQ---DRQANLAEHLE--AALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYMAPERL G  Y+V+SD+WS+GLSL+EL+ GRYPIPP   ++  + F +   D +      +       G+ +    +     MAIFELL YIV+ PPP++P   F+ DF  FV+ CL +N ++R  L+ L  +  +
Sbjct:    1 MARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFGRPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFI 272          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP2K5 (mitogen-activated protein kinase kinase 5 [Source:HGNC Symbol;Acc:HGNC:6845])

HSP 1 Score: 237.654 bits (605), Expect = 5.486e-72
Identity = 121/304 (39.80%), Postives = 183/304 (60.20%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
             +++  D  +   LG GNGG V K  + P+  I+A K I L+I   ++ QI+ EL++L+ C+S YI+G++GAFF +  IS C E+M+ GSLD+  K    +PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWSLG+S +EL+ GR+P P  ++                                  +  ++   +LL  IVD   P +P   FSE F++F+  C+++   +RP  E L+ +  ++  N
Sbjct:  123 GQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRK----MPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQK----------------------------------NQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFN 387          
BLAST of Protein kinase vs. Ensembl Celegans
Match: mek-2 (Dual specificity mitogen-activated protein kinase kinase mek-2 [Source:UniProtKB/Swiss-Prot;Acc:Q10664])

HSP 1 Score: 357.836 bits (917), Expect = 3.328e-119
Identity = 174/323 (53.87%), Postives = 233/323 (72.14%), Query Frame = 3
Query:  258 IHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFS-QDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESL 1223
            + ++L+   L + Q Q+L EF+  K+ I ELS D  +   ELG GNGGVV+K  ++ T +IMARK +HLEIKP+V+ QI++EL VLH CNSP+IVG++GAF  + DIS CMEYM+  SLD+V+K  GRLPE  V +I+V+VV GL YL++E+ I+HRDVKPSN+LVNS GE+KLCDFGVSG LIDSMANSFVGTRSYMAPERL G  Y + SD+WS GLSL+EL  GRYP+P   + ++ + F+  + +  LA+ LE   Y         S+  +MAIFE+L YIV+ PPP +P+  F+++ I FV  CL++  S+R  L+SL
Sbjct:   38 LEEQLKKLGLTEPQTQRLSEFLQVKEGIKELSEDMLQTEGELGHGNGGVVNKCVHRKTGVIMARKLVHLEIKPSVRQQIVKELAVLHKCNSPFIVGFYGAFVDNNDISICMEYMDGLSLDIVLKKVGRLPEKFVGRISVAVVRGLTYLKDEIKILHRDVKPSNMLVNSNGEIKLCDFGVSGMLIDSMANSFVGTRSYMAPERLTGSHYTISSDIWSFGLSLVELLIGRYPVPAPSQAEYATMFNVAENEIELADSLEEPNYHPP------SNPASMAIFEMLDYIVNGPPPTLPKRFFTDEVIGFVSKCLRKLPSERATLKSL 354          
BLAST of Protein kinase vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 205.297 bits (521), Expect = 6.019e-61
Identity = 118/327 (36.09%), Postives = 183/327 (55.96%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLH--DCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRL----PEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE---YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP-EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFS 1292
            E++A D   + ELGKG  G+V K++++ + +IMA K I   I    + Q++ EL      DC  P +V ++GA F +GD+  CME M++ SLD   ++A ++    PEP + K+ +SV+ GL +++E+L++IHRDVKPSNIL+N  G+VK+CDFG+SG L +SMA +   G + YM PER+ GE    Y+VR+DVWSLG+++IE++ G +P                                         +N    FE L  +V  PPP++P E  FS D   FV  CL+++ ++RP+   LL          ++EQ+  + +FS
Sbjct:   44 EIAATDLVVLEELGKGGYGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDC-CPQMVRFYGAMFREGDVWICMEVMDT-SLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLGITIIEIAVGTHPY----------------------------------------ANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELLAM-------PFMEQARNEKQFS 321          
BLAST of Protein kinase vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 205.297 bits (521), Expect = 6.019e-61
Identity = 118/327 (36.09%), Postives = 183/327 (55.96%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLH--DCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRL----PEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE---YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP-EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFS 1292
            E++A D   + ELGKG  G+V K++++ + +IMA K I   I    + Q++ EL      DC  P +V ++GA F +GD+  CME M++ SLD   ++A ++    PEP + K+ +SV+ GL +++E+L++IHRDVKPSNIL+N  G+VK+CDFG+SG L +SMA +   G + YM PER+ GE    Y+VR+DVWSLG+++IE++ G +P                                         +N    FE L  +V  PPP++P E  FS D   FV  CL+++ ++RP+   LL          ++EQ+  + +FS
Sbjct:   44 EIAATDLVVLEELGKGGYGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDC-CPQMVRFYGAMFREGDVWICMEVMDT-SLDKFYRHAYKIGKHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGETKSAYDVRADVWSLGITIIEIAVGTHPY----------------------------------------ANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELLAM-------PFMEQARNEKQFS 321          
BLAST of Protein kinase vs. Ensembl Celegans
Match: mek-1 (Dual specificity mitogen-activated protein kinase kinase mek-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21307])

HSP 1 Score: 177.563 bits (449), Expect = 1.705e-50
Identity = 106/320 (33.12%), Postives = 172/320 (53.75%), Query Frame = 3
Query:  318 FVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVL---HDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANS-FVGTRSYMAPERLIG---EEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNK 1256
            ++  + N  +    + +F+ ++G G+ G V+K RYK  ++IMA K +         ++I+ +L V+    DC  PYIV  FG F ++ D+  CME M +    L+++    +PE I+ K++VS++  L YL+ +  I+HRDVKPSNIL++  G +KLCDFG++G+LI+S A+S   G   YM PERL     + Y++RSDVWS G++L+EL+TG+YP    +                                          F++++ I++  PPR+    FS DF   V SCLQ + + RP  + LL +  +++  K
Sbjct:   57 YLTLQGNRRKADLKELQFVEDIGHGSCGTVTKCRYK--SVIMAVKTMPRTSNSYEMSRILMDLDVICLSFDC--PYIVRCFGYFITNFDVRVCMECMATCLDRLLIRIKQPIPERIIGKLSVSIIKALHYLKTKHQIMHRDVKPSNILLDWSGVIKLCDFGIAGRLIESRAHSKQAGCPLYMGPERLDPNNFDSYDIRSDVWSFGVTLVELATGQYPYAGTE------------------------------------------FDMMSKILNDEPPRLDPAKFSPDFCQLVESCLQRDPTMRPNYDMLLQHPFVVHHEK 330          
BLAST of Protein kinase vs. Ensembl Celegans
Match: mkk-4 (MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-Prot;Acc:Q20347])

HSP 1 Score: 177.563 bits (449), Expect = 2.469e-50
Identity = 124/385 (32.21%), Postives = 199/385 (51.69%), Query Frame = 3
Query:  123 REEDENVDNADNHTATKPVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLE-IKPAVKAQIIRELQ-VLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNA-----GRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLI-GEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRV----PEFCFSEDFINFVHSCLQENASDRPRLESLLTYQL 1238
            +E+DEN+ N+    + +P S    P  LS+  + +     +  E + + L    L     + L+ F +   N+ +L A        +G GN G V K+R+K T  ++A K I    I    + +++RE   ++     P IV ++GA FS+GD   CME M+  S+DL+ K        RL E +V  ITV  V+ L YL++EL IIHRDVKPSNILV+  G VKLCDFG+ GQL +S A +   G + Y+APER+   ++Y+VRSDVWSLG++L E++TG++P                ++ N                         ++F+ +A +V   PP +     +F +S   + F+++CL ++   RP+ ++L ++  
Sbjct:    3 QEDDENLRNS---MSLRPTSLSTRPTSLSVNGNEKT----LPEESVLRSLSTGTLKYPDDEHLYTFSSA--NLQDLGA--------IGNGNFGTVYKMRHKETGKLIAVKRIRCNNIGHREQIRLLREHDTIVKSEKGPNIVKFYGAIFSEGDCWICMELMDI-SMDLLYKRVYMVKNSRLNENVVGHITVCTVDALDYLKKELKIIHRDVKPSNILVDGTGAVKLCDFGICGQLEESFAKTHDAGCQPYLAPERITSSDKYDVRSDVWSLGITLYEIATGKFPY---------------QEWN-------------------------SLFDQIATVVSGDPPILHPDSDDFHYSLPLVKFINTCLTKDRRHRPKYDTLKSFDF 329          
BLAST of Protein kinase vs. Ensembl Fly
Match: Dsor1 (gene:FBgn0010269 transcript:FBtr0071313)

HSP 1 Score: 377.096 bits (967), Expect = 2.044e-126
Identity = 181/356 (50.84%), Postives = 251/356 (70.51%), Query Frame = 3
Query:  249 VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYL 1316
            ++ + + LE   + DT+R+++  F+++K+ I ELS +D E + ELG GNGGVV KVR+  T+LIMARK IHLE+KPA+K QI+REL+VLH+CN P+IVG++GAF+SDG+IS CMEYM+ GSLDL++K AGR+PE I+ +IT++V+ GL YLR+   IIHRDVKPSNILVNS GE+K+CDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WSLGLSL+E++ G YPIPP       S F+ + + +                    +   MAIFELL YIV+ PPP++    FS +F +FV  CL++   +R  L++LL++  +           +K E   +++S ++
Sbjct:   49 IDALTETLEGLDMGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEES---------------GQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWI-----------RKAELEEVDISGWV 378          
BLAST of Protein kinase vs. Ensembl Fly
Match: Dsor1 (gene:FBgn0010269 transcript:FBtr0340120)

HSP 1 Score: 376.711 bits (966), Expect = 2.532e-126
Identity = 181/356 (50.84%), Postives = 251/356 (70.51%), Query Frame = 3
Query:  249 VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYL 1316
            ++ + + LE   + DT+R+++  F+++K+ I ELS +D E + ELG GNGGVV KVR+  T+LIMARK IHLE+KPA+K QI+REL+VLH+CN P+IVG++GAF+SDG+IS CMEYM+ GSLDL++K AGR+PE I+ +IT++V+ GL YLR+   IIHRDVKPSNILVNS GE+K+CDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WSLGLSL+E++ G YPIPP       S F+ + + +                    +   MAIFELL YIV+ PPP++    FS +F +FV  CL++   +R  L++LL++  +           +K E   +++S ++
Sbjct:   46 IDALTETLEGLDMGDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEES---------------GQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWI-----------RKAELEEVDISGWV 375          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0334320)

HSP 1 Score: 212.616 bits (540), Expect = 1.065e-62
Identity = 133/361 (36.84%), Postives = 196/361 (54.29%), Query Frame = 3
Query:  312 FEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSP-YIVGYFGAFFSDGDISFCMEYMNSGSLD-----LVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE---YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE----FCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 1352
             +F     N    ++DD E   E+G+G  G V+K+ +K  + +MA K I   +    + Q++ +L+V+   N   YIV ++GA F +GD   CME M++ SLD     +  K    +PE I+AKITV+ VN L YL+EEL IIHRDVKPSNIL++  G++KLCDFG+SGQL+DS+A +   G R YMAPER+  E    Y+VRSDVWSLG++L+E++TG +P                             Y K        DS    +FE L  +V   PPR+        FS++F++FV++CL +  SDRP+   LL    +           ++ E S  +V+ Y+ ++L  +  D I
Sbjct:  105 LQFGEGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDT-SLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFP-----------------------------YRK-------WDS----VFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFI-----------RRGETSHTDVAVYVADILESMEKDGI 413          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0081892)

HSP 1 Score: 212.616 bits (540), Expect = 1.065e-62
Identity = 133/361 (36.84%), Postives = 196/361 (54.29%), Query Frame = 3
Query:  312 FEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSP-YIVGYFGAFFSDGDISFCMEYMNSGSLD-----LVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE---YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE----FCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 1352
             +F     N    ++DD E   E+G+G  G V+K+ +K  + +MA K I   +    + Q++ +L+V+   N   YIV ++GA F +GD   CME M++ SLD     +  K    +PE I+AKITV+ VN L YL+EEL IIHRDVKPSNIL++  G++KLCDFG+SGQL+DS+A +   G R YMAPER+  E    Y+VRSDVWSLG++L+E++TG +P                             Y K        DS    +FE L  +V   PPR+        FS++F++FV++CL +  SDRP+   LL    +           ++ E S  +V+ Y+ ++L  +  D I
Sbjct:  105 LQFGEGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDT-SLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFP-----------------------------YRK-------WDS----VFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFI-----------RRGETSHTDVAVYVADILESMEKDGI 413          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0300443)

HSP 1 Score: 212.616 bits (540), Expect = 1.065e-62
Identity = 133/361 (36.84%), Postives = 196/361 (54.29%), Query Frame = 3
Query:  312 FEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSP-YIVGYFGAFFSDGDISFCMEYMNSGSLD-----LVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE---YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE----FCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 1352
             +F     N    ++DD E   E+G+G  G V+K+ +K  + +MA K I   +    + Q++ +L+V+   N   YIV ++GA F +GD   CME M++ SLD     +  K    +PE I+AKITV+ VN L YL+EEL IIHRDVKPSNIL++  G++KLCDFG+SGQL+DS+A +   G R YMAPER+  E    Y+VRSDVWSLG++L+E++TG +P                             Y K        DS    +FE L  +V   PPR+        FS++F++FV++CL +  SDRP+   LL    +           ++ E S  +V+ Y+ ++L  +  D I
Sbjct:  105 LQFGEGGANTHTFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDT-SLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERAKGYDVRSDVWSLGITLMEVATGNFP-----------------------------YRK-------WDS----VFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFI-----------RRGETSHTDVAVYVADILESMEKDGI 413          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map2k2b (mitogen-activated protein kinase kinase 2b [Source:ZFIN;Acc:ZDB-GENE-080219-34])

HSP 1 Score: 390.963 bits (1003), Expect = 7.430e-132
Identity = 192/361 (53.19%), Postives = 257/361 (71.19%), Query Frame = 3
Query:  183 RKHP-PLRLSLISSNRVSTGPMD------VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNN-MAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            +K P P+ ++     + ++ P+D      +E + KKL+   LD+ Q+++L  F+ +K N+ EL  DDF+ I ELG GNGGVV+KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  IIHRDVKPSNILVN  GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SDVWS+GLSL+EL+ GRYPIPP   ++    F +           +     +     +S     MAIFELL YIV+ PPP++P   F+ DF +FV +CL +N +DR  L+ L+ +  +
Sbjct:    4 KKRPDPIVITGSGEAQTTSTPIDAASEANLEALQKKLDELDLDEQQKKRLEAFLTQKANLGELKDDDFQHICELGAGNGGVVNKVCHKPSGLVMARKLIHLEIKPAIRHQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIIHRDVKPSNILVNCRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEGIFGRALMDVGDSETHSTSPRPRPPGRPISGHGPVMAIFELLDYIVNEPPPKLPHGVFTPDFQDFVTNCLIKNPADRADLKMLMNHTFI 364          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map2k2b (mitogen-activated protein kinase kinase 2b [Source:ZFIN;Acc:ZDB-GENE-080219-34])

HSP 1 Score: 390.963 bits (1003), Expect = 7.430e-132
Identity = 192/361 (53.19%), Postives = 257/361 (71.19%), Query Frame = 3
Query:  183 RKHP-PLRLSLISSNRVSTGPMD------VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNN-MAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            +K P P+ ++     + ++ P+D      +E + KKL+   LD+ Q+++L  F+ +K N+ EL  DDF+ I ELG GNGGVV+KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  IIHRDVKPSNILVN  GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SDVWS+GLSL+EL+ GRYPIPP   ++    F +           +     +     +S     MAIFELL YIV+ PPP++P   F+ DF +FV +CL +N +DR  L+ L+ +  +
Sbjct:    4 KKRPDPIVITGSGEAQTTSTPIDAASEANLEALQKKLDELDLDEQQKKRLEAFLTQKANLGELKDDDFQHICELGAGNGGVVNKVCHKPSGLVMARKLIHLEIKPAIRHQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIIHRDVKPSNILVNCRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEGIFGRALMDVGDSETHSTSPRPRPPGRPISGHGPVMAIFELLDYIVNEPPPKLPHGVFTPDFQDFVTNCLIKNPADRADLKMLMNHTFI 364          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map2k2a (mitogen-activated protein kinase kinase 2a [Source:ZFIN;Acc:ZDB-GENE-041027-1])

HSP 1 Score: 386.341 bits (991), Expect = 5.748e-130
Identity = 189/332 (56.93%), Postives = 243/332 (73.19%), Query Frame = 3
Query:  261 HKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQD-RQANLAE----HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
             +KL    LD+ QR++L  F+ +K  + EL  +DFE I ELG GNGGVV KVR+KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SDVWS+GLSL+EL+ GRYPIPP   ++  + F +    A  AE           G+ +    +     MAIFELL YIV+ PPP++P   F+ DF  FV  CL +N +DR  L+ L+ +  +
Sbjct:   35 QRKLGELDLDEQQRKRLEAFLTQKAQVGELKDEDFEPICELGAGNGGVVHKVRHKPSRLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGRPVLDAGGAEGHSMSPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFTTDFEEFVTKCLIKNPADRADLKMLMGHTFI 366          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map2k1 (mitogen-activated protein kinase kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2759])

HSP 1 Score: 385.571 bits (989), Expect = 1.019e-129
Identity = 188/362 (51.93%), Postives = 258/362 (71.27%), Query Frame = 3
Query:  183 RKHPPLRLSLISSNRVSTGP----MDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNN---MAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLN 1247
            RK  P++L+ I       G      ++E + KKLE  +LD+ Q+++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV ++P+  IMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME M+ GSLD  +K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GR+PIPP   ++    F Q  + + +    +       +       ++   MAIFELL YIV+ PPP++P   F  +F +FV+ CL +N ++R  L+ L+ +  + N
Sbjct:    5 RKPEPIQLNPIPDGNAINGTGATETNLEALQKKLEELELDEQQKKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVLHRPSGFIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQCLKKAGKIPEQILGKVSIAVIKGLSYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRFPIPPPDAKELEQIFGQPLEGDPSASDTSPKPRPPGRPGSSYGPDSRPPMAIFELLDYIVNEPPPKLPSI-FGAEFQDFVNKCLIKNPAERADLKQLMVHSFIKN 365          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-1517])

HSP 1 Score: 229.565 bits (584), Expect = 1.229e-68
Identity = 117/304 (38.49%), Postives = 182/304 (59.87%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
             +++  D ++  +LG GNGG V K  +     I+A K I L+I   ++ QI+ EL++L+ C+SPYI+ ++ AFF +  IS C E+M+ GSLD+      R+PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWS+G+S +EL+ G +P P  ++                                  +  ++   +LL  IVD  PP +P   FSE F++F+  C+++   +RP   +L+ +  ++  N
Sbjct:  159 GQINEHDLQYQEQLGHGNGGTVYKAYHLLGKRIVAVKVIPLDITVELQKQIMSELEILYKCDSPYIIKFYSAFFVENRISICTEFMDGGSLDVYW----RIPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSVGISFMELALGSFPYPQIQK----------------------------------NQGSLMPLQLLQCIVDEDPPVLPVGQFSEKFVHFITQCMRKLPKERPAPNNLMDHPFIVQYN 423          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:Xenbase;Acc:XB-GENE-482674])

HSP 1 Score: 398.667 bits (1023), Expect = 1.047e-134
Identity = 193/343 (56.27%), Postives = 256/343 (74.64%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSN-NMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N   T   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE ++ELG GNGGVV KV +KPT+LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP  AKE + +   S +     +E         +  +    DS   MAIFELL YIV+ PPP++P   F  +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVHSFI 363          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:Xenbase;Acc:XB-GENE-482674])

HSP 1 Score: 395.971 bits (1016), Expect = 6.972e-134
Identity = 191/335 (57.01%), Postives = 254/335 (75.82%), Query Frame = 3
Query:  246 DVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSN-NMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE ++ELG GNGGVV KV +KPT+LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP  AKE + +   S +     +E         +  +    DS   MAIFELL YIV+ PPP++P   F  +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   11 NLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVHSFI 345          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:Xenbase;Acc:XB-GENE-482674])

HSP 1 Score: 388.267 bits (996), Expect = 8.041e-131
Identity = 188/324 (58.02%), Postives = 244/324 (75.31%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSN-NMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCL 1184
            N   T   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE ++ELG GNGGVV KV +KPT+LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP  AKE + +   S +     +E         +  +    DS   MAIFELL YIV+ PPP++P   F  +F +FV+ C 
Sbjct:   21 NGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCF 344          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: pik3cb (phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta [Source:Xenbase;Acc:XB-GENE-482674])

HSP 1 Score: 381.333 bits (978), Expect = 5.838e-129
Identity = 185/313 (59.11%), Postives = 241/313 (77.00%), Query Frame = 3
Query:  246 DVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSN-NMAIFELLAYIVDYPPPRVPEFCFSEDFINFVH 1175
            ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE ++ELG GNGGVV KV +KPT+LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP  AKE + +   S +     +E         +  +    DS   MAIFELL YIV+ PPP++P   F  +F +FV+
Sbjct:   11 NLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVN 323          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:549042])

HSP 1 Score: 229.95 bits (585), Expect = 1.213e-68
Identity = 118/291 (40.55%), Postives = 177/291 (60.82%), Query Frame = 3
Query:  381 LGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
            LG GNGG V K  + P+  I+A K I L+I   ++ QI+ EL++L+ C+S YI+G++GAFF +  IS C E+M+ GSLD+  K    +PE ++ +I V+V+ GL YL   L I+HRDVKPSN+LVN+ G VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWSLG+S +EL+ GR+P P  ++                                  +  ++   ++L  IVD   P +P   FSE F++F+  C+++   +RP  E L+ +  ++  N
Sbjct:  172 LGHGNGGTVYKAYHVPSGKILAVKVIPLDITVELQRQIMSELEILYKCDSLYIIGFYGAFFVENRISICTEFMDGGSLDVYRK----IPEQVLGRIAVAVLKGLTYLWS-LKILHRDVKPSNMLVNTRGHVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERIAGEQYGIHSDVWSLGISFMELALGRFPYPQIQK----------------------------------NHGSLMPLQILQCIVDEECPVLPLGEFSESFVHFITQCMRKPPKERPAPEELMDHPFIVQFN 423          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map2k1 (mitogen-activated protein kinase kinase 1 [Source:MGI Symbol;Acc:MGI:1346866])

HSP 1 Score: 402.905 bits (1034), Expect = 2.134e-136
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map2k2 (mitogen-activated protein kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346867])

HSP 1 Score: 395.201 bits (1014), Expect = 2.770e-133
Identity = 190/335 (56.72%), Postives = 250/335 (74.63%), Query Frame = 3
Query:  255 EIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQD--RQANLAEHLEAALYGKKLKAMQVSDSNN----MAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            ++ KKLE   LD+ QR++L  F+ +K  + EL  DDFE I+ELG GNGGVV+K R++P+ LIMARK IHLEIKPAV+ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+EL+ GRYPIPP   ++  ++F +     A+   H  +       + + V    +    MAIFELL YIV+ PPP++P   FS DF  FV+ CL +N ++R  L+ L+ +  +
Sbjct:   36 DLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLMNHAFI 370          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map2k2 (mitogen-activated protein kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346867])

HSP 1 Score: 393.66 bits (1010), Expect = 9.628e-133
Identity = 190/334 (56.89%), Postives = 249/334 (74.55%), Query Frame = 3
Query:  255 EIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQD--RQANLAEH---LEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            ++ KKLE   LD+ QR++L  F+ +K  + EL  DDFE I+ELG GNGGVV+K R++P+ LIMARK IHLEIKPAV+ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+EL+ GRYPIPP   ++  ++F +     A+   H         G+ +    +     MAIFELL YIV+ PPP++P   FS DF  FV+ CL +N ++R  L+ L+ +  +
Sbjct:   36 DLQKKLEELDLDEQQRKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLMNHAFI 369          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map2k5 (mitogen-activated protein kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1346345])

HSP 1 Score: 236.884 bits (603), Expect = 2.258e-71
Identity = 121/304 (39.80%), Postives = 183/304 (60.20%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
             +++  D  +   LG GNGG V K  + P+  I+A K I L+I   ++ QI+ EL++L+ C+S YI+G++GAFF +  IS C E+M+ GSLD+  K    +PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWSLG+S +EL+ GR+P P  ++                                  +  ++   +LL  IVD   P +P   FSE F++F+  C+++   +RP  E L+ +  ++  N
Sbjct:  159 GQMNEQDIRYRDTLGHGNGGTVYKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRK----IPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTGGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQK----------------------------------NQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFN 423          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map2k4 (mitogen-activated protein kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1346869])

HSP 1 Score: 209.149 bits (531), Expect = 1.518e-61
Identity = 126/345 (36.52%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNA-----GRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERL----IGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP---EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGL 1337
            + +A+D + + E+G+G  G V+K+ +KP+  IMA K I   +    + Q++ +L V +   + PYIV ++GA F +GD   CME M S S D   K         +PE I+ KIT++ V  L +L+E L IIHRD+KPSNIL++  G +KLCDFG+SGQL+DS+A +   G R YMAPER+      + Y+VRSDVWSLG++L EL+TGR+P P                                           ++F+ L  +V   PP++    E  FS  FINFV+ CL ++ S RP+ + LL +  +L            YE  T+EV+CY+  +L+ +
Sbjct:   94 DFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELM-STSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWN----------------------------------------SVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFIL-----------MYEERTVEVACYVCKILDQM 386          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P29678|MP2K1_RABIT (Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=MAP2K1 PE=1 SV=2)

HSP 1 Score: 403.29 bits (1035), Expect = 8.966e-136
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q02750|MP2K1_HUMAN (Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2)

HSP 1 Score: 403.29 bits (1035), Expect = 1.078e-135
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q01986|MP2K1_RAT (Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map2k1 PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 1.189e-135
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P31938|MP2K1_MOUSE (Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Map2k1 PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 1.493e-135
Identity = 192/341 (56.30%), Postives = 256/341 (75.07%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAE-HLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N  S+   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I+ELG GNGGVV KV +KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP   ++    F    + + AE        G+ L +  +     MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFI 361          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q05116|MP2K1_XENLA (Dual specificity mitogen-activated protein kinase kinase 1 OS=Xenopus laevis OX=8355 GN=map2k1 PE=1 SV=2)

HSP 1 Score: 402.134 bits (1032), Expect = 3.030e-135
Identity = 194/343 (56.56%), Postives = 257/343 (74.93%), Query Frame = 3
Query:  222 NRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSN-NMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            N   T   ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE ++ELG GNGGVV KV +KPT+LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP  AKE + +   S +R    +E         +  +    DS   MAIFELL YIV+ PPP++P   F  +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:   21 NGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVERDPASSELAPRPRPPGRPISSYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVHSFI 363          
BLAST of Protein kinase vs. TrEMBL
Match: A0A193PCD6 (MAPK/ERK kinase 1/2 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 395/425 (92.94%), Postives = 411/425 (96.71%), Query Frame = 3
Query:   78 MSKNKLGLKIVAATNREEDENVDNADNHTATKPVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 1352
            MSKNKLGLKI+ ATNREEDEN DN DNHTA+KP+SRKHPPLR+S ISSNRVSTGPMDVEEI KKLE+QKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMN+GSLDLVMKNAGRLPEPIVAKIT+SVVNGL+YLREELDIIHRDVKPSNILVNS+GEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIEL+TGRYPIPPAKEEDF STFSQDRQ NLAEHL+AALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFS DFI FVHSCLQENA DRPRLESLLTY  LLNP+KYLEQS KKY+FS+IEVS YLRNLL+GLSNDV+
Sbjct:    1 MSKNKLGLKILPATNREEDENNDNVDNHTASKPISRKHPPLRISFISSNRVSTGPMDVEEIQKKLESQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNAGSLDLVMKNAGRLPEPIVAKITISVVNGLIYLREELDIIHRDVKPSNILVNSDGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELATGRYPIPPAKEEDFHSTFSQDRQVNLAEHLDAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSNDFITFVHSCLQENALDRPRLESLLTYNFLLNPDKYLEQSQKKYDFSSIEVSFYLRNLLHGLSNDVM 425          
BLAST of Protein kinase vs. TrEMBL
Match: A0A430QH14 (Mitogen-activated protein kinase kinase 1 OS=Schistosoma bovis OX=6184 GN=DC041_0000407 PE=4 SV=1)

HSP 1 Score: 503.442 bits (1295), Expect = 2.870e-170
Identity = 242/363 (66.67%), Postives = 290/363 (79.89%), Query Frame = 3
Query:  219 SNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEED-FLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEV 1304
            SNR+STGP+DV E+ K+L  Q LDD QR++L  FVA K+ I EL  +DFE + ELGKGNGGVVS+VR+  T LIMA+KNIHLEIKP VK QIIRELQVLHDCNSPYIVGY+GAFF+DGDIS CMEYM+ GSLD+V+ +AGRLPEPIVAKI  SV+ GL+YLRE L IIHRDVKPSNILVN  G+VKLCDFGVSGQLIDS+ANSFVGTRSYMAPERL GE+YN  SDVWSLGLSL+EL+TGRYPIP  ++E+ +LS FS  R  NL +HLEAA  GK L A+    S  MAIFELL+YIVD PPPR+P+FCFS+DFI+ V SCL+  ASDRP LE+LL ++ ++         + + + + I++
Sbjct:  145 SNRISTGPVDVAEVLKQLAIQDLDDNQRRRLSAFVADKQKIGELHPEDFEKLNELGKGNGGVVSRVRHTTTGLIMAKKNIHLEIKPIVKTQIIRELQVLHDCNSPYIVGYYGAFFADGDISLCMEYMDGGSLDIVLLHAGRLPEPIVAKILYSVIRGLVYLREVLHIIHRDVKPSNILVNRTGDVKLCDFGVSGQLIDSLANSFVGTRSYMAPERLTGEQYNTLSDVWSLGLSLVELATGRYPIPAIEDENVYLSAFSSHRDVNLEQHLEAAKEGKPLPAVNSPSSGPMAIFELLSYIVDQPPPRLPKFCFSDDFIDLVDSCLRRPASDRPSLENLLKHRFVVTAAGACPSGNVQRQSTVIDI 507          
BLAST of Protein kinase vs. TrEMBL
Match: A0A3Q0KDI9 (Protein kinase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 6.838e-170
Identity = 242/363 (66.67%), Postives = 289/363 (79.61%), Query Frame = 3
Query:  219 SNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEED-FLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEV 1304
            SNR+STGP+DV E+ K+L  Q LDD QR++L  FVA K+ I EL  +DFE + ELGKGNGGVVS+VR+  T LIMA+KNIHLEIKP VK QIIRELQVLHDCNSPYIVGY+GAFF+DGDIS CMEYM+ GSLD+V+ +AGRLPEPIVAKI  SV+ GL+YLRE L IIHRDVKPSNILVN  G+VKLCDFGVSGQLIDS+ANSFVGTRSYMAPERL GE+YN  SDVWSLGLSL+EL+TGRYPIP  ++E  +LS FS  R  NL +HLEAA  GK L A+    S  MAIFELL+YIVD PPPR+P+FCFS+DFI+ V SCL+  ASDRP LE+LL ++ ++         + + + + I++
Sbjct:  143 SNRISTGPVDVAEVLKQLAIQDLDDNQRRRLSAFVADKQKIGELHPEDFEKLNELGKGNGGVVSRVRHTTTGLIMAKKNIHLEIKPIVKTQIIRELQVLHDCNSPYIVGYYGAFFADGDISLCMEYMDGGSLDIVLLHAGRLPEPIVAKILYSVIRGLVYLREVLHIIHRDVKPSNILVNRTGDVKLCDFGVSGQLIDSLANSFVGTRSYMAPERLTGEQYNTLSDVWSLGLSLVELATGRYPIPAIEDEKVYLSAFSSQRDVNLEQHLEAAKEGKPLPAVNSPSSGPMAIFELLSYIVDQPPPRLPKFCFSDDFIDLVDSCLRRPASDRPSLENLLKHRFVVTAAGACPSGNVQRQSTVIDI 505          
BLAST of Protein kinase vs. TrEMBL
Match: G4VT52 (Protein kinase OS=Schistosoma mansoni OX=6183 GN=Smp_026510 PE=4 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 1.144e-167
Identity = 241/363 (66.39%), Postives = 288/363 (79.34%), Query Frame = 3
Query:  219 SNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEED-FLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEV 1304
            SNR+STGP+DV E++  L  Q LDD QR++L  FVA K+ I EL  +DFE + ELGKGNGGVVS+VR+  T LIMA+KNIHLEIKP VK QIIRELQVLHDCNSPYIVGY+GAFF+DGDIS CMEYM+ GSLD+V+ +AGRLPEPIVAKI  SV+ GL+YLRE L IIHRDVKPSNILVN  G+VKLCDFGVSGQLIDS+ANSFVGTRSYMAPERL GE+YN  SDVWSLGLSL+EL+TGRYPIP  ++E  +LS FS  R  NL +HLEAA  GK L A+    S  MAIFELL+YIVD PPPR+P+FCFS+DFI+ V SCL+  ASDRP LE+LL ++ ++         + + + + I++
Sbjct:  143 SNRISTGPVDVAEVYV-LSIQDLDDNQRRRLSAFVADKQKIGELHPEDFEKLNELGKGNGGVVSRVRHTTTGLIMAKKNIHLEIKPIVKTQIIRELQVLHDCNSPYIVGYYGAFFADGDISLCMEYMDGGSLDIVLLHAGRLPEPIVAKILYSVIRGLVYLREVLHIIHRDVKPSNILVNRTGDVKLCDFGVSGQLIDSLANSFVGTRSYMAPERLTGEQYNTLSDVWSLGLSLVELATGRYPIPAIEDEKVYLSAFSSQRDVNLEQHLEAAKEGKPLPAVNSPSSGPMAIFELLSYIVDQPPPRLPKFCFSDDFIDLVDSCLRRPASDRPSLENLLKHRFVVTAAGACPSGNVQRQSTVIDI 504          
BLAST of Protein kinase vs. TrEMBL
Match: A0A4Z2DCG1 (Dual specificity mitogen-activated protein kinase kinase 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002386 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 2.917e-167
Identity = 239/363 (65.84%), Postives = 287/363 (79.06%), Query Frame = 3
Query:  219 SNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEED-FLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEV 1304
            SNR+STGP+DV E+ K+L  Q LDD QR++L  FVA K+ I EL  +DFE + ELGKGNGGVVS+VR+  T LIMA+KNIHLEIK  VK QIIRELQVLHDCNSPYIVGY+GAFF+DGDIS CMEYM+ GSLD+V+ +AGRLPEPIVAKI  SV+ GL+YLRE L IIHRDVKPSNILVN  G+VKLCDFGVSGQLIDS+ANSFVGTRSYMAPERL GE+YN  SDVWSLGLSL+EL+TGRYPIP  ++E  +LS FS  R  NL +HLEAA  GK L A+    S  MAIFELL+YIVD PPPR+P FCFS+DF++ V SCL+  AS+RP LE+LL ++ ++         + + + + I++
Sbjct:  144 SNRISTGPVDVAEVLKQLAIQDLDDNQRRRLSAFVADKQKIGELRPEDFEKLNELGKGNGGVVSRVRHISTGLIMAKKNIHLEIKSIVKTQIIRELQVLHDCNSPYIVGYYGAFFADGDISLCMEYMDGGSLDIVLLHAGRLPEPIVAKILYSVIRGLMYLREALHIIHRDVKPSNILVNRTGDVKLCDFGVSGQLIDSLANSFVGTRSYMAPERLTGEQYNTLSDVWSLGLSLVELATGRYPIPAIEDEKVYLSAFSPSRDVNLEQHLEAAKDGKPLPAVNSPSSGPMAIFELLSYIVDQPPPRLPRFCFSDDFVDLVESCLRRPASNRPSLENLLKHKFVVTAAGACPSGNVQRQSTVIDI 506          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map2k2b (mitogen-activated protein kinase kinase 2 [Source:NCBI gene;Acc:103030512])

HSP 1 Score: 395.971 bits (1016), Expect = 8.045e-134
Identity = 191/342 (55.85%), Postives = 248/342 (72.51%), Query Frame = 3
Query:  216 SSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
             SN  +    ++E + KKLE   LD+ Q+++L  F+ +K  + EL  DDF+ I ELG GNGGVV+KV +KP+ LIMARK IHLEIK A++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SDVWS+GLSL+ELS GRYPIPP   ++  + F +       E L  +   +            MAIFELL YIV+ PPP++P   F+ DF +FV  CL +N +DR  L+ L+ +  +
Sbjct:   22 GSNIGAASEANLEALQKKLEELDLDEQQKKRLEAFLTQKAKVGELKDDDFQRICELGAGNGGVVNKVCHKPSGLIMARKLIHLEIKQAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELSIGRYPIPPPDPKELEAIFGRPLMNMEGETLSTSPRPRPPGRPVSGHGPAMAIFELLDYIVNEPPPKLPHGVFTADFQDFVTKCLIKNPADRADLKMLMNHTFI 363          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map2k1 (mitogen-activated protein kinase kinase 1 [Source:NCBI gene;Acc:103028644])

HSP 1 Score: 386.341 bits (991), Expect = 4.809e-130
Identity = 190/361 (52.63%), Postives = 260/361 (72.02%), Query Frame = 3
Query:  183 RKHPPLRLSLI----SSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALY----GKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            RK  P++L+ I    + N       ++E + KKLE  +LD+ Q+++L  F+ +K+ + EL  DDFE I ELG GNGGVV KV ++P+ LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD  +K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GR+PIPP   ++    F    + + +   EA+      G+   +        MAIFELL YIV+ PPP++P   F  +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:    5 RKPEPIQLNPIPDGNAVNGTGASETNLEALQKKLEELELDEQQKKRLEAFLTQKQKVGELKDDDFEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQILGKVSIAVIKGLSYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRFPIPPPDAKELEQIFGLPMEGDPSSS-EASPKPRPPGRPSSSYGPDSRPPMAIFELLDYIVNEPPPKLPGI-FGTEFQDFVNKCLIKNPAERADLKQLMVHSFI 363          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:103027486])

HSP 1 Score: 223.402 bits (568), Expect = 2.896e-66
Identity = 115/301 (38.21%), Postives = 185/301 (61.46%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLL 1244
             +++  D ++  +LG GNGG V K  +     ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ ++ AFF +  IS C E+M+ GSLD+      R+PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWS+G+S +E+   +  + P +    +   +  +  +L E LE+ LY      +  + SN   + +         PP  P   FS+ F+NF+  C+++   +RP   +L+ +  ++
Sbjct:  156 GQINEQDIQYQEQLGHGNGGTVYKAYHLLGKRVLAVKVIPLDITAELQKQIMSELEILYKCDSPYIITFYSAFFVENRISICTEFMDGGSLDVYR----RIPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSVGISFMEIQKNQGSLMPLQLLQCIVDETSVQGLSLFE-LESRLY----VVLHCTASNKRGVQD---------PPVFPVGQFSDKFVNFITQCMRKQPKERPAPNNLMDHHFIM 437          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:103027486])

HSP 1 Score: 219.935 bits (559), Expect = 3.739e-65
Identity = 114/301 (37.87%), Postives = 174/301 (57.81%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLL 1244
             +++  D ++  +LG GNGG V K  +     ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ ++ AFF +  IS C E+M+ GSLD+      R+PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWS+G+S +E+                    Q  Q +L                           +LL  IVD  PP  P   FS+ F+NF+  C+++   +RP   +L+ +  ++
Sbjct:  156 GQINEQDIQYQEQLGHGNGGTVYKAYHLLGKRVLAVKVIPLDITAELQKQIMSELEILYKCDSPYIITFYSAFFVENRISICTEFMDGGSLDVYR----RIPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSVGISFMEI--------------------QKNQGSLMP------------------------LQLLQCIVDEDPPVFPVGQFSDKFVNFITQCMRKQPKERPAPNNLMDHHFIM 407          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:103027486])

HSP 1 Score: 215.312 bits (547), Expect = 8.589e-64
Identity = 113/303 (37.29%), Postives = 174/303 (57.43%), Query Frame = 3
Query:  348 LSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAI---FELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLN 1247
            ++  D ++  +LG GNGG V K  +     ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ ++ AFF +  IS C E+M+ GSLD+      R+PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + SDVWS+G+S +E+                                      K + +Q +  + M I    E   Y V   PP  P   FS+ F+NF+  C+++   +RP   +L+ +  ++ 
Sbjct:  123 INEQDIQYQEQLGHGNGGTVYKAYHLLGKRVLAVKVIPLDITAELQKQIMSELEILYKCDSPYIITFYSAFFVENRISICTEFMDGGSLDVYR----RIPEHVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSVGISFMEV--------------------------------------KFRKIQKNQGSLMVICFLMEFSLYCVFQDPPVFPVGQFSDKFVNFITQCMRKQPKERPAPNNLMDHHFIMQ 382          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004725.1 (pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-1 gene:ENSPMAG00000004255.1 transcript:ENSPMAT00000004725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 388.267 bits (996), Expect = 1.487e-132
Identity = 184/316 (58.23%), Postives = 245/316 (77.53%), Query Frame = 3
Query:  246 DVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNN------MAIFELLAYIVDYPPPRVPEFCFSEDFINFVH 1175
            ++EE+ KKLE  +LD+ Q+++L  F+ +K+ + EL  DDFE ++ELG GNGGVV+KV +KP+ LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLDLV+K AGR+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GRYPIPP + ++    F +      AE ++     +     +   + N      MAIFELL YIV+ PPP++P   F++DF +FV+
Sbjct:    7 NLEELQKKLEELELDEQQKKRLEAFLTQKQKVGELKDDDFEKLSELGAGNGGVVTKVLHKPSALIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDLVLKKAGRIPEEILGKVSIAVIKGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYPIPPPEAKELEGIFGKAVTEG-AEAMQNNTSPRPRPPGRPGSAYNMDARPPMAIFELLDYIVNEPPPKLPCTVFTQDFQDFVN 321          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map2k4b (mitogen-activated protein kinase kinase 4b [Source:ZFIN;Acc:ZDB-GENE-080721-13])

HSP 1 Score: 207.994 bits (528), Expect = 3.398e-62
Identity = 126/344 (36.63%), Postives = 184/344 (53.49%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMK-----NAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERL----IGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP---EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGL 1337
            + +ADD + + E+G+G  G V+K+++  +  IMA K I   +    + Q++ +L V+   + PYIV +FGA F +GD   CME M S S D   K     +   +PE I+ KIT++ V  L YL+E L IIHRDVKPSNIL++  G +KLCDFG+SGQL+DS+A +   G R YMAPER+      + Y+VRSDVWSLG++LIEL+TG++P P                                           ++F+ L  +V   PP++    E  FS  FINFV+SCL ++ S RP+   LL +  +L            YE   ++V+ Y    L+ +
Sbjct:   61 DFTADDLKDLGEIGRGAYGSVNKMQHNHSAHIMAVKRIRSTVDEKEQKQLLMDLDVVMSSDCPYIVQFFGALFREGDCWICMELM-STSFDKFYKFVYCTSDDVIPEEILGKITLATVKALNYLKENLKIIHRDVKPSNILLDRRGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLIELATGKFPYPKWN----------------------------------------SVFDQLTQVVKGDPPQLSNSEERQFSASFINFVNSCLTKDESRRPKYRELLKHPFIL-----------MYESRNVDVAVYFCKTLDRM 352          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 203.371 bits (516), Expect = 1.346e-60
Identity = 111/304 (36.51%), Postives = 175/304 (57.57%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDL----VMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGE----EYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLL 1226
            E+ ADD E I ELG+G  GVV +VR+ P+  IMA K I   +    + +++ +L + +   + PY V ++GA F +GD+  CME M++ SLD     V++    +PE I+ KI+V++V  L +L  +L +IHRDVKPSN+L+N++G VK+CDFG+SG L+DS+A +   G + YMAPER+  E     YNV+SD+WSLG+++IEL+  ++P      E + + F Q +Q                                   +V+ P P++P   FS +F++F   CL++N ++RP    L+
Sbjct:   60 EVKADDLESICELGRGAYGVVERVRHTPSGTIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPYTVTFYGALFREGDVWICMELMDT-SLDKFYKKVIEKGLTIPEDILGKISVAIVKALEHLHSKLSVIHRDVKPSNVLINTQGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEINQKGYNVKSDIWSLGITMIELAILKFPY-----ESWGTPFQQLKQ-----------------------------------VVEEPSPQLPPENFSPEFVDFSTLCLKKNPNERPTYAELM 322          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 201.06 bits (510), Expect = 1.508e-59
Identity = 122/361 (33.80%), Postives = 192/361 (53.19%), Query Frame = 3
Query:  276 NQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVL---HDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANS-FVGTRSYMAPERL-----IGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP-EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLL 1328
            +QKL +   Q  F  +  K+  +++S  + E + E+G G  G V K+RYKPT+ I+A K +          +I+ +L V+   HDC  PYIV   G+F ++ D+   ME M + +  L  +  G +PE I+ K+TV++V  L YL+E+  +IHRDVKPSNIL++S G +KLCDFG+SG+L+DS A +   G  +YMAPER+        +Y++R+DVWSLG+SL+EL+TG++P    K +                                        FE+L  ++   PP +P +  FS DF  FV  CL ++   RP+   LL +  L           ++YE   ++V+ + R+++
Sbjct:   49 DQKLQEIMNQTGFLTLDGKRYRADIS--ELETLGEMGSGTCGQVWKMRYKPTSHILAVKQMRRSGNKDENKRILMDLDVVLKSHDC--PYIVQCHGSFITNTDVFIAMELMGTCAEKLKKRIQGPIPENILGKMTVAIVKALSYLKEKHGVIHRDVKPSNILLDSRGRIKLCDFGISGRLVDSKAKTRGAGCAAYMAPERIDPPDPTHPDYDIRADVWSLGISLVELATGQFPYQNCKTD----------------------------------------FEVLTKVLQEDPPLLPSDMGFSLDFQAFVKDCLTKDHRKRPKYNKLLEHAFL-----------RRYERVEVDVATWFRDVM 354          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000668.1 (pep scaffold:Pmarinus_7.0:GL491759:2102:4562:1 gene:ENSPMAG00000000606.1 transcript:ENSPMAT00000000668.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 5.598e-41
Identity = 63/108 (58.33%), Postives = 87/108 (80.56%), Query Frame = 3
Query:  276 NQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYM 599
            + ++D  Q+++L  F+  K+ + EL  DDF+ ++ELG GNGGVV+KV ++P+ +IMARK IHLEIKPA++ QI+RELQVLH CNSPYIVG++GAF+ DG+IS CME M
Sbjct:    2 DSEVDREQQKRLDAFLHDKQKVGELKDDDFQKLSELGAGNGGVVNKVLHRPSGIIMARKLIHLEIKPAIRTQILRELQVLHKCNSPYIVGFYGAFYIDGEISICMENM 109          
BLAST of Protein kinase vs. Ensembl Yeast
Match: PBS2 (MAP kinase kinase of the HOG signaling pathway; activated under severe osmotic stress; mitophagy-specific regulator; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000003664])

HSP 1 Score: 254.218 bits (648), Expect = 8.649e-77
Identity = 150/351 (42.74%), Postives = 204/351 (58.12%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNA---GRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNS-EGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIG-----EEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLL------NGLSNDV 1349
            S ++ D+ EF+ ELG GN G VSKV +KPTN+IMA K + LE+  A   QI+ EL+VLH CNSPYIV ++GAFF +G +  CMEYM+ GSLD +   +   G + EP +A I  +V++GL  L+E+ +IIHRDVKP+NIL ++ +G VKLCDFGVSG L+ S+A + +G +SYMAPER+         Y V+SD+WSLGLS++E++ GRYP PP   E + + FSQ                                   L+ IVD PPPR+P   FS D  +FV  CLQ+    RP   +L  +  L+   KY  Q     E+ T  +    RN +      NGLS +V
Sbjct:  353 SRITLDELEFLDELGHGNYGNVSKVLHKPTNVIMATKEVRLELDEAKFRQILMELEVLHKCNSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDESSEIGGIDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPP---ETYDNIFSQ-----------------------------------LSAIVDGPPPRLPSDKFSSDAQDFVSLCLQKIPERRPTYAALTEHPWLV---KYRNQDVHMSEYITERLE--RRNKILRERGENGLSKNV 660          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 196.823 bits (499), Expect = 9.257e-57
Identity = 116/306 (37.91%), Postives = 167/306 (54.58%), Query Frame = 3
Query:  357 DDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIH-LEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSD--GDISFCMEYMNSGSLDLVMKN----AGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE----FCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            D  E +  LG+G GG VSK + K  + I A K I+ L   P  + QI RELQ      S YIV Y+G F  D    I   MEYM   SLD + KN     GR+ E ++ KI  +V+ GL YL E+  +IHRD+KP NIL+N  G+VKLCDFGVSG+ ++S+A +F GT  YMAPER+ G+ Y+V SDVWSLGL+++E++ G++P                     +E + A                N+A FELL +I+ + P    E      +S  F +F+  CL++++ +RP    ++ +  +
Sbjct:  219 DRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEK-KVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCS-------------------SEKMAA----------------NIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWI 488          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 194.126 bits (492), Expect = 9.395e-56
Identity = 115/311 (36.98%), Postives = 165/311 (53.05%), Query Frame = 3
Query:  357 DDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIH-LEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSD--GDISFCMEYMNSGSLDLVMKN----AGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE----FCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNK 1256
            D+   +  LG+G GG V+K R K    + A K I+ +   P  + QI RELQ      S YIV Y+G F  +    I   MEYM   SL+   KN     GR+ E ++ KI  SV+ GL YL E   +IHRD+KP NIL+N +GE+KLCDFGVSG+ ++S+A +F GT  YMAPER+ G+ Y+V  DVWSLGL+L+E++ GR+P            F  D+                        + N+A  ELL  I+ + P    E      +S+ F +F+  CL+++A +RP    +L +  ++   K
Sbjct:  212 DEITTLGILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHER-KVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFP------------FESDKI-----------------------TQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWIVGQMK 486          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 182.57 bits (462), Expect = 1.673e-51
Identity = 113/341 (33.14%), Postives = 187/341 (54.84%), Query Frame = 3
Query:  309 LFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIK-PAVKAQIIRELQVLHDCNSPY--IVGYFGAFFS---DGDISFCMEYMNSGSLDLVMKNAGRL-------------PEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP-EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQS 1271
            L + ++   N + +   D   + ++G GN G V K  + P + I+A+K I +E     +  Q++REL ++ +   P+  I+ ++GA+++   + +I   MEY + GSLD ++    R               E  ++KI   V+NGL +L  +  IIHRD+KPSN+L+NS+G++KLCDFGVS +LI+S+A++FVGT +YM+PER+ G  Y+++ DVWSLGL +IEL TG +P                    L  H               +D+ +  I +LL  IV+ P PR+P +  +S++  +FV+ C  +N  +R  +  LL + L++   KY+  S
Sbjct:  173 LKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNV-KPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFP--------------------LGGH---------------NDTPD-GILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIM---KYVSPS 473          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 123.635 bits (309), Expect = 1.066e-30
Identity = 94/294 (31.97%), Postives = 139/294 (47.28%), Query Frame = 3
Query:  381 LGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNA--GRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMA-NSFVGTRSYMAPERLIGE--EYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLN 1247
            +G+GN G V K   + T  I+A K ++LE        + +E+  L +  SP I  Y      D  +   MEY   GS   ++K +    LPE  V+ I   V  GL YL E+  I HRD+K +NIL+N EG VKL DFGVSG +  ++  ++FVGT  +MAPE +  E   YN ++D+WSLG++  EL  G   +PP  + D +   +     NL +     L G                                   FS+   +FV  CL +  +DRP   +LL+++ + N
Sbjct:   24 IGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKI-HRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKG---LPPLSKYDPMKVMT-----NLPKRKPPKLQGP----------------------------------FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKN 274          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO45553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSF4])

HSP 1 Score: 406.757 bits (1044), Expect = 4.601e-139
Identity = 196/338 (57.99%), Postives = 256/338 (75.74%), Query Frame = 3
Query:  249 VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALY--GKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNK 1256
            VEE+ KKL++  LD+ QR++L EF+ +K+ I ELS DDFE I ELG GNGGVV+KV +KPT LIMARK IHLE+KPA++ QIIREL+VLHDCNSPYIVG+FGAF+SDG+IS CME+M+ GSLDL++K AGR+PE I+ KI+++V+ GL YLRE   IIHRDVKPSNILVNS GE+K+CDFGVSGQLIDSMANSFVGTRSYM+PERL G +Y ++SD+WS GLSL+E++ GRYPIPP   ++     S++  +++A  +       G +  +   +++  MAIFELL YIV+ PPP +P   FS +F  FV  CL +N   R  L  L+T++ +   +K
Sbjct:    1 VEEVRKKLDDLNLDEIQRRRLEEFLNEKRKIGELSNDDFEKITELGAGNGGVVTKVLHKPTGLIMARKLIHLEVKPAIRTQIIRELKVLHDCNSPYIVGFFGAFYSDGEISICMEHMDGGSLDLILKKAGRIPEDILGKISIAVLKGLCYLREIHQIIHRDVKPSNILVNSRGEIKMCDFGVSGQLIDSMANSFVGTRSYMSPERLQGNQYTIQSDIWSFGLSLVEMAIGRYPIPPPDPQEIEKVLSRE-PSSMASPMSVGRLPPGVRPPSGVNNETRPMAIFELLDYIVNEPPPILPGAHFSPEFCEFVQKCLVKNPKQRADLTYLMTHKFIAKADK 337          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO40740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6F5])

HSP 1 Score: 243.432 bits (620), Expect = 2.020e-74
Identity = 129/295 (43.73%), Postives = 188/295 (63.73%), Query Frame = 3
Query:  342 SELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLL 1226
             +L+ +  + +  LG GNGG V K  +  T  I+A K I L++ P V+ QII E+++   C SPYI+ ++GAFF +  IS C EYM+ GSLD+     G +PEP++ +I V+VV GL YL   L I+HRDVKPSNILVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER++G+EY++ S+VWSLG+SL+E+++GR+P        +L    Q     LA +     +G     + +         ELL  IV   PPR+P+  FS  F++FV  C+Q++ S R   E++L
Sbjct:  146 GQLNQEQIQHLEILGYGNGGTVYKAIHLTTRRIIAVKVIPLDVTPEVQRQIISEMEISFQCASPYIIEFYGAFFVENRISMCTEYMDGGSLDMY----GSIPEPVLGRIAVAVVKGLAYLWG-LKIMHRDVKPSNILVNTRGQVKLCDFGVSRQLVNSIATTYVGTNAYMAPERILGDEYSILSEVWSLGVSLLEMASGRFP--------YLKVSIQ-----LASYF---FFGNHCFLVPI---------ELLQCIVHEAPPRLPDHLFSPVFVDFVAQCMQKSPSTRLTPEAVL 410          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO38062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX6])

HSP 1 Score: 193.741 bits (491), Expect = 9.420e-57
Identity = 112/309 (36.25%), Postives = 166/309 (53.72%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDL----VMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERLIGEE----YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            +  ADD + I ELG G  G V ++ + PT+ +MA K I   +    + +++ +L + +   + PY V ++GA F +GD+  CME M +   DL      K   R+PE ++ KI VSVV+ L YL   L +IHRDVKPSNILV+  G  KLCDFG+SGQL+DS+A +   G + YMAPER+  +     Y++RSD+WSLG+++IEL+TG++P            ++Q +                              FE L  +V  P P +PE  FS +F +FV   L +N  +RP    LL +  +
Sbjct:   52 DCQADDLQEIRELGHGAYGYVYEMLHVPTSTVMAVKKIRANVNSTEQKRLLMDLDISMRVSDYPYTVHFYGALFREGDVWICMELMKTSLYDLYKQVFSKPDRRIPEEVLGKIAVSVVSALEYLHSNLKVIHRDVKPSNILVDERGNFKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDIRSDIWSLGITMIELATGKFP------------YTQWKTP----------------------------FEQLKQVVHEPSPSLPEGPFSLNFRDFVTKSLIKNYKERPNYNQLLEHPFI 320          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO48408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJN6])

HSP 1 Score: 187.578 bits (475), Expect = 6.788e-55
Identity = 114/341 (33.43%), Postives = 178/341 (52.20%), Query Frame = 3
Query:  345 ELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMN---SGSLDLVMKNAGRL-PEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPERL----IGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRV---PEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLL 1328
            E S+ D     E+G+G  G V+K+ +  +N  MA K I   +    + Q++ +L V +   N P+IV ++GA F++GD   CME M         LV  +  ++ PE I++K+  +VV  L YL+ EL+IIHRDVKPSNIL++  G +KLCDFG+SG L+DS+A +   G + YMAPER+      + Y++RSDVWS G+++IELSTG +P P                                           ++F+ L+ +VD  PP++   PE   S + +NFV+ CL +    RP+   LL +Q +           + Y+   ++V  +L+ +L
Sbjct:    3 EYSSSDLVDCGEIGRGAYGTVNKMLHPNSNTFMAVKRIRSTVDQKDQKQLLMDLDVVMRSSNCPFIVRFYGALFTEGDAWICMELMEISFDKCYKLVYGSIEQIIPEEILSKVAYAVVKALDYLKRELNIIHRDVKPSNILLDRNGAIKLCDFGISGHLVDSIAKTRDAGCKPYMAPERIDPSSCRQGYDIRSDVWSFGITMIELSTGVFPYPKWN----------------------------------------SVFDQLSQVVDGDPPQLSNTPEMMRSPELLNFVNICLSKEVEKRPKYNELLNHQFI-----------QLYQERPVDVGAWLQEVL 292          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO43384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU8])

HSP 1 Score: 181.8 bits (460), Expect = 1.394e-52
Identity = 113/331 (34.14%), Postives = 171/331 (51.66%), Query Frame = 3
Query:  279 QKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVL---HDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANS-FVGTRSYMAPERL-----IGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVP-EFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            +KL + ++Q     +  KK   + S DD E   E+G G  G V K+++K +  ++A K +        + +I+ +L+V+   HDC  PYIV   GA  S  D+  CME M +    L+ +    +PE I+ K+ V++V  L YL+EE  ++HRDVKPSN+L++S G VKLCDF +SG+L+DS A +   G  +YMAPER+     +   Y+VR+DVWSLG+SL+EL+TG +P                                          N    FE+L  ++   PP +P    FS DF +FV  CL ++   RP+   LL +  +
Sbjct:   17 KKLKEIKQQTGILKLGDKKY--DFSLDDLEMSGEIGYGTCGQVCKMKHKKSGQVLAVKRMARSHNKEEQKRILMDLEVVMKSHDC--PYIVTCMGALISKSDVFICMELMATCLDKLLKRLQNPIPEHILGKMAVAIVKALHYLKEEHGVMHRDVKPSNMLLDSAGCVKLCDFSISGRLVDSKAKTKSAGCAAYMAPERIDPPDPMNPNYDVRADVWSLGISLVELATGEFPY----------------------------------------RNCTTEFEVLTRVMGEDPPSLPGSKGFSHDFSSFVDECLTKDFHYRPKYNKLLVHPFI 303          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map2k2a (mitogen-activated protein kinase kinase 2 [Source:NCBI gene;Acc:101173453])

HSP 1 Score: 400.979 bits (1029), Expect = 8.617e-136
Identity = 198/362 (54.70%), Postives = 263/362 (72.65%), Query Frame = 3
Query:  183 RKHPPLRLSLISSNRVSTGPMD------VEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAAL-YGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            R+  PL ++ I   + ++  +D      +E + KKL    LD+ QR++L  F+ +K  + EL  +DFE I ELG GNGGVV+KVR+KP+ L+MARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD V+K A R+PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SDVWS+GLSL+EL+ GRYPIPP  AKE + +  F+    A    H +     G+ +    V     MAIFELL YIV+ PPP++P   F+ DF +FV  CL +N ++R  L+ L+++  +
Sbjct:    5 RRPVPLNITPIGEGQTTSNTIDAASEANLEALQKKLGELDLDEQQRKRLEAFLTQKAQVGELKDEDFEPICELGAGNGGVVNKVRHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGFAILDGAEGEPHTQRPRPPGRPVSGHGVDSRPAMAIFELLDYIVNEPPPKLPHGVFTSDFQDFVTKCLIKNPAERADLKMLMSHTFI 366          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map2k1 (mitogen-activated protein kinase kinase 1 [Source:NCBI gene;Acc:101162677])

HSP 1 Score: 390.193 bits (1001), Expect = 1.571e-131
Identity = 192/359 (53.48%), Postives = 263/359 (73.26%), Query Frame = 3
Query:  183 RKHPPLRLSLI----SSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPP--AKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            RK  P++L+ I    + N       ++E + KKLE  +LD+ QR++L  F+ +K+ + EL  DDFE I ELG GNGGVV KV ++P+ LIMARK IHLEIKPA++ QIIRELQVLH+CNSPYIVG++GAF+SDG+IS CME+M+ GSLD  +K AG++PE I+ K++++V+ GL YLRE+  I+HRDVKPSNILVNS GE+KLCDFGVSGQLIDSMANSFVGTRSYM+PERL G  Y+V+SD+WS+GLSL+E++ GR+PIPP  ++E + +  F  + +   +E  +    G+   +        MAIFELL YIV+ PPP++P   FS +F +FV+ CL +N ++R  L+ L+ +  +
Sbjct:    5 RKPEPIQLNPIPDGNTLNGTGASETNLESLQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQILGKVSIAVIKGLSYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRFPIPPPDSRELEKIFGFPVEGETASSESPKPRPPGRPGSSYGPDSRPPMAIFELLDYIVNEPPPKLPAI-FSSEFQDFVNKCLIKNPAERADLKQLVVHPFI 362          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:101169919])

HSP 1 Score: 232.646 bits (592), Expect = 1.625e-70
Identity = 132/360 (36.67%), Postives = 202/360 (56.11%), Query Frame = 3
Query:  174 PVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
            P + K P +R   I   +V+T P    +    + +   +++ ++   E      N  +++A D  +   LG GNGG V K  +   N ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ +F AFF +  IS C E+M+ GSLD+       +PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + +DVWS+G+S +EL+ G +P P            Q  Q +L                           +LL  IVD  PP +P   FSE F++F+  C+Q N  +RP   +L+ +  ++  N
Sbjct:   55 PRAGKTPGIRN--IHGLKVNTRPNPESDSTHAVSDSIANNSLKKSSAELKKILTNGQQINAQDIHYQELLGHGNGGTVYKAYHVLGNRVLAVKVIPLDITVELQKQIMSELEILYKCDSPYIITFFSAFFVENRISICTEFMDGGSLDVYKT----IPELVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHADVWSVGISFMELALGMFPYPQI----------QKNQGSLIP------------------------LQLLQCIVDEDPPVLPVGEFSEMFVHFITLCMQRNPKERPAPNNLMDHPFIIQFN 373          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:101169919])

HSP 1 Score: 232.646 bits (592), Expect = 6.426e-70
Identity = 132/360 (36.67%), Postives = 202/360 (56.11%), Query Frame = 3
Query:  174 PVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPN 1253
            P + K P +R   I   +V+T P    +    + +   +++ ++   E      N  +++A D  +   LG GNGG V K  +   N ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ +F AFF +  IS C E+M+ GSLD+       +PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + +DVWS+G+S +EL+ G +P P            Q  Q +L                           +LL  IVD  PP +P   FSE F++F+  C+Q N  +RP   +L+ +  ++  N
Sbjct:  103 PRAGKTPGIRN--IHGLKVNTRPNPESDSTHAVSDSIANNSLKKSSAELKKILTNGQQINAQDIHYQELLGHGNGGTVYKAYHVLGNRVLAVKVIPLDITVELQKQIMSELEILYKCDSPYIITFFSAFFVENRISICTEFMDGGSLDVYKT----IPELVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHADVWSVGISFMELALGMFPYPQI----------QKNQGSLIP------------------------LQLLQCIVDEDPPVLPVGEFSEMFVHFITLCMQRNPKERPAPNNLMDHPFIIQFN 421          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map2k5 (mitogen-activated protein kinase kinase 5 [Source:NCBI gene;Acc:101169919])

HSP 1 Score: 220.32 bits (560), Expect = 8.477e-66
Identity = 126/336 (37.50%), Postives = 189/336 (56.25%), Query Frame = 3
Query:  174 PVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSC 1181
            P + K P +R   I   +V+T P    +    + +   +++ ++   E      N  +++A D  +   LG GNGG V K  +   N ++A K I L+I   ++ QI+ EL++L+ C+SPYI+ +F AFF +  IS C E+M+ GSLD+       +PE ++ +I V+VV GL YL   L I+HRDVKPSN+LVN+ G+VKLCDFGVS QL++S+A ++VGT +YMAPER+ GE+Y + +DVWS+G+S +EL+ G +P P            Q  Q +L                           +LL  IVD  PP +P   FSE F++F+  C
Sbjct:   55 PRAGKTPGIRN--IHGLKVNTRPNPESDSTHAVSDSIANNSLKKSSAELKKILTNGQQINAQDIHYQELLGHGNGGTVYKAYHVLGNRVLAVKVIPLDITVELQKQIMSELEILYKCDSPYIITFFSAFFVENRISICTEFMDGGSLDVYKT----IPELVLGRIAVAVVKGLTYLWS-LKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHADVWSVGISFMELALGMFPYPQI----------QKNQGSLIP------------------------LQLLQCIVDEDPPVLPVGEFSEMFVHFITLC 349          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000040086.1 (SMESG000040086.1)

HSP 1 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 425/425 (100.00%), Postives = 425/425 (100.00%), Query Frame = 3
Query:   78 MSKNKLGLKIVAATNREEDENVDNADNHTATKPVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 1352
            MSKNKLGLKIVAATNREEDENVDNADNHTATKPVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI
Sbjct:    1 MSKNKLGLKIVAATNREEDENVDNADNHTATKPVSRKHPPLRLSLISSNRVSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLNGLSNDVI 425          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000004166.1 (SMESG000004166.1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.072e-148
Identity = 207/333 (62.16%), Postives = 257/333 (77.18%), Query Frame = 3
Query:  297 QRQKLFEFVAKKKNISELSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFST 1295
            Q+Q L  F   KK I +++ +D   + ELGKGNGGVV+KV++KP+  IMARKNIHLEIKPA++ QI+RELQVLHDCNSPYIVGY+G++  + +IS CMEYM+ GSLDL++K AGR PEPIVA IT SV+ GL+YLR+ L IIHRDVKPSNILVN EG+VKLCDFGVSG+LIDSMANSFVGTRSYMAPERL GE+YN  SDVWSLGLSL EL+TG YPIPP   E FLS FS  +  N  +HL A   G KL+A+Q S+   MAIFELL+YIVDYPPP +P+FCFS +F++F++ CL++  SDR  LE L  ++ +   +  +  S  K E+ +
Sbjct:  125 QKQILLNFQNIKKRIGDVAFEDIITLEELGKGNGGVVAKVKHKPSEQIMARKNIHLEIKPAIRTQIMRELQVLHDCNSPYIVGYYGSYHVETEISICMEYMDGGSLDLILKKAGRFPEPIVAHITCSVLRGLIYLRKALHIIHRDVKPSNILVNIEGDVKLCDFGVSGRLIDSMANSFVGTRSYMAPERLTGEQYNTLSDVWSLGLSLAELATGIYPIPPVGPEKFLSAFSIHKNENFIDHLMATENGTKLQAIQASEKGPMAIFELLSYIVDYPPPTLPDFCFSSNFLSFINYCLKKEPSDRLSLEMLEKHKFIAADSIAILTSEIKREYKS 457          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000057661.1 (SMESG000057661.1)

HSP 1 Score: 194.897 bits (494), Expect = 9.190e-57
Identity = 122/350 (34.86%), Postives = 184/350 (52.57%), Query Frame = 3
Query:  354 ADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNA-----GRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSF-VGTRSYMAPER----LIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE-FCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHKKYEFSTIEVSCYLRNLLN----GLS-NDVI 1352
            ++D + + E+G+G  G V+++ ++ T+ +MA K I   +  + +   + +L V +   N P+IV ++GA F +GD   CME M S SLD   +        ++PE I+ K+ V  V  L YL+ EL +IHRDVKPSN+L++ +G +KLCDFG+SGQLIDS+A S   G + YMAPER    L  + Y++RSDVWSLG+++IEL TG++P P  +                                        ++FE L  ++   PP V +   FS  F NF+  CL+++ S RPR + L  +   +N            EF  I VS Y   +L+    GLS ND +
Sbjct:   51 SEDLQDLGEIGRGAYGSVNRMIHRKTDQLMAVKRIRSTLDESQQYSTLNDLDVIMKSANCPFIVRFYGALFREGDCWICMELM-STSLDKFYRYVYVHLKEKIPEKILGKVAVGTVKALDYLKVELRVIHRDVKPSNVLIDRDGNIKLCDFGISGQLIDSIAKSRDAGCKPYMAPERIHPKLSAKGYDIRSDVWSLGITMIELGTGKFPYPAWE----------------------------------------SVFEQLTCVLHGDPPSVNDSMGFSRQFQNFIERCLEKDYSKRPRYDELKQHPFFINS-----------EFDQINVSEYFCKILDSVPKGLSLNDFV 348          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000040748.1 (SMESG000040748.1)

HSP 1 Score: 188.348 bits (477), Expect = 1.915e-54
Identity = 110/310 (35.48%), Postives = 165/310 (53.23%), Query Frame = 3
Query:  348 LSADDFEFIAELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQV-LHDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMK------NAGRLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFVGTRSYMAPERLIGEE----YNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPE-FCFSEDFINFVHSCLQENASDRPRLESLLTYQLL 1241
            +S  D E + ELGKG  G+V ++ +KP+NL+ A K +        + +I+ +L + +     PY+V  +GA    GD+  CME ++S SLD   K          +PE ++A IT  +V  L YL + L +IHRDVKPSN+L++  G VK+CDFG+SG L++S+A + +GT+SY+APER+I E     + +RSDVWSLGLS++EL+  ++P P                      L+ +LY                   L+ Y+ + PPP +PE   +S    NF+  CL     DR     LL + LL
Sbjct:   49 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYP----------------------LDISLYN------------------LITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL 317          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000007331.1 (SMESG000007331.1)

HSP 1 Score: 190.66 bits (483), Expect = 6.054e-53
Identity = 113/301 (37.54%), Postives = 166/301 (55.15%), Query Frame = 3
Query:  357 DDFEFIAELGKGNGGVVSKVRYK-----PTNLIMARKNIHLEIKPAVKAQIIRELQVL---HDCNSPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAG-RLPEPIVAKITVSVVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANSFV-GTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFLSTFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPPRVPEFCFSEDFINFVHSCLQENASDRPRLESLLT 1229
            D+FE  + LG G  G V ++R K     P  +   R++ H         +I R+L V+   HDC  P+IV  +G F S  ++  CME M S  LD ++K      PE ++ K++ +++  L YL+ + DI+HRD+KPSN+L++  GEVKLCDFG+S +L DS+ANS   G   YMAPERL    Y+VR+DVWSLG+SL+EL+ G++PI   K E                                        FE++A I+D  PP +PE  +SE F  FV SCLQ++ ++RP+ + L++
Sbjct:   75 DEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSH---SVEENKRIFRDLDVVTRCHDC--PFIVTCYGIFISPSEVWICMEEM-STCLDKLLKFLNCPFPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERLNSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSE----------------------------------------FEIMARIIDGKPPSLPEGVYSEAFNKFVSSCLQKDFNNRPKYDKLVS 329          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP2K12.245e-13656.30mitogen-activated protein kinase kinase 1 [Source:... [more]
MAP2K24.265e-13155.99mitogen-activated protein kinase kinase 2 [Source:... [more]
AC011005.19.565e-12149.60novel protein similar to mitogen-activated protein... [more]
MAP2K25.276e-10657.35mitogen-activated protein kinase kinase 2 [Source:... [more]
MAP2K55.486e-7239.80mitogen-activated protein kinase kinase 5 [Source:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mek-23.328e-11953.87Dual specificity mitogen-activated protein kinase ... [more]
sek-16.019e-6136.09Dual specificity mitogen-activated protein kinase ... [more]
sek-16.019e-6136.09Dual specificity mitogen-activated protein kinase ... [more]
mek-11.705e-5033.13Dual specificity mitogen-activated protein kinase ... [more]
mkk-42.469e-5032.21MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsor12.044e-12650.84gene:FBgn0010269 transcript:FBtr0071313[more]
Dsor12.532e-12650.84gene:FBgn0010269 transcript:FBtr0340120[more]
Mkk41.065e-6236.84gene:FBgn0024326 transcript:FBtr0334320[more]
Mkk41.065e-6236.84gene:FBgn0024326 transcript:FBtr0081892[more]
Mkk41.065e-6236.84gene:FBgn0024326 transcript:FBtr0300443[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k2b7.430e-13253.19mitogen-activated protein kinase kinase 2b [Source... [more]
map2k2b7.430e-13253.19mitogen-activated protein kinase kinase 2b [Source... [more]
map2k2a5.748e-13056.93mitogen-activated protein kinase kinase 2a [Source... [more]
map2k11.019e-12951.93mitogen-activated protein kinase kinase 1 [Source:... [more]
map2k51.229e-6838.49mitogen-activated protein kinase kinase 5 [Source:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pik3cb1.047e-13456.27phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3cb6.972e-13457.01phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3cb8.041e-13158.02phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
pik3cb5.838e-12959.11phosphatidylinositol-4,5-bisphosphate 3-kinase cat... [more]
map2k51.213e-6840.55mitogen-activated protein kinase kinase 5 [Source:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map2k12.134e-13656.30mitogen-activated protein kinase kinase 1 [Source:... [more]
Map2k22.770e-13356.72mitogen-activated protein kinase kinase 2 [Source:... [more]
Map2k29.628e-13356.89mitogen-activated protein kinase kinase 2 [Source:... [more]
Map2k52.258e-7139.80mitogen-activated protein kinase kinase 5 [Source:... [more]
Map2k41.518e-6136.52mitogen-activated protein kinase kinase 4 [Source:... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29678|MP2K1_RABIT8.966e-13656.30Dual specificity mitogen-activated protein kinase ... [more]
sp|Q02750|MP2K1_HUMAN1.078e-13556.30Dual specificity mitogen-activated protein kinase ... [more]
sp|Q01986|MP2K1_RAT1.189e-13556.30Dual specificity mitogen-activated protein kinase ... [more]
sp|P31938|MP2K1_MOUSE1.493e-13556.30Dual specificity mitogen-activated protein kinase ... [more]
sp|Q05116|MP2K1_XENLA3.030e-13556.56Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193PCD60.000e+092.94MAPK/ERK kinase 1/2 OS=Dugesia japonica OX=6161 PE... [more]
A0A430QH142.870e-17066.67Mitogen-activated protein kinase kinase 1 OS=Schis... [more]
A0A3Q0KDI96.838e-17066.67Protein kinase OS=Schistosoma mansoni OX=6183 PE=4... [more]
G4VT521.144e-16766.39Protein kinase OS=Schistosoma mansoni OX=6183 GN=S... [more]
A0A4Z2DCG12.917e-16765.84Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k2b8.045e-13455.85mitogen-activated protein kinase kinase 2 [Source:... [more]
map2k14.809e-13052.63mitogen-activated protein kinase kinase 1 [Source:... [more]
map2k52.896e-6638.21mitogen-activated protein kinase kinase 5 [Source:... [more]
map2k53.739e-6537.87mitogen-activated protein kinase kinase 5 [Source:... [more]
map2k58.589e-6437.29mitogen-activated protein kinase kinase 5 [Source:... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004725.11.487e-13258.23pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-... [more]
map2k4b3.398e-6236.63mitogen-activated protein kinase kinase 4b [Source... [more]
map2k61.346e-6036.51mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k71.508e-5933.80mitogen-activated protein kinase kinase 7 [Source:... [more]
ENSPMAT00000000668.15.598e-4158.33pep scaffold:Pmarinus_7.0:GL491759:2102:4562:1 gen... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PBS28.649e-7742.74MAP kinase kinase of the HOG signaling pathway; ac... [more]
MKK19.257e-5737.91MAPKK involved in the protein kinase C signaling p... [more]
MKK29.395e-5636.98MAPKK involved in the protein kinase C signaling p... [more]
STE71.673e-5133.14Signal transducing MAP kinase kinase; involved in ... [more]
SPS11.066e-3031.97Putative protein serine/threonine kinase; localize... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455534.601e-13957.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407402.020e-7443.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380629.420e-5736.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484086.788e-5533.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433841.394e-5234.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k2a8.617e-13654.70mitogen-activated protein kinase kinase 2 [Source:... [more]
map2k11.571e-13153.48mitogen-activated protein kinase kinase 1 [Source:... [more]
map2k51.625e-7036.67mitogen-activated protein kinase kinase 5 [Source:... [more]
map2k56.426e-7036.67mitogen-activated protein kinase kinase 5 [Source:... [more]
map2k58.477e-6637.50mitogen-activated protein kinase kinase 5 [Source:... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040086.10.000e+0100.00SMESG000040086.1[more]
SMESG000004166.12.072e-14862.16SMESG000004166.1[more]
SMESG000057661.19.190e-5734.86SMESG000057661.1[more]
SMESG000040748.11.915e-5435.48SMESG000040748.1[more]
SMESG000007331.16.054e-5337.54SMESG000007331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034146 ID=SMED30034146|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1698bp
TGCAGATCTTCAAACTTTAATTTAAAATTACATTTATTAAAGTAATTTAA
TATAATTAATCAAGGCTATTAATACGAATGTCTAAAAATAAACTCGGTTT
AAAAATTGTGGCAGCTACCAATCGTGAAGAAGACGAAAATGTTGATAATG
CTGATAATCATACCGCGACAAAGCCAGTTTCCAGAAAGCATCCACCTTTA
AGATTATCACTAATTAGTAGTAATCGAGTGAGTACCGGGCCAATGGACGT
TGAAGAAATTCACAAAAAATTAGAAAATCAAAAATTAGATGACACTCAAA
GACAAAAGTTATTTGAATTTGTTGCCAAAAAGAAAAACATTTCGGAATTA
TCTGCTGATGATTTTGAATTCATTGCTGAATTAGGCAAAGGTAATGGTGG
AGTTGTTAGTAAAGTTCGATATAAGCCTACAAATTTGATAATGGCCAGAA
AAAATATTCATCTAGAAATCAAGCCGGCAGTTAAAGCTCAAATAATCAGA
GAGCTACAAGTGTTGCATGATTGCAATTCTCCTTATATTGTCGGATATTT
CGGTGCTTTCTTTTCCGATGGCGATATCAGCTTCTGCATGGAATACATGA
ACTCTGGCAGTCTTGATCTAGTAATGAAGAATGCTGGCAGACTGCCGGAA
CCGATTGTCGCGAAGATTACCGTGTCGGTTGTCAATGGACTGCTGTATTT
GCGAGAAGAGTTGGATATTATTCATCGCGATGTGAAACCGTCAAATATTC
TCGTCAATTCCGAAGGCGAAGTGAAGCTCTGTGATTTCGGTGTCAGTGGT
CAGCTGATTGATTCGATGGCCAACTCGTTCGTTGGCACGCGAAGTTATAT
GGCTCCAGAGCGGCTGATTGGTGAGGAATACAATGTCCGCAGTGACGTGT
GGAGTCTAGGTTTGTCGTTAATAGAACTGTCCACCGGTCGCTATCCGATT
CCTCCGGCCAAAGAAGAAGATTTTCTGTCAACATTTTCCCAGGATCGGCA
GGCGAATTTAGCTGAGCACTTGGAAGCTGCTTTATATGGAAAAAAATTGA
AAGCAATGCAAGTATCCGATTCAAATAATATGGCTATATTTGAATTGCTA
GCATATATCGTTGACTATCCTCCTCCGCGCGTGCCAGAATTCTGTTTTTC
AGAAGACTTCATCAATTTTGTACACTCTTGTTTACAAGAAAATGCTTCCG
ATCGGCCTAGACTCGAGTCCTTGCTGACATACCAATTGTTGTTGAACCCC
AACAAATATCTCGAACAAAGTCATAAAAAGTATGAATTTTCAACAATAGA
AGTCAGCTGTTACCTGCGAAATCTCCTCAACGGACTTTCGAATGATGTGA
TATAATATTCTGATATTCTATGCATTGCCTTTTATTTAGAAAATTCAGTG
ATATTCAATATTTAACTCTGATTTCATAACAATTACTAGGTTTCATTTTT
ACTGACTTTTTCAAATACATTTTATAGTAATTGTTATGCAATAATAAATC
GCTTCCAGTTATTTTTTATTGTGGTGTTTTTTATATCTATGTTATCGCTA
ATAATTGTTTTTGCTAGATGTAATTGAGTGAAAGGTCAACATCATTTATA
GGCGGTGCCAGTTTTCGATATTAATTTTGGATCAACTCACCAGAGGGGTT
GGCTTTTTCAATTGAGTCGTAAAATTTCTTTTACAATTTTATTTTCTG
back to top

protein sequence of SMED30034146-orf-1

>SMED30034146-orf-1 ID=SMED30034146-orf-1|Name=SMED30034146-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=426bp
MSKNKLGLKIVAATNREEDENVDNADNHTATKPVSRKHPPLRLSLISSNR
VSTGPMDVEEIHKKLENQKLDDTQRQKLFEFVAKKKNISELSADDFEFIA
ELGKGNGGVVSKVRYKPTNLIMARKNIHLEIKPAVKAQIIRELQVLHDCN
SPYIVGYFGAFFSDGDISFCMEYMNSGSLDLVMKNAGRLPEPIVAKITVS
VVNGLLYLREELDIIHRDVKPSNILVNSEGEVKLCDFGVSGQLIDSMANS
FVGTRSYMAPERLIGEEYNVRSDVWSLGLSLIELSTGRYPIPPAKEEDFL
STFSQDRQANLAEHLEAALYGKKLKAMQVSDSNNMAIFELLAYIVDYPPP
RVPEFCFSEDFINFVHSCLQENASDRPRLESLLTYQLLLNPNKYLEQSHK
KYEFSTIEVSCYLRNLLNGLSNDVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 96..388
e-value: 9.7E-69
score: 244.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 97..385
e-value: 2.9E-57
score: 194.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 96..388
score: 42.676
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 177..420
e-value: 1.8E-59
score: 203.1
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 62..175
e-value: 3.7E-43
score: 148.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..37
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..33
NoneNo IPR availablePANTHERPTHR47448FAMILY NOT NAMEDcoord: 33..388
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 214..226
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 102..125
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 89..391