Receptor-type tyrosine-protein phosphatase beta

Overview
NameReceptor-type tyrosine-protein phosphatase beta
Smed IDSMED30034139
Length (bp)4156
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase beta (SMED30034139) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase beta (SMED30034139) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase beta (SMED30034139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase beta (SMED30034139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034139SMESG000005260.1 PL05001B1C04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30034139SMESG000005260.1 dd_Smed_v4_8686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034139SMESG000005260.1 dd_Smed_v4_8686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034139SMESG000005260.1 dd_Smed_v4_8686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034139SMESG000005260.1 dd_Smed_v4_8686_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034139SMESG000005260.1 dd_Smed_v4_5733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034139SMESG000005260.1 Contig20577uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034139SMESG000005260.1 Contig20577newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30034139SMESG000005261.1 SMESG000005260.1 Contig23027newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRQ (protein tyrosine phosphatase receptor type Q [Source:HGNC Symbol;Acc:HGNC:9679])

HSP 1 Score: 199.904 bits (507), Expect = 9.066e-51
Identity = 190/706 (26.91%), Postives = 309/706 (43.77%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKH----VSEATNTAITHLLPMD---------------SKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA--IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+++L+  T Y++ +T F+   +++     +S + +  T E  P      ++F+ +    T  + T+ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P        P  DA  K+ +      T   I +P  ++S++ G I+   ++++ET     GN +     Y N A      +     E   +PP  +   K + N       E YI+G +   ++    D   NGPLK    Y+  FRA    G  T       V  +    +   +  I+ V++ +  II L  AI+   R ++ +      S      I   L +D               ++  +   F ++ E +  ++N +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS I              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +  AW +HG P  S  L  +    +A +++    ++VHCSAGVGRTG FI +D  L++ + + D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1633 NEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTNTFVIAMLEGLKGGHTYNISVYAVNSAGAG-PKVPMRITMDIKAPARPKTKPTPIYDATGKLLVTS----TTITIRMPICYYSDDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCTEGKTKFSGN------EEIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPQDAEIIDTKLKLDQLITVADLELKDERLTRPISKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADASVPGSDYINASYISG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDIVITKLMEDVQIDWTI---RDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALD-HLTQHINDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2297          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRQ (protein tyrosine phosphatase receptor type Q [Source:HGNC Symbol;Acc:HGNC:9679])

HSP 1 Score: 199.134 bits (505), Expect = 1.307e-50
Identity = 193/720 (26.81%), Postives = 311/720 (43.19%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--------------------------EATNTAITHLL-------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA--IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+++L+  T Y++ +T F+   +++     +S + +  T E  P      ++F+ +    T  + T+ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P        P  DA  K+ +      T   I +P  ++S++ G I+   ++++ET     GN +     Y N A      +     E   +PP  +   K + N       E YI+G +   ++    D   NGPLK    Y+  FRA    G  T       V  +    +   +  I+ V++ +  II L  AI+   R ++ +                             E  +  +T LL       P+  KS     F ++ E +  ++N +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS I              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +  AW +HG P  S  L  +    +A +++    ++VHCSAGVGRTG FI +D  L++ + + D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1591 NEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTNTFVIAMLEGLKGGHTYNISVYAVNSAGAG-PKVPMRITMDIKAPARPKTKPTPIYDATGKLLVTS----TTITIRMPICYYSDDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCTEGKTKFSGN------EEIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPQDAEIIDTKLKLDQLITVADLELKDERLTRLLSYRKSIKPISKKS-----FLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADASVPGSDYINASYISG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDIVITKLMEDVQIDWTI---RDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALD-HLTQHINDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2264          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 172.94 bits (437), Expect = 1.100e-42
Identity = 129/381 (33.86%), Postives = 180/381 (47.24%), Query Frame = 3
Query: 2955 IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQD--SNGRLLDDFREIKELAVKLERQKV----------------IMFT------EGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVF----NVSMDEKEISVTQLHMLAWKDHGCPT-TSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQA 3992
            ++G  +AV  IIC+ IAI     YK+  H     +   T  L +++   A H   +  E  + +  + G L      I ++A   ER K                   FT      E N  KNR++N+  Y H+RV L     +  +DYINA+ +              C N YIATQGP+ E       T GDFWRM+ E     IV +TR+EE  + KC QYWP    +   +      I V +  +++ + F  R F    N S +++E  V Q    AW DHG P   + FLAF    +     +   IVVHCSAGVGRTG FI+ID  L RI K +  +++Y ++  +R  R  MVQTE QY F    IHE L++A
Sbjct:  855 VIGPVLAVVFIICIVIAILL---YKKKPHSKRKDSEPRTKCL-LNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYR----------CQNAYIATQGPLPE-------TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTIELATFCVRTFSLHKNGSSEKRE--VRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERI-KPEKTVDVYGHVTLMRSQRNYMVQTEDQYSF----IHEALLEA 1201          

HSP 2 Score: 151.369 bits (381), Expect = 4.486e-36
Identity = 96/260 (36.92%), Postives = 129/260 (49.62%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ---SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR  NI PY+  RV L     +  +DYINAS I     Q            YIATQGP+ E  E       DFWRM+ ENN  ++V LT++ E G+EKC QYWP E + +  Y+  D      M        ++ R F V+   D +  +V Q     W + G P + E F+ F     K ++    +  I VHCSAGVGRTG FI +   L R ++ +  ++I+  +  LR  R  MVQTE +Y F Y    EYL
Sbjct: 1258 NKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQ----------KAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLER-MRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1493          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRA (protein tyrosine phosphatase receptor type A [Source:HGNC Symbol;Acc:HGNC:9664])

HSP 1 Score: 167.162 bits (422), Expect = 1.390e-41
Identity = 115/370 (31.08%), Postives = 189/370 (51.08%), Query Frame = 3
Query: 2958 VGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNT----------AITHLLPMDSKSPAAHEFHENY--EFMKQDSNGRLLDDFREIKE-----LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            V V+++  ++I   I + +++R+K+ K     +N+               +P+ ++SP+ +  +     + ++++ N R+ DD +  +E      A  ++        E N  KNR+ NI PY H+RV L     +  +DYINAS I       EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y        ++   +DY++    +++V +++  + +  +TQ H  +W D G P T   +      +K +  N     AIVVHCSAGVGRTGTF++ID  L  ++  + ++++Y  +  +R  RCQMVQT+ QY FIY  + E+
Sbjct:  146 VMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQ---EK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTP--IGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLD-MMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEH 492          

HSP 2 Score: 145.591 bits (366), Expect = 9.956e-35
Identity = 98/296 (33.11%), Postives = 150/296 (50.68%), Query Frame = 3
Query: 3126 YEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV--SMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            Y  +   SN  L ++F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          YIA+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYWP++    +  Y +   I VE+    +   +  R   V  + + K   + Q H   W + G P+  +  ++  +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  513 YNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNL-PANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YIASQGPL-------LHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSD---GLVSYGD---ITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 783          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Match: PTPRA (protein tyrosine phosphatase receptor type A [Source:HGNC Symbol;Acc:HGNC:9664])

HSP 1 Score: 167.162 bits (422), Expect = 1.390e-41
Identity = 115/370 (31.08%), Postives = 189/370 (51.08%), Query Frame = 3
Query: 2958 VGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNT----------AITHLLPMDSKSPAAHEFHENY--EFMKQDSNGRLLDDFREIKE-----LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            V V+++  ++I   I + +++R+K+ K     +N+               +P+ ++SP+ +  +     + ++++ N R+ DD +  +E      A  ++        E N  KNR+ NI PY H+RV L     +  +DYINAS I       EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y        ++   +DY++    +++V +++  + +  +TQ H  +W D G P T   +      +K +  N     AIVVHCSAGVGRTGTF++ID  L  ++  + ++++Y  +  +R  RCQMVQT+ QY FIY  + E+
Sbjct:  146 VMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQ---EK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTP--IGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLD-MMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEH 492          

HSP 2 Score: 145.591 bits (366), Expect = 9.956e-35
Identity = 98/296 (33.11%), Postives = 150/296 (50.68%), Query Frame = 3
Query: 3126 YEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV--SMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            Y  +   SN  L ++F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          YIA+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYWP++    +  Y +   I VE+    +   +  R   V  + + K   + Q H   W + G P+  +  ++  +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  513 YNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNL-PANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YIASQGPL-------LHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSD---GLVSYGD---ITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 783          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 145.206 bits (365), Expect = 7.923e-37
Identity = 99/309 (32.04%), Postives = 150/309 (48.54%), Query Frame = 3
Query: 3111 EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEG--NDAKNRFSNIKPYKHNRVKLLAKN-----DYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQL----HMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKED---DRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            +F ++   M  DS+ R  +++  ++ + V     + +  +E   N  KNRF+NI  Y H+RVKL   N     DYINA+ +    + S +E        +IA QGP+   R+        FW+M  E     I+ LT+  E G++KC QYWP   N  + Y      I V + +  ++  FV R   +     +  VT+     H +AW D G P+      +F   +  +      N   +VHCSAGVGR+GTFI ID    R+L+     D I+++  +  +R  RCQMVQ E QY FI+  I + L
Sbjct:  104 DFADHVRLMSADSDFRFSEEYDMMRNVGVG----QSVAASELPINRPKNRFTNIPSYDHSRVKLSNPNNIEGGDYINANYVPG--FSSRRE--------FIAAQGPLPTTRD-------HFWQMTWEQQCPAIIALTKCVEKGRDKCHQYWPDHENVPVLYGD----IEVTIVAEKEFDEFVIRDIRLEKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSRMFRHHLPHSPHNAPTIVHCSAGVGRSGTFISID----RLLQSSSFGDPIDVFGTVCEMRYERCQMVQNEQQYIFIHYCILQVL 383          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: Y71G12B.31 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:W6RYA7])

HSP 1 Score: 142.51 bits (358), Expect = 7.610e-36
Identity = 107/301 (35.55%), Postives = 147/301 (48.84%), Query Frame = 3
Query: 3156 RLLDDFREIKELAVKLERQKVIMFTEGND------AKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV------------------SMDEKEISVTQLHMLAWKD-HGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            RLL D     E  V L R +    T   D      A NR+S+I PY H  V+L    DYINAS +     Q E +     +  +IATQGPI        +TV DFWRMI++ +V  IV L + +E   +KC +YWP+ +  K   Y E   ++V++   ++   +V R F+V                  S  +  + V+Q     WKD  G P  + FL F    R  RQ    IVVHCSAG+GRTG FI  D  +SR  + +  I+I++ +   R+ R  MV T  QY  IY +I EYL
Sbjct:  139 RLLQD-----EFLV-LSRTEARRLTRSTDRATRHAAANRYSDIVPYDHTLVEL-DTGDYINASFV-----QGESD-----ATRWIATQGPIDSGECIGKETVSDFWRMIVQYDVACIVMLGQHQEDFVQKCGEYWPSAMG-KTERYGE---VDVKLVCELEEKTWVHREFDVSPTSSYSSSTKSSRKSRASRQQSHMKVSQWQYKEWKDTGGAPRIANFLEFLLQVR-GRQYTSPIVVHCSAGIGRTGVFICTDNVISR-FESEGIIDIFSEVNRSRQQRPSMVYTVKQYECIYDIIGEYL 416          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: dep-1 (Receptor-type tyrosine-protein phosphatase dep-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGJ9])

HSP 1 Score: 145.591 bits (366), Expect = 8.787e-35
Identity = 99/309 (32.04%), Postives = 150/309 (48.54%), Query Frame = 3
Query: 3111 EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEG--NDAKNRFSNIKPYKHNRVKLLAKN-----DYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQL----HMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKED---DRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            +F ++   M  DS+ R  +++  ++ + V     + +  +E   N  KNRF+NI  Y H+RVKL   N     DYINA+ +    + S +E        +IA QGP+   R+        FW+M  E     I+ LT+  E G++KC QYWP   N  + Y      I V + +  ++  FV R   +     +  VT+     H +AW D G P+      +F   +  +      N   +VHCSAGVGR+GTFI ID    R+L+     D I+++  +  +R  RCQMVQ E QY FI+  I + L
Sbjct: 1056 DFADHVRLMSADSDFRFSEEYDMMRNVGVG----QSVAASELPINRPKNRFTNIPSYDHSRVKLSNPNNIEGGDYINANYVPG--FSSRRE--------FIAAQGPLPTTRD-------HFWQMTWEQQCPAIIALTKCVEKGRDKCHQYWPDHENVPVLYGD----IEVTIVAEKEFDEFVIRDIRLEKSGPDGRVTRFVRHWHYMAWPDFGAPSHPNGIIQFSRMFRHHLPHSPHNAPTIVHCSAGVGRSGTFISID----RLLQSSSFGDPIDVFGTVCEMRYERCQMVQNEQQYIFIHYCILQVL 1335          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-4 (Tyrosine-protein phosphatase 4 [Source:UniProtKB/Swiss-Prot;Acc:P28192])

HSP 1 Score: 143.665 bits (361), Expect = 3.036e-34
Identity = 88/263 (33.46%), Postives = 138/263 (52.47%), Query Frame = 3
Query: 3246 KNRFSNIKPYKHNRVKLLAK--NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEK----EISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRD 4016
            KNR++NI   +  R++L +   NDYINA+ +          + C   N YIATQ P+         T  DFW MI +    +IV +T + E GK KC QYWP++ +   T+ +      V + S    + F  R+ ++ + +     E  V QLH + W DHG P++   L  +  Y     S   +VVHCSAGVGR+G++IL+D  + R L    R+ +  +L ++R+ R ++VQT  QY F +  I + L++ G+ R+  D
Sbjct:  675 KNRYNNIGAIEATRIRLNSPTGNDYINANYV----------DSCNERNAYIATQAPL-------PSTFSDFWSMIWQERSNIIVCITNMVEDGKRKCDQYWPSQQDSPQTFGN----YQVTLVSESTNAHFSHRILDLKIAKAVPAVERKVHQLHFMGWPDHGVPSSVFPLLSFVHYTSDIHSTGPVVVHCSAGVGRSGSYILVD-SMRRHLISFRRLNVQGHLTHMRRQRAKLVQTLEQYIFCHEAIRQ-LIRHGITRVHSD 914          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Match: ptp-4 (Tyrosine-protein phosphatase 4 [Source:UniProtKB/Swiss-Prot;Acc:P28192])

HSP 1 Score: 143.665 bits (361), Expect = 3.112e-34
Identity = 88/263 (33.46%), Postives = 138/263 (52.47%), Query Frame = 3
Query: 3246 KNRFSNIKPYKHNRVKLLAK--NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEK----EISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRD 4016
            KNR++NI   +  R++L +   NDYINA+ +          + C   N YIATQ P+         T  DFW MI +    +IV +T + E GK KC QYWP++ +   T+ +      V + S    + F  R+ ++ + +     E  V QLH + W DHG P++   L  +  Y     S   +VVHCSAGVGR+G++IL+D  + R L    R+ +  +L ++R+ R ++VQT  QY F +  I + L++ G+ R+  D
Sbjct:  629 KNRYNNIGAIEATRIRLNSPTGNDYINANYV----------DSCNERNAYIATQAPL-------PSTFSDFWSMIWQERSNIIVCITNMVEDGKRKCDQYWPSQQDSPQTFGN----YQVTLVSESTNAHFSHRILDLKIAKAVPAVERKVHQLHFMGWPDHGVPSSVFPLLSFVHYTSDIHSTGPVVVHCSAGVGRSGSYILVD-SMRRHLISFRRLNVQGHLTHMRRQRAKLVQTLEQYIFCHEAIRQ-LIRHGITRVHSD 868          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0073522)

HSP 1 Score: 197.208 bits (500), Expect = 2.127e-50
Identity = 193/707 (27.30%), Postives = 309/707 (43.71%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +        I    ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQ-------IRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0273235)

HSP 1 Score: 196.823 bits (499), Expect = 2.879e-50
Identity = 192/707 (27.16%), Postives = 310/707 (43.85%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +   + +       ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRK-------NYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0331406)

HSP 1 Score: 196.823 bits (499), Expect = 2.879e-50
Identity = 192/707 (27.16%), Postives = 310/707 (43.85%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +   + +       ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQIRFRK-------NYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330393)

HSP 1 Score: 195.667 bits (496), Expect = 7.658e-50
Identity = 193/707 (27.30%), Postives = 309/707 (43.71%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +        I    ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQ-------IRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330392)

HSP 1 Score: 195.667 bits (496), Expect = 7.658e-50
Identity = 193/707 (27.30%), Postives = 309/707 (43.71%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +        I    ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQ-------IRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprq (protein tyrosine phosphatase receptor type Q [Source:ZFIN;Acc:ZDB-GENE-050419-183])

HSP 1 Score: 182.57 bits (462), Expect = 1.034e-45
Identity = 180/668 (26.95%), Postives = 294/668 (44.01%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTC----------KNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVY---EIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN--LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGFIER-KTAVNKIST-----IVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--------------------------EATNTAITHLL-------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKAR-QSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            P   ++   + +  T +  T++PP E NG I  Y +             + SVI N N T T +   + ++    Y+ +++A    G+G    S + +                A++   + ++   T   I +P   F+++ G IQ   +++SE      GN S          +       T  Y   +  L+P  PK + + +++ K       Y++G +   L   ++   NGPLK  T Y+  FRA    G F    + ++ +TA +++ T     I+GV ++ F+ + L + IY  ++  R K                             E     I  LL       P+  KS     F ++ E +  + N +  ++F E+ +L   L      +    N +KNRF+NIKPY ++RVKLL++     +DYINAS +              C N +IATQGP+         TV DFWRMI E     IV LT+  E G+ +C QYWP E N+ +T +++     +  +   D+++   R   V      + V   +  +W +HG P ++S  + F  A R  R   N  IVVHCSAGVGRTG FI +D  L + L++ + ++IY  +  LR  R  MVQ  +QY F++    + L   G
Sbjct: 1648 PPKNVTLTVIPEEVTRVYVTFSPPDEPNGNISAYRVDIYRNGQLDFFINSLSVISNPNNTMTAII--DGLKGGFNYSIRIAAVNGAGFGPS--SEVHVTTGVKAPPKPKKTPRAALNSAGVIISTSKT-ITIEMPECFFTDDHGPIQKVQVIVSEPAVMDYGNLS---------NWKSVFLHPTAPYLTDDGFLNPECPKNSERMSSSTKT------YVIGEDEGCLSEDAETLCNGPLKPKTHYVFKFRATNIRGQFTDSEYSDKVRTADDRLLTRDEQIILGVLLSFFLALFLILIIYGSVKIHRRKKEGGTYSPRQAEIIETKFKLDQLIAVADLELKEEKINRLLSYRKSLKPISKKS-----FLQHVEDLCANDNAKFQEEFAELPKLLQDLATSDADL--PWNRSKNRFTNIKPYNNSRVKLLSEPGMPGSDYINASFVSG----------YLCPNEFIATQGPL-------PSTVADFWRMIWETGTKTIVMLTQCFEKGRIRCHQYWP-EDNKPVTVFADIIITKLTEDVRPDWTV---RALKVERHGSYMIVHHFNYTSWPEHGVPESSSTLVQFVKAVRSNRGHENTTIVVHCSAGVGRTGVFIALD-HLIQHLRDHEFVDIYGLVAELRSERMCMVQNLAQYMFLHQSTLDLLSAKG 2266          

HSP 2 Score: 60.8474 bits (146), Expect = 1.405e-8
Identity = 132/604 (21.85%), Postives = 230/604 (38.08%), Query Frame = 3
Query:  750 IRPYTYYGISVNAANVFGWGNLV-SVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVN-GQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITD--------------------DKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQS-IVDKSQIKIVWSYPIV--HTINYKYDIQVYNGTFSYKDELRG----GSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNV-------------------ATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNI---TSTTVTISEWVETDILYTCQVSASTSVG 2408
            + P   Y I V A N  G G    S+Y +T++   G V   +        + + W  P   NG I ++ + V+    GQ V T  +N  D   N ++P    N   +  ++     + T QL+S V+                      D++ P   Y   +      G G +      +     E      V+ +     +++ W+PPK     II                      T  F+ V Q    +  I+E  +I        D +F        + P + Y ++V   +    GP + I++TT    P  V+ L++  VD + +++ W  PI     I +   + +Y+ T      LRG         ++ SL+F T     +   + +   ++ R  +NT   +  A+    S+       LT T  ++++  VQ                      AT V  +++     + +R L   T Y   V+        ++  +G S +    T E VPSSV +    N S T I+ +W PP+  NGKI +Y +  +N  ++ N  +   T TT  +   ++    Y  +V+AST+VG
Sbjct:  101 LTPGATYNIKVAAVNKAGVGPFSQSLYYKTAEAPPGLVSNLTAFAEDHTSVIVTWFLPVRINGLITKFAVKVKHARTGQIVRTKELNAEDIM-NGALPHC--NDAADILSRGTPSPSQTSQLTSAVLPPITLSAVPPASIWSVPISVKIDELRPYTPYVFEVSAFTSDGEGQIASTMVRMPEAAPEDPPQNVVLRNITSKSVSLTWEPPK-----II----------------------TGRFSYVIQLHSSEGLISENSTI--------DQMFIYT----GLTPYTTYYIHVMAKSAGAAGPAAVINITTLAEAPSAVSLLKAEAVDSTSVRLSWRSPIQPNGLITHYRILVLYHDTLVQDITLRGQNLISPLRRNARSLDFTTESVFTLTSHETFS--TLGRDFTNTDTEAPSALPLTPSTPHTPPPWLTVTH-DRTDASVQTQTDAVTEDLTTEHPPVTPVLPATEVSADLSSDQITHVVRRLSPFTEYKFSVS------AKNIIGEGPSTEVTVKTNEQVPSSVQNVSYQNLSSTSIRVSWEPPLNPNGKITHYAVYAQN--LLTNQELRQMTDTTTAVLTGLDKYSSYKVRVAASTAVG 651          

HSP 3 Score: 53.1434 bits (126), Expect = 3.082e-6
Identity = 44/127 (34.65%), Postives = 59/127 (46.46%), Query Frame = 3
Query: 2046 YEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV-LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPV 2423
            Y    L+   PY I VTP +   ++   +    L     T E VPSS  LS    N S T I+ +W PPVE NG+I+ Y +  +  S   N N TS T  +   +     Y   ++A T VG G PV
Sbjct: 1110 YLFTKLRKYFPYIINVTPATSAGSAVNHTTMLHLR----TDEDVPSSPPLSGSNKNLSSTSIQVSWFPPVEANGEIIEYAVNLQGPST-SNKNYTSETHLVLSELTPFTPYNLSIAAVTRVGTGPPV 1231          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprjb.1 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-090304-1])

HSP 1 Score: 157.918 bits (398), Expect = 4.469e-42
Identity = 108/303 (35.64%), Postives = 158/303 (52.15%), Query Frame = 3
Query: 3111 EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLL----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEI----NQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQS----NQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            ++ E ++    DSN    +++ E+K  +V  ++ K       N AKNR+SN+ PY  +RVKL       +DYINA+ +    + S KE        +IA QGP+         T+ +FWRMI E NV  IV LT+  E G+ KC +YWP+      N  +T  SE     +E++   D++I   R+ NV   E    V Q H  AW DHG P T+E L  +    +        +   VVHCSAGVGRTGTFI ID  LS  ++ D  ++IY  + ++R  R  MVQTE QY +++   ++ +
Sbjct:    9 DYEEYFKRNSADSNCGFAEEYEELK--SVGTQQSKAAALAIENKAKNRYSNVLPYDASRVKLSMCGSPFDDYINANHVPG--YNSRKE--------FIAAQGPL-------PVTLNEFWRMIWEKNVYTIVMLTKCNEMGRVKCEKYWPSATSHYNNISVTTTSE-----IELD---DWTIRDFRIKNVKTAETRY-VRQFHFTAWPDHGVPETTEILIDFRHLVREHMDQYSRHSPTVVHCSAGVGRTGTFIAID-HLSFQIERDSMVDIYGIVHDMRMHRALMVQTEDQYVYLHQCAYDLI 282          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 169.859 bits (429), Expect = 7.552e-42
Identity = 126/373 (33.78%), Postives = 176/373 (47.18%), Query Frame = 3
Query: 2955 IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEA----TNTAITHLLPMDS--------KSPAA--------HEFHENYEFMKQDSNGRLLDDFREIKE-LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVF----NVSMDEKEISVTQLHMLAWKDHGCPT-TSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHE 3977
            +VG  +AV  IIC+ IAI      KR +          N  IT   P D         ++P           E  E+ E +K + N +L  ++  I        E   +    E N  KNR++N+  Y H+RV L     +  +DYIN++ I     Q          N YIATQGP+ E       T GDFWRM+ E     +V +TR+EE  + KC QYWP+   +  TY      I V +  +++ + F  R F    N S +++E  V Q    AW DHG P   + FLAF    +     +   I+ HCSAGVGRTG FI+ID  L RI K +  ++IY ++  +R  R  MVQTE QY FI+  + E
Sbjct: 1154 VVGPVLAVVFIICIVIAILLYKNSKRKESEPRTKCLLNNADITPHHPTDPVEMRRINFQTPGMMNHPPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNL----EVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQ----------NAYIATQGPLPE-------TFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTE--TYGM----IQVTLLDTIELATFCVRTFSLHKNGSSEKRE--VRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERI-KHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLE 1496          

HSP 2 Score: 152.14 bits (383), Expect = 2.173e-36
Identity = 96/260 (36.92%), Postives = 129/260 (49.62%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ---SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR  NI PY+  RV L     L  +DYIN+S I     Q            YIATQGP+ E  E       DFWRM+ ENN  ++V LT++ E G+EKC QYWP E + +  Y+  D      M        ++ R F V+   D +  +V Q     W + G P + E F+ F     K ++    +  I VHCSAGVGRTG FI +   L R ++ +  ++I+  +  LR  R  MVQTE +Y F Y    EYL
Sbjct: 1554 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQ----------KAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLER-MRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1789          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprjb.2 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131120-137])

HSP 1 Score: 153.295 bits (386), Expect = 2.249e-40
Identity = 108/301 (35.88%), Postives = 155/301 (51.50%), Query Frame = 3
Query: 3129 EFMKQ---DSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLL----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKE--ISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA----IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQA 3992
            E+ KQ   DSN     ++ E++ +         +     N  KNR+ N+ PY  +RVKLL      +DYINA+ +    + S KE        +IA QGP+         T+  FWRMI EN V  IV LT+  E GK KC +YWP+E +    +Y     I+V   S  +   +  R F++   E E   +V Q H  AW DHG P T+E L  +    +   +  +     VVHCSAGVGRTGTFI ID  +S+I + D  ++IY  + ++R  R  MVQTE QY ++Y   ++ L+Q+
Sbjct:   10 EYFKQKCADSNHGFAIEYEELRFVGTAQANTAALALE--NKEKNRYLNVLPYDASRVKLLKCENPFDDYINANYV--PGYNSRKE--------FIAAQGPL-------PVTINKFWRMIWENKVYTIVMLTKCNELGKVKCEKYWPSETD----FYHN---ISVTTTSETELDDWTIRDFSIKNVETEETCNVRQFHFTAWPDHGVPETTEVLIEFRHLVREHMNQYSCTSPTVVHCSAGVGRTGTFIAIDHLISQI-ERDSMVDIYGIVHDMRMHRALMVQTEDQYVYLYQCAYD-LIQS 282          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 164.466 bits (415), Expect = 3.225e-40
Identity = 127/389 (32.65%), Postives = 176/389 (45.24%), Query Frame = 3
Query: 2955 IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEA----TNTAITHLLPMDS---------------KSPAAH-----------------EFHENYEFMKQDSNGRLLDDFREIKE-LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVF----NVSMDEKEISVTQLHMLAWKDHGCPT-TSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHE 3977
            +VG  +AV  IIC+ IAI      KR +          N  IT   P D                 SP +                  E  E+ E +K + N +L  ++  I        E   +    E N  KNR++N+  Y H+RV L     +  +DYIN++ I     Q          N YIATQGP+ E       T GDFWRM+ E     +V +TR+EE  + KC QYWP+   +  TY      I V +  +++ + F  R F    N S +++E  V Q    AW DHG P   + FLAF    +     +   I+ HCSAGVGRTG FI+ID  L RI K +  ++IY ++  +R  R  MVQTE QY FI+  + E
Sbjct: 1259 VVGPVLAVVFIICIVIAILLYKNSKRKESEPRTKCLLNNADITPHHPTDPVEMRRINFQTPDSGLSSPVSEAGFDYESMMNHPPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNL----EVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQ----------NAYIATQGPLPE-------TFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTE--TYGM----IQVTLLDTIELATFCVRTFSLHKNGSSEKRE--VRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERI-KHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLE 1617          

HSP 2 Score: 151.369 bits (381), Expect = 3.221e-36
Identity = 96/260 (36.92%), Postives = 129/260 (49.62%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ---SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR  NI PY+  RV L     L  +DYIN+S I     Q            YIATQGP+ E  E       DFWRM+ ENN  ++V LT++ E G+EKC QYWP E + +  Y+  D      M        ++ R F V+   D +  +V Q     W + G P + E F+ F     K ++    +  I VHCSAGVGRTG FI +   L R ++ +  ++I+  +  LR  R  MVQTE +Y F Y    EYL
Sbjct: 1675 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQ----------KAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLER-MRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1910          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 204.527 bits (519), Expect = 3.121e-52
Identity = 192/690 (27.83%), Postives = 301/690 (43.62%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNN----------IDMIPDAMSKVNIKVADEY-TQAAITLPY--SHFSNNGGTIQMFTLVISET--RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN--LLGNKSDHNSN----GPLKSGTLYIIGFRAYT---------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAH--------------EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQL----HMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYEN 4058
            P  +    C  Q+ T I C+W PP   +     Y + C+           S  V  S+ +E D        +S ++    P   +++ +     DM +          ID  P     + +   D + ++++I   +  S FS+  G ++ FT+++SE    +N    AS+    Y +        K+T +Y+    P +         NP  N Q+ +  +G    LLG K D N N    GPL   T Y I  RA+T               S  F ++        +     I GVS  +FVII + +    +I  ++ K     T    THL     + P+ H              +F E++  ++ DSN  L  ++  +K+   + +     +  E N  KNR+SNI PY   RVKL   +D     YINAS +   +++ E          YIATQGP+   ++       DFW+M+ E NV +IV +T+  E G+ KC  YWP  ++Q   YY +   + V+M S      +  R F +   E +I   +L    H   W DHG P T+    +F+     Y      +   VVHCSAGVGRTGTFI++D  L ++    D ++I+  + +LR  R  MVQTE QY ++Y  + + L +A  +R    N +D+ LF   YEN
Sbjct: 1473 PDKIHHLHCRPQTSTAISCSWTPP---DSDFDGYSVECRRNG--------SDDVEFSKRIEKD-------KSSITISTLVPHKRYVVSIKVHSADMTSQVIEDSAITMIDRPPPPPLLIRVNKKDTFISKSSIHFRFNCSWFSDTNGAVKYFTVIVSEADGNDNQRPEASLPLPSYADYK----TNKSTKIYQTSYFPSRCAE------NPDYNIQSYKIKLGTGMELLGGKCDQNENKYCDGPLSPRTSYRISVRAFTQLFTEEMRTFPEPLYSDTFFSLPITTEAEPL--FGVIEGVSGGMFVIIMIIVLTVLLIYRQKKKRQDPMT----THLSSQIERIPSVHLNVGHIQIGPILTAQFEEHFSKLQTDSNYLLSREYENLKDFG-RDQSSDTALLPE-NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYMPGINFRRE----------YIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP--MDQDSYYYGD---LIVQMLSESVLPEWTIREFKI-CSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQV-DTVDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVL-RARKLR----NEQDNPLF-PIYEN 2096          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 203.756 bits (517), Expect = 4.596e-52
Identity = 192/690 (27.83%), Postives = 301/690 (43.62%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNN----------IDMIPDAMSKVNIKVADEY-TQAAITLPY--SHFSNNGGTIQMFTLVISET--RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN--LLGNKSDHNSN----GPLKSGTLYIIGFRAYT---------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAH--------------EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQL----HMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYEN 4058
            P  +    C  Q+ T I C+W PP   +     Y + C+           S  V  S+ +E D        +S ++    P   +++ +     DM +          ID  P     + +   D + ++++I   +  S FS+  G ++ FT+++SE    +N    AS+    Y +        K+T +Y+    P +         NP  N Q+ +  +G    LLG K D N N    GPL   T Y I  RA+T               S  F ++        +     I GVS  +FVII + +    +I  ++ K     T    THL     + P+ H              +F E++  ++ DSN  L  ++  +K+   + +     +  E N  KNR+SNI PY   RVKL   +D     YINAS +   +++ E          YIATQGP+   ++       DFW+M+ E NV +IV +T+  E G+ KC  YWP  ++Q   YY +   + V+M S      +  R F +   E +I   +L    H   W DHG P T+    +F+     Y      +   VVHCSAGVGRTGTFI++D  L ++    D ++I+  + +LR  R  MVQTE QY ++Y  + + L +A  +R    N +D+ LF   YEN
Sbjct: 1459 PDKIHHLHCRPQTSTAISCSWTPP---DSDFDGYSVECRRNG--------SDDVEFSKRIEKD-------KSSITISTLVPHKRYVVSIKVHSADMTSQVIEDSAITMIDRPPPPPLLIRVNKKDTFISKSSIHFRFNCSWFSDTNGAVKYFTVIVSEADGNDNQRPEASLPLPSYADYK----TNKSTKIYQTSYFPSRCAE------NPDYNIQSYKIKLGTGMELLGGKCDQNENKYCDGPLSPRTSYRISVRAFTQLFTEEMRTFPEPLYSDTFFSLPITTEAEPL--FGVIEGVSGGMFVIIMIIVLTVLLIYRQKKKRQDPMT----THLSSQIERIPSVHLNVGHIQIGPILTAQFEEHFSKLQTDSNYLLSREYENLKDFG-RDQSSDTALLPE-NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYMPGINFRRE----------YIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP--MDQDSYYYGD---LIVQMLSESVLPEWTIREFKI-CSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQV-DTVDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVL-RARKLR----NEQDNPLF-PIYEN 2082          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 203.371 bits (516), Expect = 5.863e-52
Identity = 195/685 (28.47%), Postives = 304/685 (44.38%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLI----IVPSAVPD--MNNIDMIPDAMSKVNIKVADEY-TQAAITLPY--SHFSNNGGTIQMFTLVISET--RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN--LLGNKSDHNSN----GPLKSGTLYIIGFRAYT---------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAH--------------EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV-SMDEKEIS--VTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYEN 4058
            P  +    C  Q+ T I C+W PP   +     Y + C+           S  V  S+ +E D      ++ ST V +   V S  +    +    + D  +  ID  P     + +   D + ++++I   +  S FS+  G ++ FT+++SE    +N    AS+    Y +        K+T +Y+    P +         NP  N Q+ +  +G    LLG K D N N    GPL   T Y I  RA+T               S  F ++        +     I GVS  +FVII + I +  ++ Y++ K     T    THL     + P+ H              +F E++  ++ DSN  L  ++  +K+   + +     +  E N  KNR+SNI PY   RVKL   +D     YINAS +   +++ E          YIATQGP+   ++       DFW+M+ E NV +IV +T+  E G+ KC  YWP  ++Q   YY +   + V+M S      +  R F + S D+ +    V   H   W DHG P T+    +F+     Y      +   VVHCSAGVGRTGTFI++D  L ++    D ++I+  + +LR  R  MVQTE QY ++Y  + + L +A  +R    N +D+ LF   YEN
Sbjct: 1362 PDKIHHLHCRPQTSTAISCSWTPP---DSDFDGYSVECRRNG--------SDDVEFSKRIEKD---KSSITISTLVPHKRYVVSIKVHSADMTSQVIEDSAITMIDRPPPPPLLIRVNKKDTFISKSSIHFRFNCSWFSDTNGAVKYFTVIVSEADGNDNQRPEASLPLPSYADYK----TNKSTKIYQTSYFPSRCAE------NPDYNIQSYKIKLGTGMELLGGKCDQNENKYCDGPLSPRTSYRISVRAFTQLFTEEMRTFPEPLYSDTFFSLPITTEAEPL--FGVIEGVSGGMFVIIMI-IVLTVLLIYRQKKKRDPMT----THLSSQIERIPSVHLNVGHIQIGPILTAQFEEHFSKLQTDSNYLLSREYENLKDFG-RDQSSDTALLPE-NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYMPGINFRRE----------YIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP--MDQDSYYYGD---LIVQMLSESVLPEWTIREFKICSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQV-DTVDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVL-RARKLR----NEQDNPLF-PIYEN 1984          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: ptprb (protein tyrosine phosphatase, receptor type B [Source:NCBI gene;Acc:100192375])

HSP 1 Score: 203.371 bits (516), Expect = 6.002e-52
Identity = 193/690 (27.97%), Postives = 303/690 (43.91%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNN----------IDMIPDAMSKVNIKVADEY-TQAAITLPY--SHFSNNGGTIQMFTLVISET--RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN--LLGNKSDHNSN----GPLKSGTLYIIGFRAYT---------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAH--------------EFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQL----HMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYEN 4058
            P  +    C  Q+ T I C+W PP   +     Y + C+           S  V  S+ +E D        +S ++    P   +++ +     DM +          ID  P     + +   D + ++++I   +  S FS+  G ++ FT+++SE    +N    AS+    Y +        K+T +Y+    P +         NP  N Q+ +  +G    LLG K D N N    GPL   T Y I  RA+T               S  F ++        +     I GVS  +FVII + I +  ++ Y++ K     T    THL     + P+ H              +F E++  ++ DSN  L  ++  +K+   + +     +  E N  KNR+SNI PY   RVKL   +D     YINAS +   +++ E          YIATQGP+   ++       DFW+M+ E NV +IV +T+  E G+ KC  YWP  ++Q   YY +   + V+M S      +  R F +   E +I   +L    H   W DHG P T+    +F+     Y      +   VVHCSAGVGRTGTFI++D  L ++    D ++I+  + +LR  R  MVQTE QY ++Y  + + L +A  +R    N +D+ LF   YEN
Sbjct: 1542 PDKIHHLHCRPQTSTAISCSWTPP---DSDFDGYSVECRRNG--------SDDVEFSKRIEKD-------KSSITISTLVPHKRYVVSIKVHSADMTSQVIEDSAITMIDRPPPPPLLIRVNKKDTFISKSSIHFRFNCSWFSDTNGAVKYFTVIVSEADGNDNQRPEASLPLPSYADYK----TNKSTKIYQTSYFPSRCAE------NPDYNIQSYKIKLGTGMELLGGKCDQNENKYCDGPLSPRTSYRISVRAFTQLFTEEMRTFPEPLYSDTFFSLPITTEAEPL--FGVIEGVSGGMFVIIMI-IVLTVLLIYRQKKKRDPMT----THLSSQIERIPSVHLNVGHIQIGPILTAQFEEHFSKLQTDSNYLLSREYENLKDFG-RDQSSDTALLPE-NRGKNRYSNILPYDSTRVKLANVDDDPCSDYINASYMPGINFRRE----------YIATQGPLPATKD-------DFWKMVWEQNVHIIVMVTQCTERGRAKCDHYWP--MDQDSYYYGD---LIVQMLSESVLPEWTIREFKI-CSEDQIDAPRLVRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRTPGSGPTVVHCSAGVGRTGTFIVLDRMLQQV-DTVDSVDIFGAVRDLRIHRMYMVQTECQYVYLYQCVRDVL-RARKLR----NEQDNPLF-PIYEN 2164          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Match: nars2 (asparaginyl-tRNA synthetase 2, mitochondrial [Source:Xenbase;Acc:XB-GENE-944603])

HSP 1 Score: 200.29 bits (508), Expect = 6.517e-51
Identity = 191/700 (27.29%), Postives = 302/700 (43.14%), Query Frame = 3
Query: 2049 EMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCK----------NESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNP--KANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKH------------------VSEATNTAITHLLPMDSKSPAAHE-FHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKAR-QSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            E+  LK  T Y++ VT F+   + +      S   +  T E VP+     +  + +    T ++ T+ PP E NGKI    +  K          N S+I N+N + T V   + ++    Y  ++ A    G G       I      P      M P  +   +  +    T   I +P  +FS++ G I+   +++SE     VGN S     + + AY +               PKP        NP    +  ++EY++G N   +  +  D   NGPLK    Y+  FRA    G  T       V  ++   +  ++  I+ V++ V  +I L  AIY   R ++ +                   + +    A   L       P + + F ++ E +  ++N +  ++F E+ +    L      +    N +KNRF+NIKPY +NRVKL+A      +DYINAS +              C N +IATQGP+       A TVGDFWRM+ E     IV LT+  E G+ +C QYWP E N+ +T + +     V  +  +D++    R   V      + V Q +  +W +HG P +T+  + F    R  R   N   VVHCSAGVGRTG F+ +D  L + +   D ++IY  +  LR  R  MVQ  +QY F++  + + L   G
Sbjct: 1516 EVTGLKPFTNYSVTVTAFTGPSDLAYTEGKLSSVVIVTTLEAVPADPPTNIEIQKIPHDVTKVQMTFIPPSEPNGKIQYQAVVYKEDNPKDSQIRNLSIIKNNNNSITAVI--DGLKGGYTYNIRIYAVNGAGAGPNATQMKITTDITEPP--RPVMQPQPIYNPSGSIRATATTFTIMMPKCYFSDDNGPIKYIQVIVSEVGAQHVGNIS-----WWHEAYHKK--------------PKPYFTSDGFPNPLCSKSRISDEYVIGANESCMALDIKDTFCNGPLKPRKQYLFKFRATNIRGQYTDSVYSEVVKTLDDGLSQTQVEIILSVTLCVLSVILLVGAIYAFARIRQKQKEGGTYSPRDAEIIDTKFKLEQLITVADLELKDERLTRPVSKKGFLQHVEELCTNNNLKFQEEFSELPKFLEDLAVSDADL--PWNRSKNRFTNIKPYNNNRVKLIADAGVPGSDYINASYVSG----------YICPNEFIATQGPL-------AGTVGDFWRMVWETRAKTIVMLTQCYEKGRIRCHQYWP-EDNKPVTVFGDIVITKVAEDVQIDWTT---RDLKVERHGDFMIVRQCNYTSWPEHGVPESTASLMHFVKMIRANRPHENTPTVVHCSAGVGRTGVFVALD-HLVQHINHHDFVDIYGLVAELRSERMCMVQNMAQYIFLHQCVVDLLASKG 2168          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprq (protein tyrosine phosphatase, receptor type, Q [Source:MGI Symbol;Acc:MGI:1096349])

HSP 1 Score: 190.274 bits (482), Expect = 5.199e-48
Identity = 189/720 (26.25%), Postives = 308/720 (42.78%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--------------------------EATNTAITHLL-------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+ +L+  T Y++ +T F    + +     +S + +  T E VP      ++F+ +    T  + ++ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P       IP  DA  K+ +      T   I +P  +++++ G I+   ++++E      GN +     Y N A      +     E   +PP  +   K + N       E Y++G +   ++    +   NGPLK    Y+  FRA    G  T       +  +    +   +  I+ V++ +  II L  AI+   R ++ +                             E  +  +T LL       P+  KS     F ++ E +  ++N +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS +              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +   W +HG P  T+  + F    R +R  +   +VVHCSAGVGRTG FI +D  L++ + + D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1592 NEENKTTEINDLEVFTRYSVVITAFVGNVSGAYTDGKSSAEVIITTLESVPKDPPNNMTFQKIPDEVTKFQLSFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAINSAGAG-PKVQMRITMDIKAPARPKTKPIPIHDATGKLLVTS----TTITIRMPICYYNDDHGPIRNVQVLVAEAGAQQDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCIEGKTKFSGN------EEIYVIGADNACMIPGNEEKICNGPLKPKKQYLFKFRATNVMGQFTDSEYSDPIKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKSIKPVSKKS-----FLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADVSIPGSDYINASYVSG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDILITKLMEDIQIDWTI---RDLKIERHGDCMTVRQCNFTGWPEHGVPENTTPLIHFVKLVRTSRAHDATPMVVHCSAGVGRTGVFIALD-HLTQHIHDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2265          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptpra (protein tyrosine phosphatase, receptor type, A [Source:MGI Symbol;Acc:MGI:97808])

HSP 1 Score: 167.933 bits (424), Expect = 4.991e-42
Identity = 116/370 (31.35%), Postives = 189/370 (51.08%), Query Frame = 3
Query: 2958 VGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNT----------AITHLLPMDSKSPAAHEFHENY--EFMKQDSNGRLLDDFREIKE-----LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            V V+++  ++I   I + +++R+K+ K     +N+               +P+ ++SP+ +  +     + ++++ N R+ DD +  +E      A  ++        E N  KNR+ NI PY H+RV L     +  +DYINAS I       EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y        ++   +DY++    +++V +V+  + +  +TQ H  +W D G P T   +      +K +  N     AIVVHCSAGVGRTGTF++ID  L  ++  + ++++Y  +  +R  RCQMVQT+ QY FIY  + E+
Sbjct:  146 VMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQ---EK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGNVRVSVEDVTVLVDYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTP--IGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLD-MMHSERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEH 492          

HSP 2 Score: 143.665 bits (361), Expect = 2.559e-34
Identity = 98/296 (33.11%), Postives = 149/296 (50.34%), Query Frame = 3
Query: 3126 YEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV--SMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            Y  +   SN  L ++F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          YIA+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYWP++    +  Y +   I VE+    +   +  R   V  + + K   + Q H   W + G P+  +  +   +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  513 YNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLP-ANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YIASQGPL-------LHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSD---GLVSYGD---ITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 783          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 168.703 bits (426), Expect = 1.072e-41
Identity = 122/394 (30.96%), Postives = 198/394 (50.25%), Query Frame = 3
Query: 2973 AVFVIICLSIAIYFI---IRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSEFLAFY----SAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYENPIFVE*ETKNQFFENNLYI 4115
            AVF  I  ++AI  +   I +++ +  ++    + + + P  SK      F   ++  + DSN    +++ ++K + + L +    +    N  KNR++N+ PY  +RVKL  +    +DYINA+ +   H  S+K+        +IATQGP+         T+ DFWRM+ E NV  IV LT+  E G+ KC +YWP++  Q    Y +   I V M S +    +  R F V    + +   + Q H  +W DHG P T++ L  +      Y K       I+VHCSAGVGRTGTFI ID  + +I  E + +++Y  + +LR  R  MVQTE QY F+   + +      +IR  +D++ D  +++ +    I+   E  + F + N YI
Sbjct:  803 AVFGCIFGALAITAVGGFIFWRKKRTDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEI--AENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYH--SKKD--------FIATQGPL-------PNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQD---YGD---ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLD------IIRAQKDSKVDL-IYQNTTAMTIYENLEPVSMFGKTNGYI 1163          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 169.088 bits (427), Expect = 1.152e-41
Identity = 122/394 (30.96%), Postives = 198/394 (50.25%), Query Frame = 3
Query: 2973 AVFVIICLSIAIYFI---IRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSEFLAFY----SAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYENPIFVE*ETKNQFFENNLYI 4115
            AVF  I  ++AI  +   I +++ +  ++    + + + P  SK      F   ++  + DSN    +++ ++K + + L +    +    N  KNR++N+ PY  +RVKL  +    +DYINA+ +   H  S+K+        +IATQGP+         T+ DFWRM+ E NV  IV LT+  E G+ KC +YWP++  Q    Y +   I V M S +    +  R F V    + +   + Q H  +W DHG P T++ L  +      Y K       I+VHCSAGVGRTGTFI ID  + +I  E + +++Y  + +LR  R  MVQTE QY F+   + +      +IR  +D++ D  +++ +    I+   E  + F + N YI
Sbjct:  989 AVFGCIFGALAITAVGGFIFWRKKRTDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPKYTAEIAE--NRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYH--SKKD--------FIATQGPL-------PNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQD---YGD---ITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLD------IIRAQKDSKVDL-IYQNTTAMTIYENLEPVSMFGKTNGYI 1349          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 168.318 bits (425), Expect = 1.966e-41
Identity = 129/382 (33.77%), Postives = 177/382 (46.34%), Query Frame = 3
Query: 2955 IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAI---THLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKV----------------IMFT------EGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVF----NVSMDEKEISVTQLHMLAWKDHGCPT-TSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQA 3992
            ++G  +AV  IIC+ IAI     YK  +  SE     +     L P   K P       N++     + G L      I ++A  +ER K                   FT      E N  KNR++N+  Y H+RV L     +  +DYINA+ +     Q          N YIATQGP+ E       T GDFWRM+ E     +V +TR+EE  + KC QYWP    +   +      I V +  +M+ + F  R F    N S +++E  V      AW DHG P   + FLAF    +     +   IVVHCSAGVGRTG FI+ID  L RI K +  +++Y ++  +R  R  MVQTE QY F    IHE L++A
Sbjct:  855 VIGPVLAVVFIICIVIAILL---YKNKRKDSEPRTKCLLNNADLAPHHPKDPVEMR-RINFQ-----TPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQ----------NAYIATQGPLPE-------TFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTMELATFCVRTFSLHKNGSSEKRE--VRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERI-KTEKTVDVYGHVTLMRSQRNYMVQTEDQYGF----IHEALLEA 1197          

HSP 2 Score: 147.517 bits (371), Expect = 5.159e-35
Identity = 94/260 (36.15%), Postives = 129/260 (49.62%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ---SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR  NI PY+ +RV L     +  +DYINAS I     Q            YIATQGP+ E  E       DFWR + ENN  ++V LT++ E G+EKC QYWP E + +  Y+  D      M        ++ R F V+   D +  +V Q     W + G P + E F+ F     K ++    +  I VHCSAGVGRTG FI +   L R ++ +  ++I+  +  LR  R  MVQTE +Y F +    EYL
Sbjct: 1254 NKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQ----------KAYIATQGPLAETTE-------DFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ------YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLER-MRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1489          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Match: sp|Q9UMZ3|PTPRQ_HUMAN (Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 4.172e-50
Identity = 190/706 (26.91%), Postives = 309/706 (43.77%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKH----VSEATNTAITHLLPMD---------------SKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA--IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+++L+  T Y++ +T F+   +++     +S + +  T E  P      ++F+ +    T  + T+ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P        P  DA  K+ +      T   I +P  ++S++ G I+   ++++ET     GN +     Y N A      +     E   +PP  +   K + N       E YI+G +   ++    D   NGPLK    Y+  FRA    G  T       V  +    +   +  I+ V++ +  II L  AI+   R ++ +      S      I   L +D               ++  +   F ++ E +  ++N +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS I              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +  AW +HG P  S  L  +    +A +++    ++VHCSAGVGRTG FI +D  L++ + + D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1633 NEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLESAPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTNTFVIAMLEGLKGGHTYNISVYAVNSAGAG-PKVPMRITMDIKAPARPKTKPTPIYDATGKLLVTS----TTITIRMPICYYSDDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCTEGKTKFSGN------EEIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATNIMGQFTDSDYSDPVKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPQDAEIIDTKLKLDQLITVADLELKDERLTRPISKKSFLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADASVPGSDYINASYISG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDIVITKLMEDVQIDWTI---RDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALD-HLTQHINDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2297          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Match: sp|O88488|PTPRQ_RAT (Phosphatidylinositol phosphatase PTPRQ OS=Rattus norvegicus OX=10116 GN=Ptprq PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 6.745e-49
Identity = 193/720 (26.81%), Postives = 308/720 (42.78%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--------------------------EATNTAITHLL-------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKAR-QSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+ NL+  T Y++ +T F    + +     +S + +  T E VP      ++F+ +    T  + T+ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P       IP  DA  K+ +      T   I +P  +++++ G I+   ++++ET     GN +     Y N A      +     E   +PP  +   K + N       E Y++G +   ++    +   NGPLK    Y+  FRA    G  T       +  +    +   +  I+ V++ +  II L  AI+  +R ++ +                             E  +  +T LL       P+  KS     F ++ E +  +SN +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS +              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +   W +HG P  T+  + F    R +R      +VVHCSAGVGRTG FI +D  L++ +   D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1594 NEENKTTEINNLEVFTRYSVVITAFVGNVSRAYTDGKSSAEVIITTLESVPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIRVYQALVYREDDPTAVQIHNFSIIQKTDTSIIAMLEGLKGGHTYNISVYAINSAGAG-PKVQMRITMDIKAPARPKSKPIPIRDATGKLLVTS----TTITIRMPICYYNDDHGPIRNVQVLVAETGAQQDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCIEGKTKFSGN------EEIYVIGADNACMIPGNEEKICNGPLKPKKQYLFKFRATNVMGQFTDSEYSDPIKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFVRIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKSIKPISKKS-----FLQHVEELCTNSNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADVSLPGSDYINASYVSG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRTKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDIVITKLMEDIQIDWTI---RDLKIERHGDCMTVRQCNFTGWPEHGVPENTTPLIHFVKLVRTSRAHDTTPMVVHCSAGVGRTGVFIALD-HLTQHINNHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2267          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Match: sp|P35992|PTP10_DROME (Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4)

HSP 1 Score: 195.667 bits (496), Expect = 7.676e-49
Identity = 193/707 (27.30%), Postives = 309/707 (43.71%), Query Frame = 3
Query: 1923 SSSVTGNNIILTWTF--GEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWA-PPVEKNGKILNYWLTCKN----ESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET-RNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAG-FVTVGF-IERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-----KHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTE--GNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLA-FYSAYRKARQSNQ-AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVI 3971
            ++++T   I L W    GE ++  + +  A  +      T N+  + +L+    YT  V        SSV    + L     T E VP  V  F   +   + I   W+ P  E NG I  + +   N          D  +     + + ++    Y  ++ A T++G+G P   +   +P   P      ++P  + + +  +        I    ++FS+  G ++M+T++++E    N  G    + L  Q+             Y + L    P +A+     P  N   E++ +G     N      NGPLKSGT Y +  RA+T A  F    +    +T  +  S IV ++V + +I+ L + + F  R + N     K      N ++   +   ++      F E+Y  M  DS+ R  ++F E+K +     R +   F +   N  KNRF+NI PY H+R KL        +DYINA+ +   +   E          +I TQGP+   R+       DFWRM  E+N   IV LTR  E G+EKC QYWP   N  +  +  D  I V++ +   Y+ +V   F +    ++  +   H   W D G P   + L  F  A+R    + Q  IVVHCSAGVGR+GTFI +D  L +I    D ++I+  +  +RK R  MVQTE QY  I+  +
Sbjct:  872 ATNITDTEISLRWDLPKGEYNDFDIAYLTADNLLAQNMTTRNEITISDLRPHRNYTFTVV-VRSGTESSVLRSSSPLSASFTTNEAVPGRVERFHPTDVQPSEINFEWSLPSSEANGVIRQFSIAYTNINNLTDAGMQDFESEEAFGVIKNLKPGETYVFKIQAKTAIGFG-PEREYRQTMPILAPPRPATQVVPTEVYRSSSTIQ-------IRFRKNYFSDQNGQVRMYTIIVAEDDAKNASGLEMPSWLDVQS-------------YSVWL----PYQAID-PYYPFENRSVEDFTIGTENCDNHKIGYCNGPLKSGTTYRVKVRAFTGADKFTDTAYSFPIQTDQDNTSLIVAITVPLTIILVLLVTLLFYKRRRNNCRKTTKDSRANDNMSLPDSVIEQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVG----RDQPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGHNSPRE----------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGD--IKVQILNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCL 1524          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Match: sp|P0C5E4|PTPRQ_MOUSE (Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus OX=10090 GN=Ptprq PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.636e-47
Identity = 189/720 (26.25%), Postives = 308/720 (42.78%), Query Frame = 3
Query: 2028 NVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSV---LSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNES-----VIYNDNITSTT----VTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIP--DAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVT-------VGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--------------------------EATNTAITHLL-------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            N  N   E+ +L+  T Y++ +T F    + +     +S + +  T E VP      ++F+ +    T  + ++ PP + NG I  Y      E       I+N +I   T    + + E ++    Y   V A  S G G P     I +    P       IP  DA  K+ +      T   I +P  +++++ G I+   ++++E      GN +     Y N A      +     E   +PP  +   K + N       E Y++G +   ++    +   NGPLK    Y+  FRA    G  T       +  +    +   +  I+ V++ +  II L  AI+   R ++ +                             E  +  +T LL       P+  KS     F ++ E +  ++N +  ++F E+ +    L      +    N AKNRF NIKPY +NRVKL+A      +DYINAS +              C N +IATQGP+         TVGDFWRM+ E     +V LT+  E G+ +C QYWP E N+ +T + +     +  +  +D++I   R   +      ++V Q +   W +HG P  T+  + F    R +R  +   +VVHCSAGVGRTG FI +D  L++ + + D ++IY  +  LR  R  MVQ  +QY F++  I + L   G
Sbjct: 1592 NEENKTTEINDLEVFTRYSVVITAFVGNVSGAYTDGKSSAEVIITTLESVPKDPPNNMTFQKIPDEVTKFQLSFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSIIQKTDTSVIAMLEGLKGGHTYNISVYAINSAGAG-PKVQMRITMDIKAPARPKTKPIPIHDATGKLLVTS----TTITIRMPICYYNDDHGPIRNVQVLVAEAGAQQDGNVTKWYDAYFNKA------RPYFTNEGFPNPPCIEGKTKFSGN------EEIYVIGADNACMIPGNEEKICNGPLKPKKQYLFKFRATNVMGQFTDSEYSDPIKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYRKSIKPVSKKS-----FLQHVEELCTNNNLKFQEEFSELPKFLQDLSSTDADL--PWNRAKNRFPNIKPYNNNRVKLIADVSIPGSDYINASYVSG----------YLCPNEFIATQGPL-------PGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWP-EDNKPVTVFGDILITKLMEDIQIDWTI---RDLKIERHGDCMTVRQCNFTGWPEHGVPENTTPLIHFVKLVRTSRAHDATPMVVHCSAGVGRTGVFIALD-HLTQHIHDHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKG 2265          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Match: sp|P18433|PTPRA_HUMAN (Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3)

HSP 1 Score: 166.777 bits (421), Expect = 8.180e-41
Identity = 115/372 (30.91%), Postives = 190/372 (51.08%), Query Frame = 3
Query: 2958 VGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNT----------AITHLLPMDSKSPAAHEFHENY--EFMKQDSNGRLLDDFREIKE-----LAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLV 3986
            V V+++  ++I   I + +++R+K+ K     +N+               +P+ ++SP+ +  +     + ++++ N R+ DD +  +E      A  ++        E N  KNR+ NI PY H+RV L     +  +DYINAS I       EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y        ++   +DY++    +++V +++  + +  +TQ H  +W D G P T   +      +K +  N     AIVVHCSAGVGRTGTF++ID  L  ++  + ++++Y  +  +R  RCQMVQT+ QY FIY  + E+ +
Sbjct:  155 VMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASFINGYQ---EK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTP--IGMLKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLD-MMHTERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHYL 503          

HSP 2 Score: 145.591 bits (366), Expect = 5.433e-34
Identity = 98/296 (33.11%), Postives = 150/296 (50.68%), Query Frame = 3
Query: 3126 YEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV--SMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            Y  +   SN  L ++F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          YIA+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYWP++    +  Y +   I VE+    +   +  R   V  + + K   + Q H   W + G P+  +  ++  +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  522 YNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNL-PANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YIASQGPL-------LHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSD---GLVSYGD---ITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 792          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: A0A1S3HMA1 (receptor-type tyrosine-protein phosphatase eta isoform X3 OS=Lingula unguis OX=7574 GN=LOC106156488 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.012e-70
Identity = 301/1254 (24.00%), Postives = 524/1254 (41.79%), Query Frame = 3
Query:  516 NISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVS-VYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQ-FNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTG-NYTSISPNVSEPISNLSV-IFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISN-ISVTTPQYQPDPVTNLQ-SIVDKSQIKIVWSYPIVHT---INYKYDIQVYNGTFSYKDELRGG--SYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSI--SSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVT---------NNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVE--KNGKILNYWL------TCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYG----APVFSFLIIVPSA-VPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET------RNNIVGNASITSLQ-YQNVAYGECITKNTCVYEIRLSPPKP-KRALKRNTNPKANWQNEEYIVGNNLLGN-KSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN-------KHVSEATNTAITH--------------------LLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVK---LERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLL-----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYR---KARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNRED 4028
            N+ WE PQ PNG++  Y+++ ++     +   T +        N+S                 NS++  + +I     + P + Y   V A N  G G + + +   T++ T G V   +++      ++I W  P   NG+++ Y + V   +  CV  ++ +CTDC P IS          +CT+    Q F++  ++   V     ++P   Y   +      G G        ++    SEP + ++V I       L I W+ P N    I  Y             L+  +N T  F+N +                  +F +  D+ S             + + VR  T+ G G  S  ++V T + +P    ++    +  + I++ W  P++     I Y   +   +     K+E +    + +F +  L+ C +YT  V         + +   +N+T ++      I  + ++T  +I++ W       C + + V  T  ++  +          + + E+ NLK    Y IKV        +       ++    +     P + ++  C +  Y  +  TW  P    KNG I  Y +        KN+ +      +ST  ++S     +  Y  +V+A T VG G    AP +  L   P   V   N    +  A       V D   Q ++ +P S F +  G ++  +++++E        +++  +    +L+ +  V   E IT     Y I+   P P   A +R       +   E I+G+    N  +    NGPL SG  Y I  R YT+ G+     +++ T  +    I G   AV +++ ++  + FII  +R        +  ++   +   H                         S+  +  +F E+ E   +DS+    D+++ +KELA     LE +K       N  KNR++NI P+ H+RVKLL       +DYINA+ +    ++S++E        +IA QGP+   ++       DFWRMI E NV ++V +T+  E G+ KC QYWP +   +  YY +   + V+M S    S +  R+ +V + E    + Q H   W DHGCP +T+  + F    R     R +   I+VHCSAGVGRTGTFI +D  L  I +E + ++I+  +L +R+ RC MVQTE QY +I+  I + + Q   + +   N ED
Sbjct:  710 NLKWEEPQHPNGKVTDYFIEYWQADHKTKEYDTYY--------NIST----------------NSADTSYSVI----NLIPGSTYKFQVKAVNSKGPGEVSNNITVTTNESTPGEVSNLTVSQNTSMSMNIGWEEPIEPNGEVITYEMHVLLEDKSCVQQVTFSCTDC-PAISKISEKSEEAPSCTSTDTTQSFSIHGRVDYTV---RNLVPYTNYTFRVYPFTSVGRGKSKDMREQTLEDTPSEPRNVMAVNITQNEKTGLNITWEAPDNPRGIITGYQ------------LRVTVNDTSNFHNTTD-----------------EFKALPDLLSY----------QNHTIEVRAYTVAGPGNWSKPLTVLTGEARPSAPQHIAFGDISPTSIEVQWQDPVMKRGILIGYLIIVTKASNGEVVKNETQDANEAKSFDATGLDPCQHYTFKVAARTSKGFGNYSSEQTNSTAVNIPGTPVIVKAEAITSTSILVMWIPPPNETCPIDYVVEVTDNDSKEIVKEIPIKGYNSTEKEITNLKKFWSYDIKV---KANTTAGPSMPSTNVKNTTLEDTPGPPARVNASC-DVCYNSMTVTWEAPTRENKNGIITGYVIYYTDGEISKNKKIDIGSQKSSTITSLS----AEKSYQVKVAARTRVGEGEKETAPTYVNLTSGPPIFVAPANTFAKVSTA------SVEDARKQISLQVPSSPFGSENGIVRNISVIVAEDSEAGKPESDVRKDNKFPTLKTWGQVKDLEKITP----YAIKEVEPNPWGTAGQRQRRAATPY---EIIIGSQDCSNVATSKYCNGPLPSGRTYCIRIRGYTTNGYTDTPCVKQGTEPDTTGAIAGGVTAVLIVLIIAFVVLFIIAKRRGLIGGKSQRETTQRNPSTAGHDNEGFDGEELKSRSSESDEEEEAWKSRPVSTSQFKEHVEKYHRDSDLLFSDEYKTVKELAPSYEWLEAEK-----PSNRCKNRYTNILPFDHSRVKLLPIDDDEGSDYINANYMPG--YRSKRE--------FIAAQGPLPATKD-------DFWRMIWEQNVTLVVMVTQCVERGRIKCEQYWPKDTEAE--YYGD---LVVQMRSESTLSDYTIRILDVQLGEFSRVLKQFHFTKWPDHGCPESTTLLINFVQNVRMHISHRPNRGPILVHCSAGVGRTGTFIAVDRLLQHI-REHNEVDIFGLVLEMRENRCNMVQTEDQYIYIHECIKDAIAQG--MHLNNGNLED 1841          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: A0A1S3HM82 (receptor-type tyrosine-protein phosphatase eta isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156488 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 5.178e-65
Identity = 303/1303 (23.25%), Postives = 528/1303 (40.52%), Query Frame = 3
Query:  477 NLSTSSAFPLHPLNIS------------WERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVS-VYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQ-FNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTG-NYTSISPNVSEPISNLSV-IFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISN-ISVTTPQYQPDPVTNLQ-SIVDKSQIKIVWSYPIVHT---INYKYDIQVYNGTFSYKDELRGG--SYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSI--SSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVT---------NNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVE--KNGKILNYWL------TCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYG----APVFSFLIIVPSA-VPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET------RNNIVGNASITSLQ-YQNVAYGECITKNTCVYEIRLSPPKP-KRALKRNTNPKANWQNEEYIVGNNLLGN-KSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN----KHVSEATNTAITHLLPMDSKSPAAHEF---------HENYEFMKQDSNGRLLDDFR---------------------EIKELAVKLERQKVIMFTE--------------------GNDAKNRFSNIKPYKHNRVKLL-----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYR---KARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNRED 4028
            N+ST    P  P+N++            WE PQ PNG++  Y+++ ++     +   T +        N+S                 NS++  + +I     + P + Y   V A N  G G + + +   T++ T G V   +++      ++I W  P   NG+++ Y + V   +  CV  ++ +CTDC P IS          +CT+    Q F++  ++   V     ++P   Y   +      G G        ++    SEP + ++V I       L I W+ P N    I  Y             L+  +N T  F+N +                  +F +  D+ S             + + VR  T+ G G  S  ++V T + +P    ++    +  + I++ W  P++     I Y   +   +     K+E +    + +F +  L+ C +YT  V         + +   +N+T ++      I  + ++T  +I++ W       C + + V  T  ++  +          + + E+ NLK    Y IKV        +       ++    +     P + ++  C +  Y  +  TW  P    KNG I  Y +        KN+ +      +ST  ++S     +  Y  +V+A T VG G    AP +  L   P   V   N    +  A       V D   Q ++ +P S F +  G ++  +++++E        +++  +    +L+ +  V   E IT     Y I+   P P   A +R       +   E I+G+    N  +    NGPL SG  Y I  R YT+ G+     +++ T  +    I G   AV +++ ++  + FII  +R       +        T L+ M   +P++              N      D+ G   ++ +                     + KE   K  R   ++F++                     N  KNR++NI P+ H+RVKLL       +DYINA+ +    ++S++E        +IA QGP+   ++       DFWRMI E NV ++V +T+  E G+ KC QYWP +   +  YY +   + V+M S    S +  R+ +V + E    + Q H   W DHGCP +T+  + F    R     R +   I+VHCSAGVGRTGTFI +D  L  I +E + ++I+  +L +R+ RC MVQTE QY +I+  I + + Q   + +   N ED
Sbjct:  685 NVSTEEIPPSAPINLTSDEKTTNSTNLKWEEPQHPNGKVTDYFIEYWQADHKTKEYDTYY--------NIST----------------NSADTSYSVI----NLIPGSTYKFQVKAVNSKGPGEVSNNITVTTNESTPGEVSNLTVSQNTSMSMNIGWEEPIEPNGEVITYEMHVLLEDKSCVQQVTFSCTDC-PAISKISEKSEEAPSCTSTDTTQSFSIHGRVDYTV---RNLVPYTNYTFRVYPFTSVGRGKSKDMREQTLEDTPSEPRNVMAVNITQNEKTGLNITWEAPDNPRGIITGYQ------------LRVTVNDTSNFHNTTD-----------------EFKALPDLLSY----------QNHTIEVRAYTVAGPGNWSKPLTVLTGEARPSAPQHIAFGDISPTSIEVQWQDPVMKRGILIGYLIIVTKASNGEVVKNETQDANEAKSFDATGLDPCQHYTFKVAARTSKGFGNYSSEQTNSTAVNIPGTPVIVKAEAITSTSILVMWIPPPNETCPIDYVVEVTDNDSKEIVKEIPIKGYNSTEKEITNLKKFWSYDIKV---KANTTAGPSMPSTNVKNTTLEDTPGPPARVNASC-DVCYNSMTVTWEAPTRENKNGIITGYVIYYTDGEISKNKKIDIGSQKSSTITSLS----AEKSYQVKVAARTRVGEGEKETAPTYVNLTSGPPIFVAPANTFAKVSTA------SVEDARKQISLQVPSSPFGSENGIVRNISVIVAEDSEAGKPESDVRKDNKFPTLKTWGQVKDLEKITP----YAIKEVEPNPWGTAGQRQRRAATPY---EIIIGSQDCSNVATSKYCNGPLPSGRTYCIRIRGYTTNGYTDTPCVKQGTEPDTTGAIAGGVTAVLIVLIIAFVVLFIIAKRRGVDRFTRIDSDDKEGPTVLM-MQDLNPSSRLIGGKSQRETTQRNPSTAGHDNEGFDGEELKSRSSESDEEEEAWKSRPVSTSQFKEHVEKYHRDSDLLFSDEYKTVKELAPSYEWLEAEKPSNRCKNRYTNILPFDHSRVKLLPIDDDEGSDYINANYMPG--YRSKRE--------FIAAQGPLPATKD-------DFWRMIWEQNVTLVVMVTQCVERGRIKCEQYWPKDTEAE--YYGD---LVVQMRSESTLSDYTIRILDVQLGEFSRVLKQFHFTKWPDHGCPESTTLLINFVQNVRMHISHRPNRGPILVHCSAGVGRTGTFIAVDRLLQHI-REHNEVDIFGLVLEMRENRCNMVQTEDQYIYIHECIKDAIAQG--MHLNNGNLED 1869          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: A0A1S3HQ93 (receptor-type tyrosine-protein phosphatase eta isoform X2 OS=Lingula unguis OX=7574 GN=LOC106156488 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 1.318e-62
Identity = 301/1302 (23.12%), Postives = 524/1302 (40.25%), Query Frame = 3
Query:  477 NLSTSSAFPLHPLNIS------------WERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVS-VYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQ-FNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTG-NYTSISPNVSEPISNLSV-IFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISN-ISVTTPQYQPDPVTNLQ-SIVDKSQIKIVWSYPIVHT---INYKYDIQVYNGTFSYKDELRGG--SYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSI--SSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVT---------NNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVE--KNGKILNYWL------TCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYG----APVFSFLIIVPSA-VPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISET------RNNIVGNASITSLQ-YQNVAYGECITKNTCVYEIRLSPPKP-KRALKRNTNPKANWQNEEYIVGNNLLGN-KSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRN----KHVSEATNTAITHLLPMDSKSPAAHEF---------HENYEFMKQDSNGRLLDDFR---------------------EIKELAVKLERQKVIMFTE--------------------GNDAKNRFSNIKPYKHNRVKLL-----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKARQSN--QAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNRED 4028
            N+ST    P  P+N++            WE PQ PNG++  Y+++ ++     +   T +        N+S                 NS++  + +I     + P + Y   V A N  G G + + +   T++ T G V   +++      ++I W  P   NG+++ Y + V   +  CV  ++ +CTDC P IS          +CT+    Q F++  ++   V     ++P   Y   +      G G        ++    SEP + ++V I       L I W+ P N    I  Y             L+  +N T  F+N +                  +F +  D+ S             + + VR  T+ G G  S  ++V T + +P    ++    +  + I++ W  P++     I Y   +   +     K+E +    + +F +  L+ C +YT  V         + +   +N+T ++      I  + ++T  +I++ W       C + + V  T  ++  +          + + E+ NLK    Y IKV        +       ++    +     P + ++  C +  Y  +  TW  P    KNG I  Y +        KN+ +      +ST  ++S     +  Y  +V+A T VG G    AP +  L   P   V   N    +  A       V D   Q ++ +P S F +  G ++  +++++E        +++  +    +L+ +  V   E IT     Y I+   P P   A +R       +   E I+G+    N  +    NGPL SG  Y I  R YT+ G+     +++ T  +    I G   AV +++ ++  + FII  +R       +        T L+ M   +P++              N      D+ G   ++ +                     + KE   K  R   ++F++                     N  KNR++NI P+ H+RVKLL       +DYINA+ +    ++S++E        +IA QGP+   ++       DFWRMI E NV ++V +T+  E G+ KC QYWP +   +  YY +   + V+M S    S +  R+ +V +     +V   +   W D GCP TT   L F    R   + +    I VHCSAGVGRTGTFI +D  L  I +E + ++I+  +L +R+ RC MVQTE QY +I+  I + + Q   + +   N ED
Sbjct:  685 NVSTEEIPPSAPINLTSDEKTTNSTNLKWEEPQHPNGKVTDYFIEYWQADHKTKEYDTYY--------NIST----------------NSADTSYSVI----NLIPGSTYKFQVKAVNSKGPGEVSNNITVTTNESTPGEVSNLTVSQNTSMSMNIGWEEPIEPNGEVITYEMHVLLEDKSCVQQVTFSCTDC-PAISKISEKSEEAPSCTSTDTTQSFSIHGRVDYTV---RNLVPYTNYTFRVYPFTSVGRGKSKDMREQTLEDTPSEPRNVMAVNITQNEKTGLNITWEAPDNPRGIITGYQ------------LRVTVNDTSNFHNTTD-----------------EFKALPDLLSY----------QNHTIEVRAYTVAGPGNWSKPLTVLTGEARPSAPQHIAFGDISPTSIEVQWQDPVMKRGILIGYLIIVTKASNGEVVKNETQDANEAKSFDATGLDPCQHYTFKVAARTSKGFGNYSSEQTNSTAVNIPGTPVIVKAEAITSTSILVMWIPPPNETCPIDYVVEVTDNDSKEIVKEIPIKGYNSTEKEITNLKKFWSYDIKV---KANTTAGPSMPSTNVKNTTLEDTPGPPARVNASC-DVCYNSMTVTWEAPTRENKNGIITGYVIYYTDGEISKNKKIDIGSQKSSTITSLS----AEKSYQVKVAARTRVGEGEKETAPTYVNLTSGPPIFVAPANTFAKVSTA------SVEDARKQISLQVPSSPFGSENGIVRNISVIVAEDSEAGKPESDVRKDNKFPTLKTWGQVKDLEKITP----YAIKEVEPNPWGTAGQRQRRAATPY---EIIIGSQDCSNVATSKYCNGPLPSGRTYCIRIRGYTTNGYTDTPCVKQGTEPDTTGAIAGGVTAVLIVLIIAFVVLFIIAKRRGVDRFTRIDSDDKEGPTVLM-MQDLNPSSRLIGGKSQRETTQRNPSTAGHDNEGFDGEELKSRSSESDEEEEAWKSRPVSTSQFKEHVEKYHRDSDLLFSDEYKTVKELAPSYEWLEAEKPSNRCKNRYTNILPFDHSRVKLLPIDDDEGSDYINANYMPG--YRSKRE--------FIAAQGPLPATKD-------DFWRMIWEQNVTLVVMVTQCVERGRIKCEQYWPKDTEAE--YYGD---LVVQMRSESTLSDYTIRILDVQLGNNTRTVRHFNFTVWPDFGCPDTTRSLLEFVKVVRTHIKPDIQGPICVHCSAGVGRTGTFIAVDRLLQHI-REHNEVDIFGLVLEMRENRCNMVQTEDQYIYIHECIKDAIAQG--MHLNNGNLED 1868          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: A0A1J1IKK8 (CLUMA_CG014018, isoform A OS=Clunio marinus OX=568069 GN=CLUMA_CG014018 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.507e-54
Identity = 175/593 (29.51%), Postives = 286/593 (48.23%), Query Frame = 3
Query: 2238 WAPPVEKNGKILNYWLTCKNESVIYNDNITST-TVTISEWVET----------DILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETR--NNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL---LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTT-SEFLAFYSAYRKARQS-NQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIY 3962
            W PP  +NGKI  Y +   ++   +N  I+ T  V  S+++E           D  Y   + A+T    G   F   +I+ + +P +   D   + +  ++ K       A +T+PYS F +  G I    ++++E     ++         +    ++ E  +  +CV + +      +      T  +   +   + VGN   G+   +  NGPLK G  Y+I  R +T  GF    +I  KT   K      +S+++   +C+   I F I YK+ + + E +          D K    ++F + +  M  D N R+ +++  I+  A  L+  K  + ++ N+  NR++NI P+ +NRV L     +NDYINAS I   H+  E          YIA QGP       K  T  DFWRMIL++ V  IV LT   E  + KC +Y+P ++N +IT+ +    IN+   S  ++  F++R+  V  D++  +V   +  +W DHG P++ S  + F   +R  RQ  + +IVVHCSAGVGRTGTFI +D  + R LK++ +I I+  +  LR  R +MVQT  QY F+Y
Sbjct:  592 WTPPCRRNGKITKYIINAVHQ---FNPQISWTYEVDASQYIEEYSFNVENFQPDSQYNVSIQANTEEFIGRETFQ-TVILEAGLPLLTEWDS-NEVIYSISTK------DARLTIPYSIFHSEVGRITKILILVAEMSCDGDLTPEKGFVGKEPYLKSWREA-SSESCVPQYQTGTITDESIQTLTT--EEGLEVFIFTVGNENCGDSPSY-CNGPLKPGASYLITMRVFTRRGFSDTDYILIKTE--KEVPFYTISISILSTMCVVFMIGFYITYKKTRTLREQSMD-----FSNDKKDIPINDFGKYFSEMSADDNARMKEEYAAIQAYAESLD--KTFIASKANEKLNRYTNISPFDYNRVVLNDDEFENDYINASHINGYHYPRE----------YIAAQGP-------KPNTAIDFWRMILQHKVESIVMLTSFVEEDRIKCHEYFP-KLNGQITFSN----INIICKSEENHQNFIKRIMEVEKDDEIHTVKHYYFTSWSDHGIPSSPSALIEFCKLFRSERQKLSGSIVVHCSAGVGRTGTFIALDIIMQR-LKQEKKINIFELINQLRLQRMKMVQTLDQYVFLY 1137          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Match: A0A087TPC7 (Phosphotidylinositol phosphatase PTPRQ (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_02474 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.142e-53
Identity = 188/662 (28.40%), Postives = 291/662 (43.96%), Query Frame = 3
Query: 2163 TGEGVPSSVLSFKC-VNQSYTGIKCTWAPPVEKNGKILNYWLTC-------KNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSV--GYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGN-------------KSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVA----VFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLL--------------------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRK--ARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            T   VP +  + K   NQ  T  + +W+PP   NG I+ Y +         KN  +  +D      +++   +  +  YT  V A        G P      I+P+ +P + N        SK+ +K +  + +  I      FS+  G +  + +++  T  + +GNA+          + + I   +  Y+   +PP+         NP    QN+      N  G+              ++   NGPL+  T Y +  RA+T  G+     +  +TA    S+ +G   A    +F++I L + +  + R  + + + +   +   H                      P+D      H F E+   M  DS+ R   +F  +K  + +       M  E N  KNR+ NI PY H+RVKLL       +D++NA+ I       E          YIA+QGP+         TV DFWRMI E +V VIV LT+  E GK KC QYWP     K  YY +   + V   S    S +V RVF+V +  +E+ V Q+H   W D GCP +  + + F  A R    R     I+VHCSAGVGRTGTFI +D  LS+ L   D I++Y  +L+LR+ R  MVQTE QY +I+  +++ +
Sbjct:  937 TPADVPDAPQNVKAECNQQPTEAEVSWSPPKYPNGLIVKYRIEYGLENSYKKNAYLTVSDPCKEQKISLQN-LRPERHYTITVRARVQGVDSDGHPATFKPCILPAGIPPLGN-------TSKILVKESGPH-RLMIEWSRDAFSDYMGALVRYAVLVGLT--DALGNATSGKTSENLPNWSKFIEGESNYYQA--TPPE--------WNPFDKSQNDSLECKPNTDGSILKCTIGLESYCPNNETYCNGPLRPATQYEMKLRAFTRGGYAESQPLLARTAPAPSSSYLGALAAGLTLLFIVIFLLMGLMVLQRKGKLEPLRQVIRSRFGHTAPSAPPIPEPPQQIEIYQTRGPLD-----VHNFSEHVRIMMSDSHLRFSQEFEALKRSSPQFPCATAEM--EENRGKNRWMNIYPYDHSRVKLLPLGDEPGSDFVNANYIPGNSSLRE----------YIASQGPL-------PNTVDDFWRMIWEQSVTVIVMLTQCVERGKNKCEQYWPAPGEMK--YYGD---LQVRTLSESMLSSYVIRVFHVQLGPRELRVKQMHFTRWPDFGCPESPDDLINFVRAVRDHLPRVRPGPILVHCSAGVGRTGTFIAVD-RLSQQLMRSDVIDVYGTVLDLRQYRTNMVQTEDQYIYIHLCVNQLI 1547          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:NCBI gene;Acc:103023538])

HSP 1 Score: 168.703 bits (426), Expect = 2.882e-42
Identity = 127/378 (33.60%), Postives = 195/378 (51.59%), Query Frame = 3
Query: 2949 STIVGVSVAV--FVIICLSIAIYFIIRYKRNKHVSEATN--------TAITHL--LPMDSKSPAAHEFHENY--EFMKQDSNGRLLDD---FRE-IKELAV-KLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSM---DYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            + I+ V VA+   ++I   I + +++R+K+ K     +N        T  T L  +P+ ++SP+ +  +     + ++++ N R+ DD   FRE    L V  ++        E N  KNR+ NI PY H+RV L     +  +D+INAS I   +   EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y     I V +   M   DY+I    +++V +VS  + +  VTQ H  +W D G P T   +      +K +  N      IVVHCSAGVGRTGTFI+ID  L  ++  + +++++  +  +R  RCQMVQT+ QY FI+  + E+
Sbjct:  192 TAIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLTNGRTEDTELQSVPLLARSPSTNRKYPPLPVDKLEEEMNRRMADDNKLFREEFNALPVCPIQASCDAASKEENKEKNRYVNILPYDHSRVHLSSLEGVPDSDFINASYI---NGYQEK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGN---IRVSVEDVMVLVDYTIRKFCIQQVGDVSGKKPQRLVTQFHFTSWPDFGVPFTP--IGMLKFLKKVKTCNPQYAGPIVVHCSAGVGRTGTFIVIDAMLD-MMGAERKVDVFGFVTRIRAQRCQMVQTDMQYVFIFQALLEH 543          

HSP 2 Score: 135.191 bits (339), Expect = 1.233e-31
Identity = 92/285 (32.28%), Postives = 141/285 (49.47%), Query Frame = 3
Query: 3153 GRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            G L  +F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          Y+A+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYW ++          D  I ++     +     + +   + + K  +V Q H   W + G PT  +  +   +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  573 GGLEAEFKKLTSIKIQNDKMRTGNLP-ANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YMASQGPL-------QHTIEDFWRMIWEWRSCSIVMLTELEERGQEKCAQYWSSD----GVMVCGDLSIELKREDECESYTVRDLLVTNNRENKARAVRQFHFHGWPEVGIPTDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 834          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 171.014 bits (432), Expect = 3.321e-42
Identity = 143/438 (32.65%), Postives = 215/438 (49.09%), Query Frame = 3
Query: 2838 NGPLKSGTLYIIGFRAYT------SAGFVTVGF------IERKTAVNKISTIV-GVSVAVFVIICLSIAIYFIIRYKRNKHV--------------SEATNTAITHLLP----MDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEIS----VTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDN 4019
            +GPL S T Y +  RA+T      +  F    F      +  +T    +  IV G+S  +F +I + IAI  +I YK+  H                E +NT +   +     + S   AAH F  +   ++ DSN    ++F ++K++  + +        E N  KNR++NI PY   RVKLL       +D+INAS I    +  E          YIATQGP+   ++       DFWRM+ E+NV  IV +T+  E G+ KC QYWPT+  ++  YY E   + V M S    S ++ R F +S  E ++S    V   +   W DHG P T+    +F+     Y     ++   VVHCSAGVGRTGTFI++D  L + L     ++IY ++ +LR  R  MVQTESQY F++  + + L +A  +R  ++N
Sbjct: 1478 DGPLASRTPYRLSVRAFTQLYDGENKQFSHPLFSDTYLSLPLRTKAEPMGGIVEGISTGLF-LISMVIAITTLIIYKQRVHKVAVQESPVVRMSMWKEVSNTGMYMGIRSNRCISSPIKAAH-FESHLSKLQADSNYLFSEEFEDLKDVG-RNQTLDAARLPE-NRCKNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPTD--REPLYYGE---LVVHMLSESVLSEWIIREFKISR-EGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQ-LDSRGTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVL-RARKLRCEQEN 1886          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 170.629 bits (431), Expect = 3.941e-42
Identity = 143/438 (32.65%), Postives = 215/438 (49.09%), Query Frame = 3
Query: 2838 NGPLKSGTLYIIGFRAYT------SAGFVTVGF------IERKTAVNKISTIV-GVSVAVFVIICLSIAIYFIIRYKRNKHV--------------SEATNTAITHLLP----MDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEIS----VTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDN 4019
            +GPL S T Y +  RA+T      +  F    F      +  +T    +  IV G+S  +F +I + IAI  +I YK+  H                E +NT +   +     + S   AAH F  +   ++ DSN    ++F ++K++  + +        E N  KNR++NI PY   RVKLL       +D+INAS I    +  E          YIATQGP+   ++       DFWRM+ E+NV  IV +T+  E G+ KC QYWPT+  ++  YY E   + V M S    S ++ R F +S  E ++S    V   +   W DHG P T+    +F+     Y     ++   VVHCSAGVGRTGTFI++D  L + L     ++IY ++ +LR  R  MVQTESQY F++  + + L +A  +R  ++N
Sbjct: 1478 DGPLASRTPYRLSVRAFTQLYDGENKQFSHPLFSDTYLSLPLRTKAEPMGGIVEGISTGLF-LISMVIAITTLIIYKQRVHKVAVQESPVVRMSMWKEVSNTGMYMGIRSNRCISSPIKAAH-FESHLSKLQADSNYLFSEEFEDLKDVG-RNQTLDAARLPE-NRCKNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPTD--REPLYYGE---LVVHMLSESVLSEWIIREFKISR-EGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQ-LDSRGTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVL-RARKLRCEQEN 1886          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:NCBI gene;Acc:103023538])

HSP 1 Score: 168.703 bits (426), Expect = 4.055e-42
Identity = 127/378 (33.60%), Postives = 195/378 (51.59%), Query Frame = 3
Query: 2949 STIVGVSVAV--FVIICLSIAIYFIIRYKRNKHVSEATN--------TAITHL--LPMDSKSPAAHEFHENY--EFMKQDSNGRLLDD---FRE-IKELAV-KLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSM---DYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            + I+ V VA+   ++I   I + +++R+K+ K     +N        T  T L  +P+ ++SP+ +  +     + ++++ N R+ DD   FRE    L V  ++        E N  KNR+ NI PY H+RV L     +  +D+INAS I   +   EK       N +IA QGP       K +TV DFWRMI E N   IV +T ++E  + KC+QYWP   +Q    Y     I V +   M   DY+I    +++V +VS  + +  VTQ H  +W D G P T   +      +K +  N      IVVHCSAGVGRTGTFI+ID  L  ++  + +++++  +  +R  RCQMVQT+ QY FI+  + E+
Sbjct:  233 TAIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSFRLTNGRTEDTELQSVPLLARSPSTNRKYPPLPVDKLEEEMNRRMADDNKLFREEFNALPVCPIQASCDAASKEENKEKNRYVNILPYDHSRVHLSSLEGVPDSDFINASYI---NGYQEK-------NKFIAAQGP-------KEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGN---IRVSVEDVMVLVDYTIRKFCIQQVGDVSGKKPQRLVTQFHFTSWPDFGVPFTP--IGMLKFLKKVKTCNPQYAGPIVVHCSAGVGRTGTFIVIDAMLD-MMGAERKVDVFGFVTRIRAQRCQMVQTDMQYVFIFQALLEH 584          

HSP 2 Score: 135.191 bits (339), Expect = 1.394e-31
Identity = 92/285 (32.28%), Postives = 141/285 (49.47%), Query Frame = 3
Query: 3153 GRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            G L  +F+++  + ++ ++ +       N  KNR   I PY+ NRV +  K      DY+NAS I   + Q +          Y+A+QGP+         T+ DFWRMI E   C IV LT +EE G+EKC+QYW ++          D  I ++     +     + +   + + K  +V Q H   W + G PT  +  +   +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  614 GGLEAEFKKLTSIKIQNDKMRTGNL-PANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFI-DGYRQKDS---------YMASQGPL-------QHTIEDFWRMIWEWRSCSIVMLTELEERGQEKCAQYWSSD----GVMVCGDLSIELKREDECESYTVRDLLVTNNRENKARAVRQFHFHGWPEVGIPTDGKGMINIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERV-KAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYKVVQEYI 875          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 170.244 bits (430), Expect = 5.537e-42
Identity = 134/389 (34.45%), Postives = 183/389 (47.04%), Query Frame = 3
Query: 2955 IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHE-NYEFMKQDSNGRLLDDFREIKELAVKLERQKV---IMFT-------------------EGNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVF----NVSMDEKEISVTQLHMLAWKDHGCPT-TSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDN 4019
            +VG  +AV  IIC+ IAI     YKR +  SEA   +    LP + + P+ H         +   + G        I +LA  LER K    + F+                   E N AKNR++N+  Y H+RV L A      +DYINA+ I     Q          N YIATQG + E       T GDFWRM+ E     IV +T++EE  + KC QYWPT   +          I V +  +++ + +  R F    N S +++E  V Q    AW DHG P   + FLAF    +     +   +VVHCSAGVGRTG FI+ID  L RI K +  ++IY ++  +R  R  MVQTE QY FI+  + E  V  G   +P  N
Sbjct: 1267 VVGPVLAVVFIICIVIAILL---YKRKRAESEARKGS----LPNNKEMPSHHPTDPVELRRLNFQTPGMASHPPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQ----------NAYIATQGSLPE-------TFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGL------IQVTLLDTVELATYCVRTFALYKNGSSEKRE--VRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERI-KHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLE-AVTCGNTEVPARN 1621          

HSP 2 Score: 150.599 bits (379), Expect = 5.740e-36
Identity = 96/260 (36.92%), Postives = 129/260 (49.62%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ---SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR  NI PY+  RV L     +  +DYINAS I     Q            YIATQGP+ E  E       DFWRM+ E+N  ++V LT++ E G+EKC QYWP E + +  Y+  D      M        ++ R F V+   D +  +V Q     W + G P + E F+ F     K ++    +  I VHCSAGVGRTG FI +   L R ++ +  ++I+  +  LR  R  MVQTE QY F Y    EYL
Sbjct: 1666 NKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQ----------KAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLER-MRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1901          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 156.377 bits (394), Expect = 2.667e-39
Identity = 111/370 (30.00%), Postives = 181/370 (48.92%), Query Frame = 3
Query: 2964 VSVAVFVIICLSIAIYFIIRYKRNKHVSEATNT----------AITHLLPMDSKSP---------AAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEY 3980
            V++A  ++I + I + +++R+++ KH    TN+          A    +P+ ++SP         A     E +     D N    ++F  +    ++   +      E N  KNR+ NI PY + RV L     +  +DYINAS +   +   EK       N +IA QG     + PK +T+ D+WRMI E N   IV +T ++E  + KC+QYWP   +Q    Y        ++   +DY+I    ++ V ++   +    +TQ H  +W D G P     +      +K +  N      IVVHCSAGVGRTGTFI+ID  L  +++ + +++++  +  +R  RCQMVQT+ QY FIY  + E+
Sbjct:  105 VALACILVIGVFIIVLYMLRFRKYKH--NGTNSLRLANGRGEDAEMQSMPLLARSPSTNRKYPPLAVDRLEEEFNRRSADDNKLFREEFNSLPSCPIQATCEAAS--KEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYV---NGYQEK-------NKFIAAQG-----KGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWP---DQGCWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAP--IGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLD-MIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEF 449          

HSP 2 Score: 147.517 bits (371), Expect = 2.212e-36
Identity = 100/285 (35.09%), Postives = 145/285 (50.88%), Query Frame = 3
Query: 3159 LLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            L D+F+++  + ++ E+ +       N  KNR   I PY  NRV +  K      DYIN S I        ++ + F     +A QGP+        QTV DFWRM+ E   C IV LT +EE G+EKC++YWPTE    ITY      I +E+     +  +  R F+VS   + K   + Q H   W + G P   +  ++  +A +K +Q   N  I VHCSAG GRTGTF  +   L R+ K +  ++++  + +LR  R  MVQT  QY F Y V+ EY+
Sbjct:  481 LEDEFKKLTTVKIQNEKMRTGNL-PANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFI-----DGYRQKDAF-----LAGQGPL-------QQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTE--GTITYGD----IIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERV-KTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYI 740          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.629e-36
Identity = 103/282 (36.52%), Postives = 137/282 (48.58%), Query Frame = 3
Query: 3231 EGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVE-MNSSMDYSI---FVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA----IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTES-------------------QYCFIYSVIHEY 3980
            E N  KNR+ NI PY  +RV+L     +  +DYINAS I          N     N +IA QGP       K +T+ DFWRMI E N   IV +T ++E    KCSQYWP     K  +      ++VE +   +DY+I    V+ V       +   VTQ H  +W D G P T   +      +K + SN +    IVVHCSAGVGRTGTFI+ID  L  I  E  R++++  +  +R  RCQMVQT+                    QY FIY  + E+
Sbjct:   57 EENKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYI----------NGYREKNKFIAAQGP-------KEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWP----DKGCWTYGSVRVSVEDITVLVDYTIRKFCVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTP--IGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAMLDMIQAE-QRVDVFGFVSRIRAQRCQMVQTDLQPLDCYLDSDFEQLASILIQYVFIYQALLEF 314          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000174.1 (pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 gene:ENSPMAG00000000154.1 transcript:ENSPMAT00000000174.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 7.956e-35
Identity = 115/366 (31.42%), Postives = 171/366 (46.72%), Query Frame = 3
Query: 2976 VFVIICLSIAIYFIIRYK-RNKHVSEATNTAITHLLPMDS---------------KSPAA-HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSE----FLAFYSAYRKARQSNQAIVVHC----SAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            V +I CL+ A+  +I     N H   +  + +  L+  DS               ++P    +F + Y+  + DS     ++++E+  +  K +  +     E N  KNR++NI P+   RVKL     +  +DYINA+ I   H  S +         YIA QGP+   RE       DFWRM+ E  V  IV LT   E G+ KC  YWP +I      Y +   +      S +++I    V      +++ S+   H  AW DHG P T++    F+  +  +         IVVHC    SAGVGRTGTFI +D  L  I K+ + I+IY  + ++R  R  MVQTE QY FI+  I + L
Sbjct: 1058 VILIACLTTAMIVVIACAIENSHSVRSPRSYVELLVRRDSLTMHVIMEDTSNKKKRNPVPFSKFPDYYKKREADSGYLFSEEYQELSSVG-KGQAMEAATLAE-NRTKNRYTNILPFDVTRVKLASVEDIPHSDYINANYI-KGHSSSRE---------YIAAQGPLAGTRE-------DFWRMVWEQKVNQIVMLTNCVERGQPKCECYWPMDITP--VRYGDIGLVMEWDKPSPEWTIRHLVVKAQHKTDEKRSLYHFHFTAWPDHGVPDTTDSLTNFVRLFRTHVNTTNKGGPIVVHCRCGSSAGVGRTGTFISLDHLLQDIDKKPE-IDIYGIVHDMRMSRVLMVQTEMQYIFIHKCILKVL 1401          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 1.944e-34
Identity = 96/251 (38.25%), Postives = 131/251 (52.19%), Query Frame = 3
Query: 3231 EGNDAKNRFSNIKPYKHNRVKLLAK--NDYINASKICSAHWQSEKENECFCSNI-YIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEI----SVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSN----QAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQY 3950
            E N  KNR+S+I PY HNRVKL  +  +DYINAS +           + + S+I YIA QGP+ EN      T GDFW+MI E    VIV +T+ EE GK KC QYWP     K  Y      + V +     Y+  V R  ++S  +        VT + +++W DHG P     L      R+    N     A+VVHCSAGVGR+GT+I +D  L R L+ +  +++Y  +  LR  R  MVQ E ++
Sbjct:  427 EYNTKKNRYSDILPYDHNRVKLSGEGESDYINASYV-----------DGYKSSIRYIAAQGPL-EN------TAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAYGD----VTVTIMDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVPEDPNLL--LKLRRRVNSFNGAGCTAVVVHCSAGVGRSGTYIGLD-CLVRQLENEGHVDVYGCVFRLRHQRPLMVQVEVRF 652          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006520.1 (pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 gene:ENSPMAG00000005841.1 transcript:ENSPMAT00000006520.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.473e-32
Identity = 91/279 (32.62%), Postives = 133/279 (47.67%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKLLAKND----YINASKI----CSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPT--EINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKARQ-----------SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLI 4001
            N  +NRF ++ PY+ NR++LL   D    Y+NAS+I        W             YIATQGP+         T  DFW+M+ E  V VI  +T+ EE GK K  +YWP     +  +TY        V      D+  +      +   +D  E +V  L    W DHGCP   + FL +    +  R+           +N  +VVHCSAGVGRTG  IL  E +   L+ ++++++ + L  LR  R  MVQT +QY F+Y  + ++L  + LI
Sbjct:  928 NHDRNRFKDVVPYEENRIELLPSKDNPTGYVNASRIQVTVSGEEWH------------YIATQGPL-------PSTCQDFWQMVWEEGVNVIAMVTQEEEGGKSKSHRYWPKLGSRHSAVTY----GKFKVTTKFRTDFGCYATTGLKLKHLLDGHERTVWHLQYTDWPDHGCPDHVQGFLGYLEEIKSVRRHTNNMLEASKPANPPVVVHCSAGVGRTGVVILT-EMMIACLEHNEKLDVPDVLAILRTQRMLMVQTITQYTFVYQALIQFLRSSRLI 1182          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 110.923 bits (276), Expect = 1.156e-26
Identity = 102/321 (31.78%), Postives = 139/321 (43.30%), Query Frame = 3
Query: 3126 YEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKL--LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILEN---NVCVIVNLTRVEEHGKEKCSQYWP-------TEINQK---------ITYYSEDDPIN-VEMNSSMDYSIFVERVFNVSMDEKEISVTQLHML---AWKDHGCPTTSEFLAFYSAYRKARQS-NQAIVVHCSAGVGRTGTFILIDEEL----------------SRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIY 3962
            ++F++   +GRL    RE     V       +     NDA+NR+ NI PY+ NRV L  L+ NDYINAS +     +     +      YIATQGP         +T   FW+M   N   +  VIV +T + E+ +EKC QYWP         I  K         +T +  D  I  V ++   DY   V  +     D     V  +H      WKD   P     +    A+  +  S    I+VHCSAGVGRTGTFI +D  +                 R  +E  R  I   +L LR  R +MVQT+ Q+ FIY
Sbjct:   19 FKFIQNQEDGRL----REATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKTLSGNDYINASYV-----KVNVPGQSIEPGYYIATQGPT-------RKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYT-VTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 55.8398 bits (133), Expect = 3.962e-8
Identity = 42/127 (33.07%), Postives = 62/127 (48.82%), Query Frame = 3
Query: 3243 AKNRFSNIKPYKHNRVKLLAK--------------------NDYINASKICSAHWQSEKENECFCSNI-------YIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYW 3542
            AKNR+ +I PY+H+RV +L K                    ++YINA+ +    +  E +N  F +         YIATQ P+         TV DF+  IL N V ++++LT   E+G EKC +YW
Sbjct:  529 AKNRYKDIFPYEHSRV-ILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVE-QNSSFQTTTTTTRRVRYIATQAPM-------PSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 49.6766 bits (117), Expect = 3.582e-6
Identity = 42/142 (29.58%), Postives = 57/142 (40.14%), Query Frame = 3
Query: 3225 FTEGNDA--KNRFSNIKPYKHNRVKL----------------------------------LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYW 3542
             TEG  +  KNR+SNI PY+H+RVKL                                     NDYINA+ +       + +        YIATQ P+         T+ DFW++I  N V VI++L   +E    K   YW
Sbjct:  402 LTEGIQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK--------YIATQAPL-------PSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW 528          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 146.747 bits (369), Expect = 9.406e-39
Identity = 97/256 (37.89%), Postives = 138/256 (53.91%), Query Frame = 3
Query: 3231 EGNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSE-FLAFYSAYRKA-RQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHE 3977
            + N  KNR+S++ PY HNRV L        +DYINAS I       +  N       YIATQGP+       A TV DFW+M+ E  V VIVNLTR+ + G  +C +YWP + ++  TY+  +  +  E     DY +    + N+   E   +VTQ H L+W D   PTT +  L F     K  R  +  IVVHCS GVGRTG +ILID  L+++++    I+I   + +LR  R  MV+T++Q+ F  + + E
Sbjct:   54 DKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFITD----HDPRNPA-----YIATQGPL-------AHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHE--TYHIYEVHLVSEHIWCDDYLVRSFYLKNLQTSETR-TVTQFHFLSWPDLNVPTTPKPLLEFRRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAVAE 290          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO31805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW8])

HSP 1 Score: 152.525 bits (384), Expect = 1.692e-38
Identity = 100/300 (33.33%), Postives = 150/300 (50.00%), Query Frame = 3
Query: 3168 DFREIKELAVKLERQKVIMFTEG----NDAKNRFSNIKPYKHNRVKL-LAKND----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDE------KEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKAR----QSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIP 4010
            D++   E     E+ K + + +     N  KNRF+N+  Y H+RV L L +ND    YINA+ + + +            N YIATQGP+       A+T+ DFWRMI E N  VIV +T + E G+ KC+ YWPT+ N+K   +    P+ +       ++ +  R F +  ++      + + V Q H   W DHG P             K+          +VVHCSAGVGR+G FI+ID  + RI    D ++I+N L ++R  R  +VQ E QY FI+  + EY+    +I +P
Sbjct:   22 DYKFFMEFEGVHEKNKRLTWVQSQKPENQMKNRFANVVAYDHSRVVLSLTENDQSSHYINANYVDTYN----------AMNAYIATQGPL-------AKTISDFWRMIWEQNCRVIVMITNIIEKGRHKCAMYWPTK-NRKTENHG---PLTITFVQEETFAYYSIRTFEIKPNKDGTHYTQPMMVKQFHFTGWPDHGAPEPGFEFPVLDLIMKSTACVVPGTGPLVVHCSAGVGRSGAFIVIDSMIKRIHDNGD-LDIFNFLAHIRNQRNHLVQEECQYIFIHDTLAEYIACNFVISLP 299          

HSP 2 Score: 56.9954 bits (136), Expect = 3.988e-8
Identity = 62/234 (26.50%), Postives = 94/234 (40.17%), Query Frame = 3
Query: 3222 MFTEGNDAKNRFSNI-KPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEI-SVTQLHMLAWKDHGCP----TTSEFLAFYSAYRKARQSNQ-------AIVVHCSAGVGRTGTFILIDEELSRILKE 3869
            +F E N  K    N    +  +RV+L  +     +DYINAS I           E F     IATQ P+         T  D+WRMI + N   IV L   +E  K+    Y P   +   T +  D  + +E  ++    I  +     + D   I  +   H L W +HG P    T  + ++    +    + N         IVVHC+ G+GRTG +  +     +I +E
Sbjct:  343 LFYECNLQKVTIDNFFSEFDSSRVRLYPRPGEEGSDYINASYI-----DGFTRREAF-----IATQHPL-------QSTTMDYWRMIWQENCRSIVMLLSEKEWDKDVFPSYLPAVHD---TAHFGDYEVTMESETARGDFIIRDLKLISTKDPSVIRQIRHFHFLHWPEHGQPWSGQTVLQLVSKVEEWESEVEKNSHQFDIIGPIVVHCNNGIGRTGVYCALHALWQQITQE 556          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 145.591 bits (366), Expect = 1.813e-38
Identity = 89/256 (34.77%), Postives = 133/256 (51.95%), Query Frame = 3
Query: 3231 EGNDAKNRFSNIKPYKHNRVKLLAKN--DYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS--MDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQA-IVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            + N  KNR+ N+ PY+  RV+L   +  DYINA+     H +   +++ +    YIATQGP+         T  DFW+MI E  V V+  +T  +E GK KC +YWP   NQ +          V +    +Y  FV+R   V      K I +  L+ + W DHG P +   +  + AY ++  ++QA +VVHCSAG+GRTG  I +D  L  +++ D   +I   + +LR+ R  M+QT+ QY F Y    E L
Sbjct:   54 QANTDKNRYRNVLPYEATRVRLSGSSGEDYINAN-----HIRVLVDDDTYH---YIATQGPL-------PNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLGGR---FEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAYMRSLATSQAPVVVHCSAGIGRTGALIAVDVALG-LMERDKPFDINQTIRDLREQRQGMIQTKDQYIFCYKACLEVL 290          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 150.599 bits (379), Expect = 7.556e-38
Identity = 103/265 (38.87%), Postives = 137/265 (51.70%), Query Frame = 3
Query: 3234 GNDAKNRFSNIKPYKHNRVKL-----LAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVS-MDEKE--ISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQ----AIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQA 3992
             N  KNR++NI  Y H+RV L     + ++DYINA+ I       +  N    S  +IA+QGP+ E       T  DFWRM+ E    +IV LT++EE G+ KC QYWP    +          + V  N +   S +V R F VS M E+E    V Q H  +W DHG P     L   S  R    +N      ++VHCSAGVGRTGTFI +D  L R  +E   I+++  +  +R  R  MVQTESQY F    IH+ LV+A
Sbjct:   45 ANKYKNRYANIVAYDHSRVLLTPLEGVLESDYINANYI-------DGYNR---SGAFIASQGPLPE-------TFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNY------GALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPL--LSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGT-IDVFGFVRQMRNKRNLMVQTESQYVF----IHDALVEA 279          

HSP 2 Score: 147.902 bits (372), Expect = 6.206e-37
Identity = 98/259 (37.84%), Postives = 133/259 (51.35%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEIS--VTQLHMLAWKDHGCPTTS-EFLAFYSAYRKARQ--SNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N AKNR++NI PY+  RV L  +     +DYINAS I   H              YIATQ P+        +T  DFWRM+ E    VIV LTR EE GK KC +YWP++ ++        D I VE+   + YS +V R F+++  E++ S  V Q     W D G P +    +       K +Q   N  I VHCS GVGRTG F  +   + R+ K +  I+++  + +LR  R  MVQT+ QY F Y+ I EYL
Sbjct:  336 NAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNH----------RLKAYIATQAPV-------PRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLY------DKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERV-KAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYL 570          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 150.599 bits (379), Expect = 8.528e-38
Identity = 103/264 (39.02%), Postives = 137/264 (51.89%), Query Frame = 3
Query: 3225 FTEGNDAKNRFSNIKPYKHNRVKLLA-----KNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNV--SMDEKEISVTQLHMLAWKDHGCP-TTSEFLAFYSAYRKARQSN-----QAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHE 3977
              + N  KNR++NI  + H RV L        +DYINA+ +     Q E          YIA QGP+ E       T  DFWRM+ E N  VIV +T  EE G+ KC QYWP+  +Q          I+V M S+++ S +  R F V  S   +E  V Q H  AW DHG P + +  L F    RK+   N       +VVHCSAGVGRTGT+++ID +L RI  E   +++YN ++ LR  R  MVQ E QY  I+ V+ E
Sbjct:   40 LNQANRFKNRYNNITAFDHCRVLLQPIEGDPTSDYINANYLDGYRKQRE----------YIAAQGPLPE-------TCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNYGV------IHVNMMSTVELSDYTIRSFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNF---VRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEAT-VDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLE 276          

HSP 2 Score: 127.487 bits (319), Expect = 2.936e-30
Identity = 88/259 (33.98%), Postives = 124/259 (47.88%), Query Frame = 3
Query: 3237 NDAKNRFSNIKPYKHNRVKLLAK-----NDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEIS--VTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSN---QAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            N  KNR++N+ PY   RV+L  +     +DYINA+ I          +       +IATQ PI +       T+ DFWRMI E + C IV L++  E GK K  +YWP +    I        + VEM     +  ++ R F V+  ++  S  V Q    AW D G P +   L       +  Q     Q   VHCSAGVGRTG F  +   + R LK +  ++++  +  LR+ R  MVQT+ QY F Y  + EYL
Sbjct:  334 NKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYI----------DGYMSKKAFIATQAPIPD-------TIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSI------GNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGSPDSGGGLIDLIGQVQRWQQKCGVQLTAVHCSAGVGRTGVFCAVSILIER-LKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYL 568          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ptprq (protein tyrosine phosphatase receptor type Q [Source:NCBI gene;Acc:101163323])

HSP 1 Score: 199.904 bits (507), Expect = 4.719e-51
Identity = 178/651 (27.34%), Postives = 277/651 (42.55%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNY-WLTCKNESVIYNDNI------TSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSP--------PKPKRALKRNTNPKANWQNEE-YIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVS--EA----TNTAITHLL--------------PMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLL-----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTT-SEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            P   ++   + +    +  +++PP E NG I +Y  L  + E +I N ++       +T     E ++    Y+ Q+SA    G+      F I      P  +     P AM          +    +  P   +S++ G I    ++++E+ +                   E IT     + +R +P          P  ++K+      +++ EE Y++G N   L  N +DH  NGPLK  T+Y+  FRA    G  T        +V       G  +     I L + + F +  K     S  EA    T   +  L+              P++ KS     F ++ E +  + N +  ++F E+ +L   L      +    N +KNRF NIKPY +NRVKLL     A +D+INAS +              C N +IATQGP+         TV DFWRMI E     I  LT+  E G+ +C +YWP E N+ +T +S+     V   +  D++I   R   V      I V   +  +W +HG P + S F+ F  A R  R  N  I VHCSAGVGRTG FI +D  +  + ++ + ++IY  +  LR  R  MVQ  +QY F++    E L   G
Sbjct: 1444 PPKNVNVTAIPEEVKSVTVSFSPPEEPNGIITDYVALVYEKEKLIKNISLRIIQTENNTLTADVEGLKGGHNYSIQISAKNGAGWSPLSQHFQITTGIKAP--SKPTQTPQAMLGNGGVAMVTHKTITVRKPACFYSDDNGPIAKIQVIVAESGDQ------------------ENITNWRSAFYLRPAPYLTDEGFYNPPCSSVKKTAAVNTHFRGEEGYVIGGNNACLEQNNTDHFCNGPLKPNTVYVFKFRATNIRGQYT-------DSVYSEHVRTGTPIGSETQIILGVLLSFFLHKKEGGTYSPREAEIIETKCKLDQLIAVADMELKQEKLNRPVNKKS-----FLQHVEDLCANDNSKFQEEFAELPKLLQDLATTDADL--PWNKSKNRFPNIKPYNNNRVKLLSEPGTAGSDFINASFVSG----------YLCPNEFIATQGPL-------PGTVADFWRMIWETGTRSIAMLTQCYEKGRIRCHKYWP-EDNKPMTVFSDILISKVSEEAFPDWTI---RTLKVEKHGHYILVKHFNYTSWPEHGVPESCSTFIKFVKAIRSHRHDNSTIAVHCSAGVGRTGVFIALDHLIQHV-RDHEFVDIYGLVAELRSERMCMVQNLAQYIFLHQCTLELLNNKG 2038          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ptprq (protein tyrosine phosphatase receptor type Q [Source:NCBI gene;Acc:101163323])

HSP 1 Score: 189.119 bits (479), Expect = 9.076e-48
Identity = 186/676 (27.51%), Postives = 288/676 (42.60%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNY-WLTCKNESVIYNDNI------TSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITL--PYSHFSNNGGTIQMFTLVISET----RNNIVGNASITSLQYQNVAYGECI-------TKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNN---LLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIE---RKTAVNKIST-----IVGVSVAV------FVIICLSIAIYF------------------------IIRYKRNKHVSEATNTAITH---LLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLL-----AKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTT-SEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAG 3995
            P   ++   + +    +  +++PP E NG I +Y  L  + E +I N ++       +T     E ++    Y+ Q+SA    G+      F I      P  +     P AM   N  VA   T   IT+  P   +S++ G I    ++++E+    + NI    S   L+       E          K T          +P+     +         E Y++G N   L  N +DH  NGPLK  T+Y+  FRA    G  T        R  + + + T     I+GV ++        +IIC+S+ ++                         +I     +   E  N  +++   L P++ KS     F ++ E +  + N +  ++F E+ +L   L      +    N +KNRF NIKPY +NRVKLL     A +D+INAS +              C N +IATQGP+         TV DFWRMI E     I  LT+  E G+ +C +YWP E N+ +T +S+     V   +  D++I   R   V      I V   +  +W +HG P + S F+ F  A R  R  N  I VHCSAGVGRTG FI +D  +  + ++ + ++IY  +  LR  R  MVQ  +QY F++    E L   G
Sbjct: 1333 PPKNVNVTAIPEEVKSVTVSFSPPEEPNGIITDYVALVYEKEKLIKNISLRIIQTENNTLTADVEGLKGGHNYSIQISAKNGAGWSPLSQHFQITTGIKAP--SKPTQTPQAMLG-NGGVA-MVTHKTITVRKPACFYSDDNGPIAKIQVIVAESGVRDQENITNWRSAFYLRPAPYLTDEGFYNPPCSSVKKTAAVNTHFRGGQPESGDGSSLVRFNQTTEEGYVIGGNNACLEQNNTDHFCNGPLKPNTVYVFKFRATNIRGQYTDSVYSEHVRTASADGLLTREEQIILGVLLSFFLALFFIIIICVSVKLHQHKKEGGTYSPREAEIIETKCKLDQLIAVADMELKQEKLNRLLSYRKSLKPVNKKS-----FLQHVEDLCANDNSKFQEEFAELPKLLQDLATTDADL--PWNKSKNRFPNIKPYNNNRVKLLSEPGTAGSDFINASFVSG----------YLCPNEFIATQGPL-------PGTVADFWRMIWETGTRSIAMLTQCYEKGRIRCHKYWP-EDNKPMTVFSDILISKVSEEAFPDWTI---RTLKVEKHGHYILVKHFNYTSWPEHGVPESCSTFIKFVKAIRSHRHDNSTIAVHCSAGVGRTGVFIALDHLIQHV-RDHEFVDIYGLVAELRSERMCMVQNLAQYIFLHQCTLELLNNKG 1975          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ENSORLT00000023638.2 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 181.415 bits (459), Expect = 1.883e-45
Identity = 176/677 (26.00%), Postives = 286/677 (42.25%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNE---SVIYN----DNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRN----------------NIVGNASITSLQ--YQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGN----KSDHNS--NGPLKSGTLYIIGFRAYT-----------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSE--------------ATNTAITHLLPMDSKSPAA-HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEK---EISVTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            P  VL   C  QS T I C+W PP        +Y + C ++   +V+Y+     + TS  +T  +      +Y   +SA T+          +I  P A+P    +      +S  +I           +   S FS+  G I+ FT+V++E++                 + + N+SI S Q  Y +    E +  N  V+ I L                          G   LG      SD N   +GPLK  T Y +  RA+T                 +  ++++  +    ++N +  I G+S  +F+I  + +    ++  +R   V E              +T T +       + SP     F  ++  ++ DS+  L +++ ++K++         ++    N  KNR++NI PY   RVKL   +D     YINAS I   +++ E          YIATQGP+   ++       DFW+M+ E NV  +V +T+  E G+ KC  YWP   +Q   YY +   + V+M S    S +  R F +  +E+      V Q H   W DHG P  +    +F+     Y      +   VVHCSAGVGR+GTFI++D  L + L   D ++IY  + +LR  R  MVQTE QY +++  + + L
Sbjct: 1037 PGRVLGLHCRPQSSTSISCSWTPP---EADFDSYNIECVHQDSRTVVYSRRTGKDSTSYVITQLDPHRHYTVYVKVISAGTTSSEVEDSIVTMIDRPPALPIGTRVSERSTVVSTCSI---------LFSFNCSWFSDTNGAIKFFTVVVTESKGVEDVLPDQYHPLPSYRDYISNSSIKSYQTSYFSSYCSESLDSNAHVFNISLGS------------------------GMEPLGGPCEPSSDLNQFCDGPLKPRTSYRLSIRAFTQLFHEDSKDIGTFSPLFTDTYLSLPIVTETESLNGV--IGGISAGLFLIAVVVVITALLVCRRRVGRVGEERPVFGMSQRRERLSTGTQLGIRGNRRTSSPIRIMNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSALL--PENRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP--FDQDPLYYGD---LIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQ-LDVRDTVDIYGAVFDLRLHRSHMVQTEGQYSYLHHCVRDVL 1650          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ENSORLT00000023642.2 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 179.874 bits (455), Expect = 6.105e-45
Identity = 175/676 (25.89%), Postives = 285/676 (42.16%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNE---SVIYN----DNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRN----------------NIVGNASITSLQ--YQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSN------GPLKSGTLYIIGFRAYT-----------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVI-ICLSIAIYFIIRYK------------RNKHVSEATNTAITHLLPMDSKSPAA-HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEK---EISVTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYL 3983
            P  VL   C  QS T I C+W PP        +Y + C ++   +V+Y+     + TS  +T  +      +Y   +SA T+          +I  P A+P    +      +S  +I           +   S FS+  G I+ FT+V++E++                 + + N+SI S Q  Y +    E +  N  V+ I L                          G   LG   + +S+      GPLK  T Y +  RA+T                 +  ++++  +    ++N +  I G+S  +F+I + + I    + R +            R + +S  T   I         SP     F  ++  ++ DS+  L +++ ++K++         ++    N  KNR++NI PY   RVKL   +D     YINAS I   +++ E          YIATQGP+   ++       DFW+M+ E NV  +V +T+  E G+ KC  YWP   +Q   YY +   + V+M S    S +  R F +  +E+      V Q H   W DHG P  +    +F+     Y      +   VVHCSAGVGR+GTFI++D  L + L   D ++IY  + +LR  R  MVQTE QY +++  + + L
Sbjct: 1245 PGRVLGLHCRPQSSTSISCSWTPP---EADFDSYNIECVHQDSRTVVYSRRTGKDSTSYVITQLDPHRHYTVYVKVISAGTTSSEVEDSIVTMIDRPPALPIGTRVSERSTVVSTCSI---------LFSFNCSWFSDTNGAIKFFTVVVTESKGVEDVLPDQYHPLPSYRDYISNSSIKSYQTSYFSSYCSESLDSNAHVFNISLGS------------------------GMEPLGGPCEPSSDLNQFCDGPLKPRTSYRLSIRAFTQLFHEDSKDIGTFSPLFTDTYLSLPIVTETESLNGV--IGGISAGLFLIAVVVVITALLVCRRRVGRERPVFGMSQRRERLSTGTQLGI-------RGSPIRIMNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSALL--PENRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP--FDQDPLYYGD---LIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQ-LDVRDTVDIYGAVFDLRLHRSHMVQTEGQYSYLHHCVRDVL 1850          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Match: ENSORLT00000038731.1 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 172.17 bits (435), Expect = 1.130e-42
Identity = 172/663 (25.94%), Postives = 278/663 (41.93%), Query Frame = 3
Query: 2178 PSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNE---SVIYN----DNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRN----------------NIVGNASITSLQ--YQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSN------GPLKSGTLYIIGFRAYT-----------------SAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSE--------------ATNTAITHLLPMDSKSPAA-HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKND-----YINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEK---EISVTQLHMLAWKDHGCPTTS----EFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTE 3941
            P  VL   C  QS T I C+W PP        +Y + C ++   +V+Y+     + TS  +T  +      +Y   +SA T+          +I  P A+P    +      +S  +I           +   S FS+  G I+ FT+V++E++                 + + N+SI S Q  Y +    E +  N  V+ I L                          G   LG   + +S+      GPLK  T Y +  RA+T                 +  ++++  +    ++N +  I G+S  +F+I  + +    ++  +R   V E              +T T     L +   SP     F  ++  ++ DS+  L +++ ++K++         ++    N  KNR++NI PY   RVKL   +D     YINAS I   +++ E          YIATQGP+   ++       DFW+M+ E NV  +V +T+  E G+ KC  YWP   +Q   YY +   + V+M S    S +  R F +  +E+      V Q H   W DHG P  +    +F+     Y      +   VVHCSAGVGR+GTFI++D  L + L   D ++IY  + +LR  R  MVQTE
Sbjct: 1145 PGRVLGLHCRPQSSTSISCSWTPP---EADFDSYNIECVHQDSRTVVYSRRTGKDSTSYVITQLDPHRHYTVYVKVISAGTTSSEVEDSIVTMIDRPPALPIGTRVSERSTVVSTCSI---------LFSFNCSWFSDTNGAIKFFTVVVTESKGVEDVLPDQYHPLPSYRDYISNSSIKSYQTSYFSSYCSESLDSNAHVFNISLGS------------------------GMEPLGGPCEPSSDLNQFCDGPLKPRTSYRLSIRAFTQLFHEDSKDIGTFSPLFTDTYLSLPIVTETESLNGV--IGGISAGLFLIAVVVVITALLVCRRRVGRVGEERPVFGMSQRRERLSTGTQFVVKLFLIISSPIRIMNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSALL--PENRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP--FDQDPLYYGD---LIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQ-LDVRDTVDIYGAVFDLRLHRSHMVQTE 1744          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005260.1 (SMESG000005260.1)

HSP 1 Score: 2647.46 bits (6861), Expect = 0.000e+0
Identity = 1303/1323 (98.49%), Postives = 1308/1323 (98.87%), Query Frame = 3
Query:  105 MVTVRFTPFTLLCSILLFYSAYSDNASTVNQNTSPSTLSSTETVQMKDIQQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKYDIQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYENPIFVE 4073
            MVTVRFTPF LLCSILLFYSAYSDNASTVNQNTS STLSSTETVQMKD QQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFN SNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDC PNISVPPWPDNSI NCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPP+NKTMEIIKYSIWIQRSDNNQCVLKTEMNC D FNNVSQSSHM++NITECYSI GLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCG GPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKY IQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPFSFKKNSSVFSKGNSLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYW+TCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKV DEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKN CVYEIRL PPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPA HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNRED+NLFRQSYENPIFVE
Sbjct:    1 MVTVRFTPFALLCSILLFYSAYSDNASTVNQNTSLSTLSSTETVQMKDNQQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNFSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCTPNISVPPWPDNSIINCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPENKTMEIIKYSIWIQRSDNNQCVLKTEMNCMDCFNNVSQSSHMNSNITECYSISGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGCGPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKYGIQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPFSFKKNSSVFSKGNSLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWITCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVTDEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNPCVYEIRLLPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAVHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDTNLFRQSYENPIFVE 1323          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005260.1 (SMESG000005260.1)

HSP 1 Score: 2565.42 bits (6648), Expect = 0.000e+0
Identity = 1260/1278 (98.59%), Postives = 1265/1278 (98.98%), Query Frame = 3
Query:  240 MKDIQQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKYDIQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPXXXXXXXXXXXXXXXLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDSNLFRQSYENPIFVE 4073
            MKD QQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFN SNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDC PNISVPPWPDNSI NCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPP+NKTMEIIKYSIWIQRSDNNQCVLKTEMNC D FNNVSQSSHM++NITECYSI GLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCG GPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKY IQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPFSFKKNSSVFSKGNSLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYW+TCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKV DEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKN CVYEIRL PPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPA HEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNRED+NLFRQSYENPIFVE
Sbjct:    1 MKDNQQTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSESSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNFSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCTPNISVPPWPDNSIINCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPENKTMEIIKYSIWIQRSDNNQCVLKTEMNCMDCFNNVSQSSHMNSNITECYSISGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGCGPISNISVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKYGIQVYNGTFSYKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSFVAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEMRNLKYATPYTIKVTPFSFKKNSSVFSKGNSLDQVAITGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWITCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVTDEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNPCVYEIRLLPPKPKRALKRNTNPKANWQNEEYIVGNNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPAVHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNREDTNLFRQSYENPIFVE 1278          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 310/648 (47.84%), Postives = 414/648 (63.89%), Query Frame = 3
Query: 2163 TGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVG-NNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLS-----IAIYFIIRYKRNKHVSEATNTAITHLLPMDS-KSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENE-CFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNR---EDSNLFRQSYENPIFVE 4073
            T + +   V +F C N S+  I C+W  P + NG IL+Y +TCK  SV++N  +T T + I+  ++ DILY  ++SASTS+G G  ++  + I PS  P + N   IPD +      V D   Q A+TLPY+HF+N+ G I+ FTLVIS   +    N++IT   Y ++                +  P+P   + R     + WQ+  +++G      N S +  NGPL S T YIIGFR YT+AGF T G I  +TA+N       + V  F+ + LS      A YF  RY+R              + P D+ KSP    FH ++EFMK+DSNGRL+D F++IK+   +LE Q V++F+ GN  KNR+ NIKPY+HNRVKL   +DYINAS+IC  HW ++     C C++ YIATQGP+GE+REPK  T+GDFWRM+LENNVC+IVNLTR EE+GKEKCSQYWP + N +I + S DD + V M +S + SIF ERV  VSM++ E +V QLHM +W DH CPTTS+F+ FY+AY +++  ++AI+VHCSAGVGRTG+FILIDEELSRI K  D++EIYN L NLRKCRCQMVQTESQYCFIY++IHE L+Q GL ++P  +R     S    QSY NPIF E
Sbjct:  915 TNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL----------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINW-----AILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1541          

HSP 2 Score: 373.629 bits (958), Expect = 4.502e-107
Identity = 206/442 (46.61%), Postives = 266/442 (60.18%), Query Frame = 3
Query:  465 GVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYG---CYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPH-QIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQSIVDK-SQIKIVWSYP-------IVHTINYKYDIQVYNGTFS 1754
            G + NLS +S+FP  PL+I+WE P   NGEIVQY + V KT  N +CVLTM LNCTDC+ N+SVP +PD     CY ING  FNS+N+ F + + D +I PYT Y I+V + N +GWGNL S   +TSQY SGPV   S+T  +P   + I W  P   NG+IVQYFIWV++ N +CVLTMS+NCTDCK N+SVP  P+NS +NC   +G  FN   +  S+ I D KILP   Y +NIR LNGYGWGN +          S  I NLSV  SFP  PL+I W+PP     EI++Y IW+Q + NN+CVL    NCTD  NN+S  +  D +   CY+I GL FNS +  FS+ I D  I P + Y +NVR L   GWG  S+ ++ T QY   PV+N        + I   W +P       + +TI  K    V+N T +
Sbjct:  531 GSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQKT--NNECVLTMSLNCTDCKNNLSVPAMPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFIWVQNTNNECVLTMSLNCTDCKNNLSVPRIPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQNT-NNECVLTVSFNCTDCKNNLSVPAMPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLT 969          

HSP 3 Score: 369.392 bits (947), Expect = 9.764e-106
Identity = 196/416 (47.12%), Postives = 258/416 (62.02%), Query Frame = 3
Query:  465 GVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPH-QIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQ--SIVDKSQIKIVWSYPIV 1703
            G V+NLS +S FPL PL+I+W  P   NGEIVQY + V KT  N +CVLTM LNCTDC+  +S+P      CY ING  FNS+++ F + + D +I  YT Y I++ + N +GWGNL S   +T+QY SGPV   ++   +P   + I W  P   NG+IVQYFIWV++ N +CVLTMS+NCTDCK N+SVP  P+NS +NC   +G  FN   +  S+ I D KILP   Y +NIR LNGYGWGN +          S  I NLSV  SFP  PL+I W+PP     EI++Y IW+Q++ NN+CVL   +NCTD  NN+S  +  D +   CY+I GL FNS +  FS+ I D  I P + Y +NVR L   GWG +S+ ++ T QY   PVTNL   S      + I+WS P+V
Sbjct:  274 GPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLIWVQKT--NNECVLTMSLNCTDCKNKISMPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNTNNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQKT-NNECVLTMSLNCTDCKNNLSVPAMPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVV 686          

HSP 4 Score: 355.14 bits (910), Expect = 7.007e-101
Identity = 189/419 (45.11%), Postives = 255/419 (60.86%), Query Frame = 3
Query:  465 GVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYG---CYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPH-QIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQ--SIVDKSQIKIVWSYPIV 1703
            G V+N++ +S+FP  PL+I+W  P   NGEIVQY++ V  T  N +CVLTM LNCTDC+ N+SVP +P+     CY ING  FNS+N+ F + + D +I PYT Y I++ + N +GWGN  S   +T QYTSG +   S+   +P   + I W  P   NG+IVQY IWV+  N +CVLTMS+NCTDCK N+SVP  PDNS ++C   +G  FN   +  S+ I D KILP   Y +N+R LNGYGWGN++      S  +S P++NLSV  SFP  PL+I W PP     EI++Y IW+Q + NN+CVL   +NCTD  NN+S     + +   CY+I GL FNS +  FS+ I D  I P + Y +N+R L   GWG  S+ ++ T QY    + NL   S      + I W  P V
Sbjct:  401 GPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNT--NNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQKTNNECVLTMSLNCTDCKNNLSVPAMPDNSTDSCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNLSSKTIQTSQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFIWVQNT-NNECVLTMSLNCTDCKNNLSVPRIPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGV 816          

HSP 5 Score: 281.182 bits (718), Expect = 8.937e-77
Identity = 161/421 (38.24%), Postives = 231/421 (54.87%), Query Frame = 3
Query:  471 VSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSV--PYLPD---YGCYQINGPT--FNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYP-HQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQ--SIVDKSQIKIVWSYPIV 1703
            V NL+ +S + ++ L I W+RP    G I+ Y V +     +  C+    L+C+DC+++       L D     C QIN  +   +++++   +   D  ++P T Y +   A N FGWG+  S+   T Q+ SGPV   S+T ++P   + I W  P   NG+IVQY IWV+  N +CVLTMS+NCTDCK  IS+P   DNS N C   +G  FN   +  S+ I D KIL    Y +NIR LNGYGWGN++      +  +S P++N++V  SFP  PL+I W PP     EI++Y IW+Q + NN+CVL   +NCTD  NN+S     + +   CY+I GL FNS +  FS+ I D  I P + Y +N+R L   GWG  S+ ++ T QY    + NL   S      + I W  P V
Sbjct:  140 VQNLNGTSKWGVNNLLIEWDRPSAIGGTILAYLVTIGGQLNDSVCIKRWLLSCSDCQESAQAIGQSLQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLIWVQKTNNECVLTMSLNCTDCKNKISMP---DNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNT-NNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGV 556          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 310/648 (47.84%), Postives = 414/648 (63.89%), Query Frame = 3
Query: 2163 TGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVG-NNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLS-----IAIYFIIRYKRNKHVSEATNTAITHLLPMDS-KSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENE-CFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNR---EDSNLFRQSYENPIFVE 4073
            T + +   V +F C N S+  I C+W  P + NG IL+Y +TCK  SV++N  +T T + I+  ++ DILY  ++SASTS+G G  ++  + I PS  P + N   IPD +      V D   Q A+TLPY+HF+N+ G I+ FTLVIS   +    N++IT   Y ++                +  P+P   + R     + WQ+  +++G      N S +  NGPL S T YIIGFR YT+AGF T G I  +TA+N       + V  F+ + LS      A YF  RY+R              + P D+ KSP    FH ++EFMK+DSNGRL+D F++IK+   +LE Q V++F+ GN  KNR+ NIKPY+HNRVKL   +DYINAS+IC  HW ++     C C++ YIATQGP+GE+REPK  T+GDFWRM+LENNVC+IVNLTR EE+GKEKCSQYWP + N +I + S DD + V M +S + SIF ERV  VSM++ E +V QLHM +W DH CPTTS+F+ FY+AY +++  ++AI+VHCSAGVGRTG+FILIDEELSRI K  D++EIYN L NLRKCRCQMVQTESQYCFIY++IHE L+Q GL ++P  +R     S    QSY NPIF E
Sbjct:  785 TNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL----------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAINW-----AILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 1411          

HSP 2 Score: 361.303 bits (926), Expect = 1.761e-103
Identity = 199/442 (45.02%), Postives = 264/442 (59.73%), Query Frame = 3
Query:  465 GVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYG---CYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPH-QIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQSIVDK-SQIKIVWSYP-------IVHTINYKYDIQVYNGTFS 1754
            G V+N++ +S+FP  PL+I+W  P   NGEIVQY++ V  T  N +CVLTM LNCTDC+ N+SVP +P+     CY ING  FNS+N+ F + + D +I PYT Y I++ + N +GWGN  S   +T QY SGPV   S+T  +P   + I W  P   NG+IVQYFIWV++ N +CVLTMS+NCTDCK N+SVP  P+NS +NC   +G  FN   +  S+ I D KILP   Y +NIR LNGYGWGN +          S  I NLSV  SFP  PL+I W+PP     EI++Y IW+Q + NN+CVL    NCTD  NN+S  +  D +   CY+I GL FNS +  FS+ I D  I P + Y +NVR L   GWG  S+ ++ T QY   PV+N        + I   W +P       + +TI  K    V+N T +
Sbjct:  401 GPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNT--NNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFIWVQNTNNECVLTMSLNCTDCKNNLSVPRIPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQNT-NNECVLTVSFNCTDCKNNLSVPAMPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLT 839          

HSP 3 Score: 354.755 bits (909), Expect = 3.810e-101
Identity = 190/416 (45.67%), Postives = 252/416 (60.58%), Query Frame = 3
Query:  465 GVVSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPH-QIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQ--SIVDKSQIKIVWSYPIV 1703
            G V+NLS +S FPL PL+I+W  P   NGEIVQY + V KT  N +CVLTM LNCTDC+  +S+P      CY ING  FNS+++ F + + D +I  YT Y I++ + N +GWGNL S   +T+QY SGPV   ++   +P   + I W  P   NG+IVQYFIWV++ N +CVLTMS+NCTDCK N+SVP  P+NS +NC   +G  FN   +  S+ I D KILP   Y +NIR LNGYGWGN +         +S P++NLSV  SFP  PL+I W PP     EI++Y IW+Q + NN+CVL   +NCTD  NN+S     + +   CY+I GL FNS +  FS+ I D  I P + Y +N+R L   GWG  S+ ++ T QY    + NL   S      + I W  P V
Sbjct:  274 GPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLIWVQKT--NNECVLTMSLNCTDCKNKISMPDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNTNNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYISGPVTNLSVTSSFPSFPLSIIWSPPVVSNGEIVQYFIWVQNT-NNECVLTMSLNCTDCKNNLSVPRIPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYTSGSIMNLSVASSFPSFPLSITWEPPGV 686          

HSP 4 Score: 290.812 bits (743), Expect = 6.153e-80
Identity = 165/421 (39.19%), Postives = 236/421 (56.06%), Query Frame = 3
Query:  471 VSNLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSV--PYLPD---YGCYQINGPT--FNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYP-HQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQ--SIVDKSQIKIVWSYPIV 1703
            V NL+ +S + ++ L I W+RP    G I+ Y V +     +  C+    L+C+DC+++       L D     C QIN  +   +++++   +   D  ++P T Y +   A N FGWG+  S+   T Q+ SGPV   S+T ++P   + I W  P   NG+IVQY IWV+  N +CVLTMS+NCTDCK  IS+   PDNS N C   +G  FN   +  S+ I D KIL    Y +NIR LNGYGWGN++      +  +S P++N++V  SFP  PL+I W PP     EI++Y IW+Q + NN+CVL   +NCTD  NN+S     + +   CY+I GL FNS +  FS+ I D  I P + Y +N+R L   GWG  S+ ++ T QY   PVTNL   S      + I+WS P+V
Sbjct:  140 VQNLNGTSKWGVNNLLIEWDRPSAIGGTILAYLVTIGGQLNDSVCIKRWLLSCSDCQESAQAIGQSLQDPSVRNCSQINNASSFVSTADKHLSLATNDSDVKPATSYLVIATALNEFGWGDAQSISLLTDQFISGPVTNLSVTSLFPLSPLSITWAPPGVTNGEIVQYLIWVQKTNNECVLTMSLNCTDCKNKISM---PDNSTNACYTINGLNFNSNDKSFSMTINDGKILSYTNYTINIRSLNGYGWGNLSSKTIKTNQYISGPVTNVTVNSSFPSFPLSITWAPPGVTNGEIVQYFIWVQNT-NNECVLTMSLNCTDCKNNLSVPRMPENSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINIRSLNGYGWGNSSSKTIQTDQYISGPVTNLSVTSSFPSFPLSIIWSPPVV 556          
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 310/648 (47.84%), Postives = 414/648 (63.89%), Query Frame = 3
Query: 2163 TGEGVPSSVLSFKCVNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEWVETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKVNIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSLQYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVG-NNLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKISTIVGVSVAVFVIICLS-----IAIYFIIRYKRNKHVSEATNTAITHLLPMDS-KSPAAHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNRFSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENE-CFCSNIYIATQGPIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEINQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAWKDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELSRILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIRIPRDNR---EDSNLFRQSYENPIFVE 4073
            T + +   V +F C N S+  I C+W  P + NG IL+Y +TCK  SV++N  +T T + I+  ++ DILY  ++SASTS+G G  ++  + I PS  P + N   IPD +      V D   Q A+TLPY+HF+N+ G I+ FTLVIS   +    N++IT   Y ++                +  P+P   + R     + WQ+  +++G      N S +  NGPL S T YIIGFR YT+AGF T G I  +TA+N       + V  F+ + LS      A YF  RY+R              + P D+ KSP    FH ++EFMK+DSNGRL+D F++IK+   +LE Q V++F+ GN  KNR+ NIKPY+HNRVKL   +DYINAS+IC  HW ++     C C++ YIATQGP+GE+REPK  T+GDFWRM+LENNVC+IVNLTR EE+GKEKCSQYWP + N +I + S DD + V M +S + SIF ERV  VSM++ E +V QLHM +W DH CPTTS+F+ FY+AY +++  ++AI+VHCSAGVGRTG+FILIDEELSRI K  D++EIYN L NLRKCRCQMVQTESQYCFIY++IHE L+Q GL ++P  +R     S    QSY NPIF E
Sbjct:  122 TNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLTDTWINITSSIKPDILYILEISASTSIGAGEKIYFNITISPSPFPFVINASKIPDVLRNSIATVNDSRYQLAVTLPYNHFNNDLGIIRKFTLVISTNDDIYPRNSTITKSSYSDL----------------ILLPEPGSQITRKKRAISEWQSRPFVIGATQSCSNSSSNTCNGPLLSATAYIIGFRVYTTAGFTTEGVITVRTAIN-----WAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFAE 748          

HSP 2 Score: 139.428 bits (350), Expect = 2.556e-33
Identity = 76/163 (46.63%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  477 NLSTSSAFPLHPLNISWERPQTPNGEIVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYG---CYQINGPTFNSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSGPVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFI 956
            NLS +S+FP  PL+I+WE P   NGEIVQY + V  T  N +CVLT+  NCTDC+ N+SVP +PD     CY ING  FNS+N+ F + + D +I PYT Y I+V + N +GWGN  S   +T+QY SGPV   +      + I   W  P+  NG I+ Y I
Sbjct:    2 NLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQNT--NNECVLTVSFNCTDCKNNLSVPAMPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTI 162          

HSP 3 Score: 128.257 bits (321), Expect = 8.950e-30
Identity = 64/150 (42.67%), Postives = 87/150 (58.00%), Query Frame = 3
Query:  897 IHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVNCTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCITYRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSI 1346
            + I W  P   NG+IVQY IWV++ N +CVLT+S NCTDCK N+SVP  PDNS +NC   +G  FN   +  S+ I D KILP   Y +N+R LNGYGWGN +      +  +S P+SN +  ++     +   W  P      I+ Y+I
Sbjct:   14 LSITWEPPGVANGEIVQYLIWVQNTNNECVLTVSFNCTDCKNNLSVPAMPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNC-YNSSFNSIFCSWGFPSKANGVILSYTI 162          

HSP 4 Score: 118.242 bits (295), Expect = 1.396e-26
Identity = 70/176 (39.77%), Postives = 95/176 (53.98%), Query Frame = 3
Query: 1251 NLSVIFSFPLAPLTIRWQPPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNITECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNISVTTPQYQPDPVTNLQSIVDK-SQIKIVWSYP-------IVHTINYKYDIQVYNGTFS 1754
            NLSV  SFP  PL+I W+PP     EI++Y IW+Q + NN+CVL    NCTD  NN+S  +  D +   CY+I GL FNS +  FS+ I D  I P + Y +NVR L   GWG  S+ ++ T QY   PV+N        + I   W +P       + +TI  K    V+N T +
Sbjct:    2 NLSVASSFPSFPLSITWEPPGVANGEIVQYLIWVQNT-NNECVLTVSFNCTDCKNNLSVPAMPDNSTDNCYTINGLNFNSNNKSFSMTINDGKILPYTNYTINVRSLNGYGWGNSSSKTIQTNQYISGPVSNFNCYNSSFNSIFCSWGFPSKANGVILSYTITCKASSVVFNKTLT 176          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRQ9.066e-5126.91protein tyrosine phosphatase receptor type Q [Sour... [more]
PTPRQ1.307e-5026.81protein tyrosine phosphatase receptor type Q [Sour... [more]
PTPRS1.100e-4233.86protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRA1.390e-4131.08protein tyrosine phosphatase receptor type A [Sour... [more]
PTPRA1.390e-4131.08protein tyrosine phosphatase receptor type A [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dep-17.923e-3732.04Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
Y71G12B.317.610e-3635.55Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
dep-18.787e-3532.04Receptor-type tyrosine-protein phosphatase dep-1 ... [more]
ptp-43.036e-3433.46Tyrosine-protein phosphatase 4 [Source:UniProtKB/... [more]
ptp-43.112e-3433.46Tyrosine-protein phosphatase 4 [Source:UniProtKB/... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp10D2.127e-5027.30gene:FBgn0004370 transcript:FBtr0073522[more]
Ptp10D2.879e-5027.16gene:FBgn0004370 transcript:FBtr0273235[more]
Ptp10D2.879e-5027.16gene:FBgn0004370 transcript:FBtr0331406[more]
Ptp10D7.658e-5027.30gene:FBgn0004370 transcript:FBtr0330393[more]
Ptp10D7.658e-5027.30gene:FBgn0004370 transcript:FBtr0330392[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprq1.034e-4526.95protein tyrosine phosphatase receptor type Q [Sour... [more]
ptprjb.14.469e-4235.64protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprsa7.552e-4233.78protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprjb.22.249e-4035.88protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprsa3.225e-4032.65protein tyrosine phosphatase receptor type Sa [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprb3.121e-5227.83protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb4.596e-5227.83protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb5.863e-5228.47protein tyrosine phosphatase, receptor type B [Sou... [more]
ptprb6.002e-5227.97protein tyrosine phosphatase, receptor type B [Sou... [more]
nars26.517e-5127.29asparaginyl-tRNA synthetase 2, mitochondrial [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprq5.199e-4826.25protein tyrosine phosphatase, receptor type, Q [So... [more]
Ptpra4.991e-4231.35protein tyrosine phosphatase, receptor type, A [So... [more]
Ptprj1.072e-4130.96protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.152e-4130.96protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprs1.966e-4133.77protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UMZ3|PTPRQ_HUMAN4.172e-5026.91Phosphatidylinositol phosphatase PTPRQ OS=Homo sap... [more]
sp|O88488|PTPRQ_RAT6.745e-4926.81Phosphatidylinositol phosphatase PTPRQ OS=Rattus n... [more]
sp|P35992|PTP10_DROME7.676e-4927.30Tyrosine-protein phosphatase 10D OS=Drosophila mel... [more]
sp|P0C5E4|PTPRQ_MOUSE3.636e-4726.25Phosphatidylinositol phosphatase PTPRQ OS=Mus musc... [more]
sp|P18433|PTPRA_HUMAN8.180e-4130.91Receptor-type tyrosine-protein phosphatase alpha O... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HMA11.012e-7024.00receptor-type tyrosine-protein phosphatase eta iso... [more]
A0A1S3HM825.178e-6523.25receptor-type tyrosine-protein phosphatase eta iso... [more]
A0A1S3HQ931.318e-6223.12receptor-type tyrosine-protein phosphatase eta iso... [more]
A0A1J1IKK81.507e-5429.51CLUMA_CG014018, isoform A OS=Clunio marinus OX=568... [more]
A0A087TPC71.142e-5328.40Phosphotidylinositol phosphatase PTPRQ (Fragment) ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra2.882e-4233.60protein tyrosine phosphatase receptor type A [Sour... [more]
ptprb3.321e-4232.65receptor-type tyrosine-protein phosphatase beta [S... [more]
ptprb3.941e-4232.65receptor-type tyrosine-protein phosphatase beta [S... [more]
ptpra4.055e-4233.60protein tyrosine phosphatase receptor type A [Sour... [more]
PTPRD5.537e-4234.45protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra2.667e-3930.00protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000008162.11.629e-3636.52pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ENSPMAT00000000174.17.956e-3531.42pep scaffold:Pmarinus_7.0:GL479793:24808:47889:1 g... [more]
ENSPMAT00000003525.11.944e-3438.25pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
ENSPMAT00000006520.11.473e-3232.62pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP11.156e-2631.78Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP33.962e-833.07Phosphotyrosine-specific protein phosphatase; invo... [more]
PTP23.582e-629.58Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489499.406e-3937.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318051.692e-3833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383041.813e-3834.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438547.556e-3838.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453828.528e-3839.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprq4.719e-5127.34protein tyrosine phosphatase receptor type Q [Sour... [more]
ptprq9.076e-4827.51protein tyrosine phosphatase receptor type Q [Sour... [more]
ENSORLT00000023638.21.883e-4526.00receptor-type tyrosine-protein phosphatase beta [S... [more]
ENSORLT00000023642.26.105e-4525.89receptor-type tyrosine-protein phosphatase beta [S... [more]
ENSORLT00000038731.11.130e-4225.94receptor-type tyrosine-protein phosphatase beta [S... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005260.10.000e+098.49SMESG000005260.1[more]
SMESG000005260.10.000e+098.59SMESG000005260.1[more]
SMESG000005237.14.502e-10747.84SMESG000005237.1[more]
SMESG000005237.11.761e-10347.84SMESG000005237.1[more]
SMESG000005237.12.556e-3347.84SMESG000005237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034139 ID=SMED30034139|Name=Receptor-type tyrosine-protein phosphatase beta|organism=Schmidtea mediterranea sexual|type=transcript|length=4156bp
CATTTGGATTTGTTCATTTTATCTTTATTTTTATCATTTGATCAGCTTTA
ATTTTGGATTATTTTTAATATTATTGACTTTATTAATTAATTTACTTAAT
CCTCATGGTCACGGTGAGATTCACGCCTTTTACTCTCCTTTGTTCGATCC
TTTTATTTTATTCCGCATACTCTGATAATGCATCAACAGTCAACCAAAAT
ACCTCCCCTTCAACGCTTTCTTCTACAGAAACCGTTCAAATGAAGGACAT
TCAACAGACAAATATCTCATCATCAGAGATTTTACAAACTTATACATATC
AATCTTCAGAAAGTAAAACCACAGACATTCGATCCTCCCCTATGGAAATC
AGTTCCAGGTTTACACCAATGTCAACAGTGGTCACAGAACCAGCTGGGTC
TGAAAGTAGTATTCCAATAAAAACTTTCCCAACTTACCAATCGACTGTGA
CTTATCTATATCCAGGAGTGGTTTCCAATTTATCCACCAGCAGCGCGTTT
CCTTTGCATCCGTTGAACATTTCTTGGGAGCGACCACAGACTCCGAATGG
AGAAATTGTCCAGTATTATGTTCAGGTATTTAAAACTCCCATGAACAGGC
AATGTGTATTGACAATGTTTTTAAATTGCACTGACTGTAGAAAGAATGTA
TCAGTTCCTTATTTGCCAGATTATGGATGTTACCAAATAAATGGACCGAC
GTTCAATTCCAGCAATCAAAGATTTGGGATCATAGTGAAAGATGAAAGGA
TTCGACCTTATACGTATTATGGCATAAGTGTAAATGCAGCAAACGTTTTC
GGGTGGGGCAACTTAGTTAGCGTTTATCAAGAAACATCTCAATATACAAG
TGGACCAGTCGACATCCAGTCAATTACCGGTATCTATCCTCACCAAATTC
ATATCAAATGGATGAACCCCACCTTTGAGAATGGACAAATTGTCCAATAT
TTTATCTGGGTGGAGGATGTGAATGGCCAATGCGTGTTGACAATGTCAGT
GAATTGTACTGACTGTAAACCTAATATATCAGTTCCGCCATGGCCAGATA
ATAGCATTAATAACTGCACTGCCAAATCTGGGGGCCAATTTAATGTTACT
AAACAATTGTCTTCAATAGTGATCACCGATGACAAAATTCTCCCATGCAT
CACATACAGAGTCAACATAAGGCTCCTGAATGGATACGGATGGGGCAACG
TAACCGGAAATTATACATCAATATCACCAAATGTCAGTGAACCAATTTCA
AATTTGTCAGTCATATTTTCATTTCCTTTGGCACCCTTGACAATCAGATG
GCAGCCCCCTAAGAATAAAACTATGGAGATTATTAAATATTCTATTTGGA
TACAGAGATCAGATAACAATCAGTGCGTTTTAAAAACGGAAATGAACTGT
ACGGATGTCTTTAACAACGTATCCCAGTCATCACATATGGATACCAACAT
TACTGAATGTTATTCCATTCCAGGACTAAAGTTTAACTCTACGGATGATA
TTTTCTCTCTAATAATAAGGGATTTAGCAATTCAACCAAAATCTAAATAT
GTTGTCAATGTGAGGCCCTTGACAATGTGTGGATGGGGTCCAATATCCAA
TATTTCTGTGACTACCCCTCAATACCAGCCTGATCCGGTGACAAATTTGC
AGTCAATTGTTGATAAGTCGCAGATCAAAATCGTCTGGAGCTATCCGATT
GTTCATACAATTAATTATAAATATGATATACAGGTGTATAACGGAACTTT
TTCCTACAAAGATGAACTCCGGGGCGGAAGTTATAACTTTTCTTCCGTTT
CCTTGGAATTTTGTACTTACTACACACTCTGTGTGATGGTCATCGATGAT
TACAAGGTGCCTAGCGTTACTCGCTGCATCTCAAATACGACGGGCTTGTC
ATTTGTTGCCATCAACAGTATATCATCATCAGTTACAGGAAATAATATTA
TATTGACATGGACGTTCGGAGAACAGTCTAACTGCTTGGTGCAGTTCAAT
GTAGCCACAACCGTACCGGAGAATATCAATGTCACTAACAACAAATACGA
AATGAGAAACCTAAAATATGCCACCCCGTACACGATAAAGGTCACACCAT
TCTCCTTTAAGAAAAATTCCAGTGTATTCTCTAAAGGAAACAGTCTAGAT
CAAGTTGCTATAACTGGTGAAGGAGTCCCAAGTTCAGTTTTAAGTTTCAA
ATGTGTTAACCAGTCATATACAGGGATCAAGTGCACCTGGGCACCTCCAG
TTGAGAAAAACGGGAAAATATTAAATTATTGGCTTACTTGTAAAAATGAA
TCGGTTATCTACAATGATAACATAACATCAACTACGGTGACTATTTCAGA
ATGGGTTGAAACAGACATATTGTACACTTGCCAGGTGAGTGCGTCGACAT
CTGTTGGGTATGGGGCTCCAGTTTTCTCTTTTTTGATAATAGTTCCTTCA
GCCGTTCCTGACATGAATAATATTGATATGATACCAGACGCTATGAGTAA
GGTGAATATCAAAGTGGCTGATGAGTATACTCAAGCCGCTATCACCTTAC
CATACAGTCATTTCTCCAACAACGGTGGCACTATTCAGATGTTCACATTA
GTTATATCAGAAACTAGAAATAATATTGTTGGAAATGCATCTATAACTTC
ATTGCAATATCAGAATGTCGCCTACGGCGAATGTATCACAAAGAACACTT
GCGTATATGAAATTCGACTTTCACCTCCAAAACCCAAAAGAGCCCTAAAG
AGAAACACTAATCCGAAAGCTAATTGGCAGAATGAAGAGTATATTGTTGG
TAACAACTTACTGGGTAACAAATCTGACCATAATTCCAACGGCCCTTTGA
AAAGTGGGACATTGTATATAATTGGCTTTCGAGCATACACCTCGGCAGGA
TTTGTAACTGTCGGTTTCATAGAAAGGAAAACTGCGGTTAATAAAATATC
CACTATCGTTGGGGTTTCAGTGGCAGTATTCGTGATCATTTGTCTCTCAA
TTGCCATTTATTTCATTATTAGATACAAGCGCAACAAGCATGTGTCAGAG
GCCACAAACACAGCCATAACCCATTTGTTGCCCATGGACAGCAAATCTCC
GGCCGCTCACGAATTCCACGAAAACTACGAATTCATGAAACAAGACTCGA
ATGGTCGACTGCTCGACGACTTCCGAGAAATCAAAGAGCTTGCAGTTAAA
TTAGAACGTCAAAAGGTGATCATGTTCACAGAGGGCAATGATGCCAAGAA
CCGGTTCAGCAACATAAAGCCATACAAGCACAACCGAGTCAAATTGCTGG
CAAAGAATGACTACATTAATGCCAGCAAAATATGTTCAGCACATTGGCAG
TCGGAAAAGGAGAATGAGTGCTTCTGTTCAAATATATACATTGCCACCCA
AGGACCGATTGGAGAGAACAGAGAACCGAAAGCTCAAACCGTAGGAGACT
TCTGGAGAATGATTCTGGAAAATAATGTTTGTGTTATTGTCAATTTAACA
AGGGTAGAGGAGCATGGCAAGGAGAAATGCAGTCAGTATTGGCCGACGGA
AATCAACCAAAAGATCACATATTACAGTGAAGATGATCCAATAAATGTCG
AAATGAACAGTTCCATGGATTACTCCATATTCGTAGAAAGAGTTTTCAAT
GTTTCAATGGATGAGAAAGAAATTTCTGTCACACAACTTCATATGCTTGC
ATGGAAGGACCACGGCTGTCCAACGACATCAGAATTTCTGGCATTCTATT
CAGCATACAGAAAGGCTCGACAGTCAAATCAAGCTATTGTTGTCCACTGC
AGTGCTGGAGTTGGGCGAACGGGAACATTTATACTGATTGATGAAGAGTT
ATCCAGAATATTGAAAGAAGATGATAGAATAGAAATTTATAATAATTTGC
TAAATTTAAGAAAATGTCGATGTCAAATGGTGCAAACAGAATCCCAATAC
TGCTTCATATACAGTGTCATCCACGAATATCTTGTCCAGGCTGGTCTCAT
CAGGATCCCGAGAGATAACAGGGAGGATTCAAATTTATTCAGACAGTCGT
ACGAAAATCCTATATTTGTAGAATAAGAAACCAAAAATCAATTTTTTGAA
AATAATTTATATATTTATTCAGTCTAGATTGAAATATATATTTTTGTTTA
AAACAA
back to top

protein sequence of SMED30034139-orf-1

>SMED30034139-orf-1 ID=SMED30034139-orf-1|Name=SMED30034139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1324bp
MVTVRFTPFTLLCSILLFYSAYSDNASTVNQNTSPSTLSSTETVQMKDIQ
QTNISSSEILQTYTYQSSESKTTDIRSSPMEISSRFTPMSTVVTEPAGSE
SSIPIKTFPTYQSTVTYLYPGVVSNLSTSSAFPLHPLNISWERPQTPNGE
IVQYYVQVFKTPMNRQCVLTMFLNCTDCRKNVSVPYLPDYGCYQINGPTF
NSSNQRFGIIVKDERIRPYTYYGISVNAANVFGWGNLVSVYQETSQYTSG
PVDIQSITGIYPHQIHIKWMNPTFENGQIVQYFIWVEDVNGQCVLTMSVN
CTDCKPNISVPPWPDNSINNCTAKSGGQFNVTKQLSSIVITDDKILPCIT
YRVNIRLLNGYGWGNVTGNYTSISPNVSEPISNLSVIFSFPLAPLTIRWQ
PPKNKTMEIIKYSIWIQRSDNNQCVLKTEMNCTDVFNNVSQSSHMDTNIT
ECYSIPGLKFNSTDDIFSLIIRDLAIQPKSKYVVNVRPLTMCGWGPISNI
SVTTPQYQPDPVTNLQSIVDKSQIKIVWSYPIVHTINYKYDIQVYNGTFS
YKDELRGGSYNFSSVSLEFCTYYTLCVMVIDDYKVPSVTRCISNTTGLSF
VAINSISSSVTGNNIILTWTFGEQSNCLVQFNVATTVPENINVTNNKYEM
RNLKYATPYTIKVTPFSFKKNSSVFSKGNSLDQVAITGEGVPSSVLSFKC
VNQSYTGIKCTWAPPVEKNGKILNYWLTCKNESVIYNDNITSTTVTISEW
VETDILYTCQVSASTSVGYGAPVFSFLIIVPSAVPDMNNIDMIPDAMSKV
NIKVADEYTQAAITLPYSHFSNNGGTIQMFTLVISETRNNIVGNASITSL
QYQNVAYGECITKNTCVYEIRLSPPKPKRALKRNTNPKANWQNEEYIVGN
NLLGNKSDHNSNGPLKSGTLYIIGFRAYTSAGFVTVGFIERKTAVNKIST
IVGVSVAVFVIICLSIAIYFIIRYKRNKHVSEATNTAITHLLPMDSKSPA
AHEFHENYEFMKQDSNGRLLDDFREIKELAVKLERQKVIMFTEGNDAKNR
FSNIKPYKHNRVKLLAKNDYINASKICSAHWQSEKENECFCSNIYIATQG
PIGENREPKAQTVGDFWRMILENNVCVIVNLTRVEEHGKEKCSQYWPTEI
NQKITYYSEDDPINVEMNSSMDYSIFVERVFNVSMDEKEISVTQLHMLAW
KDHGCPTTSEFLAFYSAYRKARQSNQAIVVHCSAGVGRTGTFILIDEELS
RILKEDDRIEIYNNLLNLRKCRCQMVQTESQYCFIYSVIHEYLVQAGLIR
IPRDNREDSNLFRQSYENPIFVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR000242PTPase_domain
IPR003961FN3_dom
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR013783Ig-like_fold
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0021510spinal cord development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0022038corpus callosum development
GO:0030517negative regulation of axon extension
GO:0032687negative regulation of interferon-alpha production
GO:0032688negative regulation of interferon-beta production
GO:0034164negative regulation of toll-like receptor 9 signaling pathway
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
GO:0048681negative regulation of axon regeneration
GO:0061000negative regulation of dendritic spine development
GO:0090557establishment of endothelial intestinal barrier
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
GO:0070062extracellular exosome
GO:0099061integral component of postsynaptic density membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 1102..1122
score: 36.61
coord: 1275..1285
score: 63.05
coord: 1069..1076
score: 70.59
coord: 1190..1207
score: 37.39
coord: 1259..1274
score: 24.01
coord: 1227..1245
score: 71.73
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 1018..1294
e-value: 1.0E-78
score: 277.5
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 1045..1290
e-value: 2.7E-60
score: 203.8
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1019..1292
score: 41.425
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 1191..1291
e-value: 1.2E-30
score: 117.8
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 598..673
e-value: 12.0
score: 10.7
coord: 692..770
e-value: 0.073
score: 22.2
coord: 120..235
e-value: 10.0
score: 11.4
coord: 377..495
e-value: 87.0
score: 3.3
coord: 509..587
e-value: 8.1
score: 12.3
coord: 249..364
e-value: 0.31
score: 20.1
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 122..223
score: 7.141
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 601..690
score: 6.486
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 250..344
score: 7.283
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 691..783
score: 12.876
IPR003961Fibronectin type IIICDDcd00063FN3coord: 692..775
e-value: 2.29848E-6
score: 45.1799
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 993..1297
e-value: 6.2E-79
score: 267.4
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1008..1294
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 394..510
e-value: 1.5E-7
score: 33.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 676..781
e-value: 6.4E-10
score: 41.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 134..243
e-value: 2.6E-6
score: 29.8
NoneNo IPR availablePANTHERPTHR19134:SF483PROTEIN TYROSINE PHOSPHATASE 4E, ISOFORM A-RELATEDcoord: 114..1293
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 114..1293
NoneNo IPR availableCDDcd00047PTPccoord: 1070..1286
e-value: 7.36744E-63
score: 210.605
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.758
NoneNo IPR availableTMHMMTMhelixcoord: 951..973
NoneNo IPR availableTMHMMTMhelixcoord: 917..939
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1230..1240
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1209..1283
score: 18.643
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 395..587
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 136..303
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 606..785
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 329..430