Coiled-coil domain-containing protein 96

Overview
NameCoiled-coil domain-containing protein 96
Smed IDSMED30034138
Length (bp)1263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 96 (SMED30034138) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 96 (SMED30034138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 96 (SMED30034138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 96 (SMED30034138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034138SMESG000050787.1 SmedASXL_012025SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034138SMESG000050787.1 dd_Smed_v4_11884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034138SMESG000050787.1 dd_Smed_v4_11884_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034138SMESG000050787.1 dd_Smed_v6_11884_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034138SMESG000050787.1 dd_Smed_v4_11884_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Human
Match: CCDC113 (coiled-coil domain containing 113 [Source:HGNC Symbol;Acc:HGNC:25002])

HSP 1 Score: 197.208 bits (500), Expect = 1.651e-58
Identity = 140/347 (40.35%), Postives = 224/347 (64.55%), Query Frame = 2
Query:  107 ELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            +L  L+E+    N  LK+E  MFEKY  ++E +    D   P  ++   +  + ++ + R+RSKSR+         + +QK E+ Q E+ + + ++   +  +E+ L  ++AI+EEA+IR SE+S+  +EF++D++K        I+ ++K +++ E+  R+RD + +KLRLKN +L+ Q+ K+ +QL+QKEE+ E LH+VDF+QLKIEN Q+LE IE +NQEL +LKL +G TLQVLN+YK KL   M     +  EI  R+EL ++I+ ET+QVE+++ KAE  N RLR+QL+++R P VM YV       DL K  ++  RKV+IA+M+L  H+K WN+++  N
Sbjct:   25 QLCGLVEELSYVNSALKTETEMFEKYYAKLEPR----DQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTA-DQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITN 366          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Human
Match: CCDC113 (coiled-coil domain containing 113 [Source:HGNC Symbol;Acc:HGNC:25002])

HSP 1 Score: 190.274 bits (482), Expect = 2.077e-56
Identity = 113/240 (47.08%), Postives = 169/240 (70.42%), Query Frame = 2
Query:  428 DTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            D  +AI+EEA+IR SE+S+  +EF++D++K        I+ ++K +++ E+  R+RD + +KLRLKN +L+ Q+ K+ +QL+QKEE+ E LH+VDF+QLKIEN Q+LE IE +NQEL +LKL +G TLQVLN+YK KL   M     +  EI  R+EL ++I+ ET+QVE+++ KAE  N RLR+QL+++R P VM YV       DL K  ++  RKV+IA+M+L  H+K WN+++  N
Sbjct:   73 DYAQAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITN 312          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Human
Match: CCDC113 (coiled-coil domain containing 113 [Source:HGNC Symbol;Acc:HGNC:25002])

HSP 1 Score: 50.447 bits (119), Expect = 1.026e-6
Identity = 48/166 (28.92%), Postives = 95/166 (57.23%), Query Frame = 2
Query:  107 ELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTL 604
            +L  L+E+    N  LK+E  MFEKY  ++E +    D   P  ++   +  + ++ + R+RSKSR+         + +QK E+ Q E+ + + ++   +  +E+ L  ++AI+EEA+IR SE+S+  +EF++D++K        I+ ++K +++ E+  R+RD +
Sbjct:   25 QLCGLVEELSYVNSALKTETEMFEKYYAKLEPR----DQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTA-DQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNM 185          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Fly
Match: CG13693 (gene:FBgn0031235 transcript:FBtr0078126)

HSP 1 Score: 63.929 bits (154), Expect = 9.952e-11
Identity = 41/138 (29.71%), Postives = 73/138 (52.90%), Query Frame = 2
Query:  695 VLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALD 1108
            +L  VDF++L I+ T+ + ++EEKN  +  LK + G+T   +   K+ +  L  +++ +    +       +++ E   V+    K  +T D LR QL DY  P+V +Y+    + + L K EK+L RK+ I  M L+
Sbjct:  294 ILTAVDFEKLIIKRTELVNQLEEKNIHMAGLKGVTGKTSLAMTEEKQAMMNLETEMRTVLNRTDEVTRAIQKLEKEVAAVQMHNTKDYVTLDELRAQLQDYEAPSVSEYIERKEEAHVLEKEEKMLQRKIYILNMKLN 431          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Zebrafish
Match: ccdc113 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:450041])

HSP 1 Score: 152.91 bits (385), Expect = 3.413e-42
Identity = 131/366 (35.79%), Postives = 217/366 (59.29%), Query Frame = 2
Query:   65 PELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGLL 1162
             E+ ++S +    ++L EL+   L+ N  L +E  +F++Y+ R++ +    +     +N S+E              K++     R   L+ EQKC +A+S  ++  ++++  KI SEK LD YKA +EEADI L+EI K R  F R++VK   +  +  + +EK +R+ E++++ +D LI+KL  KNS L   K K + QL+Q+EEM E +  +DF+ LK EN ++ ++++E+N + + LKL+A +TLQ LNS K+KL  L N+ + +  +   R +L  +I+ ET Q E+E++KAE  N +LR QL+D+ VP V+ Y+        L K  +   RKV+IA+MAL  + K W ++R A  AGL+
Sbjct:    2 AEMTEDSKSGTDRKQLVELVGLNLTSNAALNAEIDLFDRYISRLDLR--TFETVWKWQNLSTEKIPG---------RKAKVRTPGRQQLLTLEQKCVVAKSVYKKMIEDLKIAKIHSEKQLDNYKATLEEADIHLAEIKKERSHFKRNIVKELEDKKSMTMSAEKVMRYIEDKIKAKDILIEKLHRKNSALLTHKKKQQAQLRQQEEMAEGVTVLDFELLKFENIRFRKQLDEQNLKQVNLKLLAVKTLQTLNSNKEKLHILTNESEMLSSDTALRMKLLVKIEEETEQAEEERHKAEALNRKLRDQLADFHVPHVLQYIKLKESHGQLQKSVREWERKVEIAEMALKTYTKSWEKLRFAAGAGLV 356          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Xenopus
Match: gins3 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:548359])

HSP 1 Score: 204.142 bits (518), Expect = 1.171e-59
Identity = 160/348 (45.98%), Postives = 232/348 (66.67%), Query Frame = 2
Query:   53 ESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGIN-PITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIA 1093
            ESQ  E   +  +  + E+L  L  D       LK+E  M +K+  R++ K    D   P    +  +T + S++++R+RSKSR    +R L L+ +QKCE+ Q E+EE ++E  +N+  +EK L   KA +EEA+ R ++I K +YEF+RD+ K  I+   +  V  +K +R+ EE++R RD+L+DKLRLKN+ L+ QK K+KMQ+KQKEEMGEVLHEVDF+QLKIEN Q+LE+I+E+NQ+L++LKL AG TL VLN +KKKL T M +   +  EI+ R+E+  RI++E   VEQ++ KAE  N +LR+QL DYRVP V++Y+    DQ DL K  +I  RKV+IA
Sbjct:   25 ESQAGEEPLQYLSELSIEQLEILTRDTRDAVSILKAETDMLDKFHSRLDPK----DLVPPPTTDAVLSTLDFSQMRSRRRSKSRGQIPERLLSLTVDQKCELVQKELEESKEESLRNEENAEKDLQNLKATVEEAEFRSTDIKKSKYEFERDIGKAAISIKKSAGVSPDKVIRYMEEKMRARDSLVDKLRLKNAALKVQKKKMKMQVKQKEEMGEVLHEVDFQQLKIENAQFLERIDERNQDLLQLKLTAGDTLLVLNLFKKKLNTAMAESTHLDKEIHMRKEMLQRIELEAQLVEQDREKAERVNKKLRKQLHDYRVPDVLEYIQEKTDQEDLEKSIRIWERKVEIA 368          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Xenopus
Match: ENSXETT00000001668.1 (coiled-coil domain containing 96 [Source:NCBI gene;Acc:100489589])

HSP 1 Score: 50.0618 bits (118), Expect = 5.096e-6
Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query:  692 EVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKL 841
            E LH +DF+QLKIEN  Y EKIEE+N+EL++L+     T+  L   K+KL
Sbjct:  405 EGLHLIDFEQLKIENQTYNEKIEERNEELLKLRKKITSTVHTLTHVKEKL 454          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Mouse
Match: Ccdc113 (coiled-coil domain containing 113 [Source:MGI Symbol;Acc:MGI:3606076])

HSP 1 Score: 196.052 bits (497), Expect = 3.271e-58
Identity = 146/373 (39.14%), Postives = 228/373 (61.13%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            +T+S+   E + P +Q           L  L+E+    N  LK+E  MFEKY  R+E +   +   +  +  ++E +         +R        DR L L+ EQK E+ Q E+E+ R EI   +  +E+ L  ++AI+EEADIR +E+ K  +EF++D++K        I+ ++K +++ E+  R+RD + DKL LKN +L+ Q+ K+  QL+QKEE+GE LH+VDF+QLKIEN Q+LE IE +N+EL++LKL +G TLQVLN+YK KL   M     +  EI  R EL  +I+ ETIQ E+++ KA + ND+LR+QL+++R P VM YV       +L K  K+  RKV+IA+M+L  ++K WN+++ ++
Sbjct:   10 ITDSQAEEEGELPVIQ-----------LCGLVEELSYGNSALKTETEMFEKYYSRLEPRDHRMTRLSDIKITAAEFS-----QLRSRRKSKARGGLDRTLGLTVEQKLELVQKELEDTRDEIRHMRANAERDLQHHEAIIEEADIRWNEVQKAVHEFEKDILKTISKKKGSILATQKVMKYIEDMNRRRDNIKDKLCLKNVSLKVQRKKMLSQLRQKEEVGEALHDVDFQQLKIENAQFLETIEARNKELIQLKLASGNTLQVLNTYKNKLHRAMEIYVNLDKEILLRNELLGKIEKETIQAEEDRAKAHILNDKLRKQLAEFRAPQVMMYVKEKILNGELEKTIKMWERKVEIAEMSLKGYRKAWNKMKTSD 366          
BLAST of Coiled-coil domain-containing protein 96 vs. UniProt/SwissProt
Match: sp|Q9H0I3|CC113_HUMAN (Coiled-coil domain-containing protein 113 OS=Homo sapiens OX=9606 GN=CCDC113 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 7.929e-58
Identity = 140/347 (40.35%), Postives = 224/347 (64.55%), Query Frame = 2
Query:  107 ELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            +L  L+E+    N  LK+E  MFEKY  ++E +    D   P  ++   +  + ++ + R+RSKSR+         + +QK E+ Q E+ + + ++   +  +E+ L  ++AI+EEA+IR SE+S+  +EF++D++K        I+ ++K +++ E+  R+RD + +KLRLKN +L+ Q+ K+ +QL+QKEE+ E LH+VDF+QLKIEN Q+LE IE +NQEL +LKL +G TLQVLN+YK KL   M     +  EI  R+EL ++I+ ET+QVE+++ KAE  N RLR+QL+++R P VM YV       DL K  ++  RKV+IA+M+L  H+K WN+++  N
Sbjct:   25 QLCGLVEELSYVNSALKTETEMFEKYYAKLEPR----DQRPPRLSEIKISAADYAQFRGRRRSKSRTGMDRGVGLTA-DQKLELVQKEVADMKDDLRHTRANAERDLQHHEAIIEEAEIRWSEVSREVHEFEKDILKAISKKKGSILATQKVMKYIEDMNRRRDNMKEKLRLKNVSLKVQRKKMLLQLRQKEEVSEALHDVDFQQLKIENAQFLETIEARNQELTQLKLSSGNTLQVLNAYKSKLHKAMEIYLNLDKEILLRKELLEKIEKETLQVEEDRAKAEAVNKRLRKQLAEFRAPQVMTYVREKILNADLEKSIRMWERKVEIAEMSLKGHRKAWNRMKITN 366          
BLAST of Coiled-coil domain-containing protein 96 vs. UniProt/SwissProt
Match: sp|Q8C5T8|CC113_MOUSE (Coiled-coil domain-containing protein 113 OS=Mus musculus OX=10090 GN=Ccdc113 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.288e-57
Identity = 146/373 (39.14%), Postives = 228/373 (61.13%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            +T+S+   E + P +Q           L  L+E+    N  LK+E  MFEKY  R+E +   +   +  +  ++E +         +R        DR L L+ EQK E+ Q E+E+ R EI   +  +E+ L  ++AI+EEADIR +E+ K  +EF++D++K        I+ ++K +++ E+  R+RD + DKL LKN +L+ Q+ K+  QL+QKEE+GE LH+VDF+QLKIEN Q+LE IE +N+EL++LKL +G TLQVLN+YK KL   M     +  EI  R EL  +I+ ETIQ E+++ KA + ND+LR+QL+++R P VM YV       +L K  K+  RKV+IA+M+L  ++K WN+++ ++
Sbjct:   10 ITDSQAEEEGELPVIQ-----------LCGLVEELSYGNSALKTETEMFEKYYSRLEPRDHRMTRLSDIKITAAEFS-----QLRSRRKSKARGGLDRTLGLTVEQKLELVQKELEDTRDEIRHMRANAERDLQHHEAIIEEADIRWNEVQKAVHEFEKDILKTISKKKGSILATQKVMKYIEDMNRRRDNIKDKLCLKNVSLKVQRKKMLSQLRQKEEVGEALHDVDFQQLKIENAQFLETIEARNKELIQLKLASGNTLQVLNTYKNKLHRAMEIYVNLDKEILLRNELLGKIEKETIQAEEDRAKAHILNDKLRKQLAEFRAPQVMMYVKEKILNGELEKTIKMWERKVEIAEMSLKGYRKAWNKMKTSD 366          
BLAST of Coiled-coil domain-containing protein 96 vs. UniProt/SwissProt
Match: sp|Q3SZX9|CC113_BOVIN (Coiled-coil domain-containing protein 113 OS=Bos taurus OX=9913 GN=CCDC113 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.668e-53
Identity = 140/380 (36.84%), Postives = 225/380 (59.21%), Query Frame = 2
Query:   50 GESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKK--------------KLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
             E+   E Q +  ++    +L  L+E+    N  LK+E  MFEKY  ++E K     +  P      + TG        +R        +R + LS +QK E+ Q E+E+ + EI   +  +E+ L  ++AI+EEA+IR +E+ K  ++F++D++K        I+ ++K +++ E+  R+RD + DKLRLKN +L+ Q+ KL +QL+QKEE+GE LH+VDF+QLKIEN Q+LE IE +NQEL+++KL +G TLQ+LN+YK+              KL   M     +  E   R+EL ++I+ ET+Q E+++ KA   N +LR+QLS++R P VM Y+       DL K  ++  RKV+IA+M+L  ++K WN+++  N
Sbjct:    6 SETSASETQAQEESDLPVFQLCGLVEELSYGNSALKTETEMFEKYYNKLELK-----DQRPPRLSEIKITGAEIAQLRSRRKSKSRMGMERVMGLSVDQKLELVQKELEDTKDEIRHMRANAERDLQHHEAIIEEAEIRWTEVQKEVHDFEKDILKTISKKKGSILATQKVMKYIEDMNRRRDNMKDKLRLKNVSLKVQRKKLLLQLRQKEEVGEALHDVDFQQLKIENAQFLETIEARNQELIQMKLASGNTLQILNAYKRSSLLKTSRVVILQSKLHHAMQMSLNLTKEFLLRKELLEKIEKETLQAEEDRAKALALNKQLRKQLSEFRAPQVMIYIWEKIRNGDLEKTIRMWERKVEIAEMSLKGYRKAWNKMKTTN 380          
BLAST of Coiled-coil domain-containing protein 96 vs. UniProt/SwissProt
Match: sp|Q5XJN6|CC113_DANRE (Coiled-coil domain-containing protein 113 OS=Danio rerio OX=7955 GN=ccdc113 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.112e-41
Identity = 130/366 (35.52%), Postives = 220/366 (60.11%), Query Frame = 2
Query:   65 PELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGLL 1162
             E+ ++S ++   ++L EL++  L+ N  L +E  +F++Y+ R++ +    +     +N S+E              K++     R   L+ EQKC +A+S  ++  ++++  KI SEK LD YKA +EEADI L+EI K R  F R++V+   +  +  + +EK +R+ E++++ +D LI+KL  KNS L   K K + QL+Q+EEM E +  +DF+ LK EN ++ ++++E+N + + LKL+A +TLQ LNS K+KL  L N+ + +  +   R +L  +I+ ET Q E+E++KAE  N +LR QL+D+ VP V+ Y+        L K  +   RKV+IA+MAL  + K W+++R A  AGL+
Sbjct:    2 AEMTEDSKSDTARKQLVELVDLNLTSNAALNAEIDLFDRYISRLDLR--TFETVWKWQNLSTEKIPG---------RKAKVRTPGRQQLLTLEQKCVVAKSVYKKMIEDLKIAKIHSEKQLDNYKATLEEADIHLAEIKKERSHFKRNIVEELEDKKSMTMSAEKVMRYIEDKIKAKDILIEKLHRKNSALLTHKKKQQAQLRQQEEMAEGVTVLDFELLKFENIRFRKQLDEQNLKQVNLKLLAVKTLQTLNSNKEKLHILTNESEMLSSDTALRTKLLVKIEEETEQAEEERHKAEALNRKLRDQLADFHVPHVLQYIKLKESHGQLQKSVREWERKVEIAEMALKTYTKSWDKLRFAAGAGLV 356          
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Match: A0A210QH24 (DUF4201 domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13928 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.499e-101
Identity = 201/374 (53.74%), Postives = 262/374 (70.05%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHE--IVDNSAPTEN--QSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVR 1138
            M +SE        +  D+   + ++E+L  ++ED   +ND L +E  MFEKYLKR E K    +    AP      S+ +   +  +  ++     S+    +++L+ EQKC+IAQ EI+E ++EIEK K   EKILDT+KAIMEEAD+RL+E  K  YEFDRD++KG +N  T  VM+EK VR+FE+RLR RD L++KLRLKNSTL+ QK KL +QLKQKEEMGEVLHEVDF QLKIEN QYLEKI+E+NQ+L+RLKLMAG+TLQVLNSYKKKL TL  + +++K EI AR EL  RI  ET  VE E+ KAE  N +LRQQL+DYRVP VM+YV   AD Y+L K+ +   RKV+IA+MAL  H+K WNQ++
Sbjct:    1 MADSESMSLDTSNDAGDDPLQDLSDEQLFHMVEDMQKENDVLATETQMFEKYLKRNETKDALGVPGQGAPAAGIVPSASSQDVMRGVNRKRSKSRSSNIDKSSMRLNTEQKCDIAQKEIDELKEEIEKLKENCEKILDTFKAIMEEADLRLAETKKESYEFDRDILKGSVNARTATVMAEKVVRYFEDRLRSRDALVEKLRLKNSTLKVQKKKLHLQLKQKEEMGEVLHEVDFNQLKIENQQYLEKIDERNQDLLRLKLMAGKTLQVLNSYKKKLHTLTMESERLKSEITARNELLTRIDAETKVVEVERAKAEKINRKLRQQLADYRVPEVMEYVTEKADLYELQKKVRSWERKVEIAEMALKTHRKSWNQLQ 374          
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Match: A0A1S3J674 (coiled-coil domain-containing protein 113 OS=Lingula unguis OX=7574 GN=LOC106170568 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.663e-101
Identity = 196/377 (51.99%), Postives = 264/377 (70.03%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKH----EIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            M ESE        E  D+     T++EL  LL++ L  N+ L +E  MFEK+ KR+E K     ++  N+AP+++Q       + R +++ RS     +         EQKC+IAQ EIEE R++I++ K ESE++LDTY+AIMEEADIR++EI K  YEF+RD+VKG +N  T  V+SE+ +++ E+++R RDTLI+KLRLKNSTL+ QK KL MQLKQKEEMGEVLHEVDF QLKIEN QYLEKI+E+NQ+L+RLKLMAG TLQVLN+YKKKL+TL  +  ++K EI +R +L  RI  ET+ VE ++  AE  N +LR QL DYRVP VM+YV   AD Y+++K+ K   RKV+IA+M L  H+K WNQ+R A+
Sbjct:    1 MAESETMSVDTSNEANDDPLQELTDDELDRLLDETLRANEVLAAETQMFEKFFKRVEPKELQGIQLSVNAAPSQSQHDVGGRGIGRKRSKSRSSHVDKSLRLTA----EQKCDIAQREIEELREDIDRLKDESERVLDTYRAIMEEADIRINEIKKASYEFERDIVKGAVNTRTGKVISERVLKYLEDKIRARDTLIEKLRLKNSTLKVQKKKLAMQLKQKEEMGEVLHEVDFNQLKIENAQYLEKIDERNQDLLRLKLMAGNTLQVLNTYKKKLSTLTLESTRLKAEIASRNDLLARIDSETVTVETDRAGAEKINRKLRTQLGDYRVPEVMEYVRERADLYEMHKKVKSWERKVEIAEMGLKTHRKAWNQMRMAS 373          
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Match: R7US15 (DUF4201 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_181233 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.650e-98
Identity = 215/380 (56.58%), Postives = 279/380 (73.42%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAP-------TENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            M ESE        E Q++   + ++E++  LLE+    N+ L +E  MF+KY KRIE K     + AP       T   S  T   +   + RKRSKSRSS +DR+L+L+AEQKC+IAQ EIEEYR+EI++ + ESEK+LD +KAIMEEADIRL+E+ K  YEFDRD+VKG +NP T  V++EK  R+ +++LR RDTLI+KLRLKN+TL+ QK KL MQLKQKEEMGEVLHEVDF QLKIEN QY+EKI+E+NQ+L+RLKLMAG TLQVLNSYKKKL TL  + +++K EI +RQ+L DRI  ET  VE E++KAE  N +LRQQL+DY+VP VM+YV+  AD Y+L K+ K   RKV+IA+MAL  H+K WNQ++ A+
Sbjct:    1 MAESETLSVDNSTENQEDPLQDLSDEQIFHLLEETFRANEVLGAETHMFDKYFKRIEPK-----DGAPMHQVQLSTTTPSHSTHDLMMGGRGRKRSKSRSSNTDRSLRLNAEQKCDIAQREIEEYREEIDRLRDESEKVLDNFKAIMEEADIRLTEMKKSSYEFDRDIVKGSVNPRTGKVIAEKMTRYLDDKLRARDTLIEKLRLKNATLKVQKKKLHMQLKQKEEMGEVLHEVDFNQLKIENQQYIEKIDERNQDLLRLKLMAGNTLQVLNSYKKKLHTLNLESERLKTEIASRQDLLDRIDSETTSVEDERSKAEKINRKLRQQLTDYKVPEVMEYVSEKADLYELQKKVKSWERKVEIAEMALKTHRKAWNQMKMAS 375          
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Match: V3YXT5 (DUF4201 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_184681 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.187e-98
Identity = 206/372 (55.38%), Postives = 271/372 (72.85%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHE---IVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQV 1135
            M ESE        +  ++     ++E+L +L+ D +  N+ L +E  MFEKYLKR+E K E   ++ +  P    +  T+    R   RKRSKSRSS  DR+LKL+AEQKC+I+Q EIEE R++ EK + +SEKILD Y+AIMEEAD+RL+E+ K  YEF+RD+VKG +N  T  V+SEK +R+FE++LR RDTLI+KLRLKNSTL+ QK KL +QLKQKEEMGEVLHEVDF QLKIEN QYLEKI+E+NQ+L+RLK+MAG T QV N+++KKL TL  + +++K EI++R +L  RI VET  VE+E+ KAE  N +LRQQL+DY+VPAVM+YV   AD YDL K+ K   RKV+IA MAL  H+K W Q+
Sbjct:    1 MAESETLSVDTSNDTGEDPLLELSDEKLFQLVNDTIEDNEILSAETHMFEKYLKRVEPKGEAGSLLQSVHPPSGLAPSTSTQELRGMGRKRSKSRSSNIDRSLKLTAEQKCDISQREIEELREDNEKVREDSEKILDNYRAIMEEADLRLAEMKKEFYEFERDIVKGAVNTRTNKVVSEKVIRYFEDKLRSRDTLIEKLRLKNSTLKVQKKKLHLQLKQKEEMGEVLHEVDFNQLKIENQQYLEKIDERNQDLLRLKMMAGNTTQVRNAFQKKLHTLEKESERLKSEISSRNDLLSRIDVETTVVEEERLKAEKINKKLRQQLADYKVPAVMEYVTEKADLYDLQKKVKSWERKVEIADMALKTHRKTWKQL 372          
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Match: C3ZBE2 (DUF4201 domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_275521 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 2.138e-97
Identity = 188/357 (52.66%), Postives = 255/357 (71.43%), Query Frame = 2
Query:   89 ANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKK----HEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHAN 1147
            +  ++E L++L+ED L  ND L +E  MFEK+LKR+E K      +   S P     S +  ++  +  R+      +        + EQKC+IAQ E+EE R++I+K K ESEKILD +KA +EE+D RLSEI K  YEF+RD++KGG+NP T  V+ E+  R+F++R+R +DTLI+KLRLKNS+L+ QK KL++QLKQKEEMGEVLHEVDF+QLKIEN QYLE+I+E+NQ+L+RLKLMAG T+QVLNSYKKKL TL  + +++K EI +RQ++  RI  ET  VE+E++KAE  N + R QL+DYRVP V+DYV   AD Y+L K  K   RKV+IA+MAL  HKK W Q++ A+
Sbjct:   22 SELSDERLYQLVEDTLQSNDVLNTETEMFEKFLKRVEPKDGGHSSLGSTSTPVTATPSASMQDLRTVGRRRSKSKSGTIERLLKLSA-EQKCDIAQRELEELREDIDKFKEESEKILDNHKAHIEESDTRLSEIRKSSYEFERDILKGGVNPRTGKVVGERATRYFDDRIRAKDTLIEKLRLKNSSLKVQKRKLQLQLKQKEEMGEVLHEVDFQQLKIENAQYLERIDERNQDLLRLKLMAGNTMQVLNSYKKKLNTLTAESERLKSEITSRQDMLTRIDAETNSVEEERSKAEKENKKYRTQLADYRVPDVLDYVQDKADLYELQKTVKSWERKVEIAEMALKTHKKTWYQMQMAS 377          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Cavefish
Match: ccdc113 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:103040997])

HSP 1 Score: 102.834 bits (255), Expect = 3.103e-24
Identity = 57/155 (36.77%), Postives = 92/155 (59.35%), Query Frame = 2
Query:  695 VLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGL 1159
              H+VD ++LKIE  QY+E+I++ +Q+L +L +  G  L+V N  + KL +L  + + +  +I +R+ +  +++ +T QVE+E+ KAE  N +LR +LSD+ VP V+ YV   A    L +  +   RKV IA+M L    K WN+ R    A L
Sbjct:  152 TFHKVDLQKLKIEKRQYIEQIDKLSQDLQQLSVQGGNMLKVFNQNRTKLQSLTLESESLSSDIASREGMLMKLEEQTQQVEKERAKAESKNKKLRTRLSDFHVPDVLSYVEVNALHTKLEQDNRFCERKVAIAEMGLKTLTKAWNKHRATAEAAL 306          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Sea Lamprey
Match: ccdc113 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:450041])

HSP 1 Score: 244.588 bits (623), Expect = 4.746e-78
Identity = 161/345 (46.67%), Postives = 237/345 (68.70%), Query Frame = 2
Query:  143 NDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVK---------GGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANS 1150
            N+ L +E  MFEKY  R++ K     NS P++  +  T+    + +  +RS+SR S++DR L+L+A QKCE+AQ+E+E+ R E+ +  +E+E++LDTYKA MEEADIRL+E  + + EF+RD++K          G   + ++  ++K + + E+R+R RDTLI+KLRL+N +L+ Q  K+ +QL+QKEEMGE LHEVDF QL+IEN Q++EKI+E+NQ+++RLKL A  TLQVLNSYKKKL  LM + + ++ +I +RQE+   I VET+ VE+E+ KAE  N +LR QLS++RVP VM+YV   A   DL        RKV+IAKM L  H   W +++ A++
Sbjct:    4 NEVLLAETEMFEKYFNRLDPKDL---NSTPSQGPTPTTSMQDLQTRGLRRSRSRGSSTDRPLRLTAAQKCELAQTELEQLRAELLRTGVEAEQVLDTYKATMEEADIRLTEFRRAQVEFERDILKTKTGTCKGRAGAGGLARLP-ADKILHYMEDRIRARDTLIEKLRLRNGSLKIQNKKMLLQLQQKEEMGEALHEVDFSQLQIENNQFVEKIDERNQDMLRLKLTAASTLQVLNSYKKKLNLLMEEARAMERDIASRQEMLKSIDVETVAVEEERMKAERLNRQLRAQLSEFRVPPVMEYVQHKAQLLDLQNEVCSWERKVEIAKMQLKAHNSTWKRLKTASA 344          
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Nematostella
Match: EDO35964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ5])

HSP 1 Score: 293.123 bits (749), Expect = 2.863e-96
Identity = 199/356 (55.90%), Postives = 265/356 (74.44%), Query Frame = 2
Query:   74 QDE-SYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVR 1138
            QDE      ++EEL+ L+++ +  ND L++E  MFEKYLKR++ K   +  +AP   Q  ET+        RKRS+SR  + DR LKLSAEQKC+IAQ E+EE R +IEK K ESEKILD Y+AIMEEA+IR +EI K+ YEF+RD+VKG +N  T  V++E+  R+FE++LR RDTLI+KLRLKNSTL+ QK KL MQLKQKEEMGEVLHEVDF QLKIEN QYLEKI+EKNQ+L+RLKLM+G   Q+LN+YKKKL TL  + ++++ EI  R EL  +I  ET  V+ ++ KAE+ N++L+QQL+DY+VP VMDYV   A  Y+LNK  ++  RKV+IA+MAL  ++K W++++
Sbjct:   15 QDEDPLVELSDEELYNLVQETIHANDVLRNETTMFEKYLKRVDPKDIGIKPAAPVIAQPPETSHR----GLRKRSRSRGPSLDRHLKLSAEQKCDIAQRELEELRDDIEKLKDESEKILDNYRAIMEEAEIRNAEIKKVSYEFERDLVKGAVNQRTNKVIAERVTRYFEDKLRARDTLIEKLRLKNSTLKVQKRKLHMQLKQKEEMGEVLHEVDFNQLKIENQQYLEKIDEKNQDLLRLKLMSGNVQQILNTYKKKLHTLTMESERLRTEIGQRNELLFKIDAETNLVQTDREKAELLNEKLKQQLADYKVPDVMDYVGERAKLYELNKVVRMWERKVEIAEMALKTNRKTWHKMQ 366          
BLAST of Coiled-coil domain-containing protein 96 vs. Planmine SMEST
Match: SMESG000050787.1 (SMESG000050787.1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 378/378 (100.00%), Postives = 378/378 (100.00%), Query Frame = 2
Query:   29 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVXXXXXXXXXXXXXXXXXXXXXXXXEQKCEIAQSEIEEYRQXXXXXXXXXXXXLDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRXXXXXXXXXXXXXXXXGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGLL 1162
            MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVSRLQNRKRSKSRSSASDRALKLSAEQKCEIAQSEIEEYRQEIEKNKIESEKILDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRQQKSKLKMQLKQKEEMGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGLL
Sbjct:    1 MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFEKYLKRIEKKHEIVDNSAPTENQSSETTGNVSRLQNRKRSKSRSSASDRALKLSAEQKCEIAQSEIEEYRQEIEKNKIESEKILDTYKAIMEEADIRLSEISKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKNSTLRQQKSKLKMQLKQKEEMGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETIQVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILARKVDIAKMALDRHKKIWNQVRHANSAGLL 378          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCDC1131.651e-5840.35coiled-coil domain containing 113 [Source:HGNC Sym... [more]
CCDC1132.077e-5647.08coiled-coil domain containing 113 [Source:HGNC Sym... [more]
CCDC1131.026e-628.92coiled-coil domain containing 113 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG136939.952e-1129.71gene:FBgn0031235 transcript:FBtr0078126[more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1133.413e-4235.79coiled-coil domain containing 113 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gins31.171e-5945.98coiled-coil domain containing 113 [Source:NCBI gen... [more]
ENSXETT00000001668.15.096e-652.00coiled-coil domain containing 96 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc1133.271e-5839.14coiled-coil domain containing 113 [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9H0I3|CC113_HUMAN7.929e-5840.35Coiled-coil domain-containing protein 113 OS=Homo ... [more]
sp|Q8C5T8|CC113_MOUSE2.288e-5739.14Coiled-coil domain-containing protein 113 OS=Mus m... [more]
sp|Q3SZX9|CC113_BOVIN2.668e-5336.84Coiled-coil domain-containing protein 113 OS=Bos t... [more]
sp|Q5XJN6|CC113_DANRE1.112e-4135.52Coiled-coil domain-containing protein 113 OS=Danio... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QH243.499e-10153.74DUF4201 domain-containing protein OS=Mizuhopecten ... [more]
A0A1S3J6745.663e-10151.99coiled-coil domain-containing protein 113 OS=Lingu... [more]
R7US151.650e-9856.58DUF4201 domain-containing protein OS=Capitella tel... [more]
V3YXT54.187e-9855.38DUF4201 domain-containing protein OS=Lottia gigant... [more]
C3ZBE22.138e-9752.66DUF4201 domain-containing protein OS=Branchiostoma... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1133.103e-2436.77coiled-coil domain containing 113 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1134.746e-7846.67coiled-coil domain containing 113 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359642.863e-9655.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 96 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050787.10.000e+0100.00SMESG000050787.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034138 ID=SMED30034138|Name=Coiled-coil domain-containing protein 96|organism=Schmidtea mediterranea sexual|type=transcript|length=1263bp
GGTAATTAAATAAAATTTCATTTAAAATATGACAGAGAGTGAATTTAGTG
GTGAATCTCAGCATCCTGAGTTACAGGATGAATCTTATGCTAATTTTACT
AACGAGGAATTACATGAATTACTAGAAGATGCTTTATCAAAAAATGATAA
GCTTAAGTCCGAAAACATAATGTTCGAAAAATATCTTAAACGGATAGAGA
AAAAACATGAAATCGTTGATAATAGTGCTCCAACCGAAAATCAATCCAGT
GAAACTACTGGAAATGTAAGTCGATTGCAAAATAGAAAACGTTCGAAAAG
CCGTAGTTCAGCATCTGACAGAGCATTAAAATTATCTGCCGAACAAAAAT
GTGAAATAGCTCAATCGGAAATCGAAGAATATCGCCAAGAAATTGAGAAA
AATAAAATTGAATCTGAGAAAATATTAGATACTTACAAAGCAATTATGGA
AGAAGCCGATATCAGATTATCAGAGATCAGTAAGCTCAGATACGAATTCG
ACAGAGACGTCGTTAAGGGCGGCATCAACCCGATTACGAAAATCGTGATG
AGTGAAAAATTTGTTCGACATTTTGAAGAAAGATTGAGACAAAGAGACAC
TCTCATCGATAAATTACGGTTAAAAAATTCTACTTTGCGCCAGCAAAAAT
CCAAATTGAAAATGCAATTGAAACAAAAAGAAGAAATGGGTGAAGTACTA
CATGAAGTCGACTTCAAGCAATTGAAAATCGAAAACACCCAATACTTGGA
GAAAATCGAAGAGAAAAACCAAGAATTGATGCGACTGAAATTAATGGCCG
GCAGGACTTTACAGGTTTTGAATTCATATAAGAAGAAACTGACGACTCTT
ATGAATGATGTCAAGAAGATCAAATATGAAATCAATGCTAGACAAGAACT
TTATGATCGAATTCAAGTGGAAACTATTCAAGTGGAGCAGGAGAAAAACA
AAGCCGAAATGACAAACGACAGACTCCGCCAGCAACTGTCAGATTATCGG
GTACCCGCGGTTATGGACTATGTCAATTGTGTCGCAGATCAGTATGATCT
TAATAAGAGAGAGAAAATCCTAGCGAGAAAAGTAGACATAGCGAAGATGG
CCTTAGACCGGCACAAGAAAATCTGGAACCAAGTCCGTCATGCAAATTCG
GCTGGACTACTGTAATATGTACTTTGCCAGATAAATTTGACAGTTTTGGG
CAAAAAATTAACTCTTTTCTTTTTCGATTTTAAGATGATTTCAAATAAAT
AGTTGTAAGGTGC
back to top

protein sequence of SMED30034138-orf-1

>SMED30034138-orf-1 ID=SMED30034138-orf-1|Name=SMED30034138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MTESEFSGESQHPELQDESYANFTNEELHELLEDALSKNDKLKSENIMFE
KYLKRIEKKHEIVDNSAPTENQSSETTGNVSRLQNRKRSKSRSSASDRAL
KLSAEQKCEIAQSEIEEYRQEIEKNKIESEKILDTYKAIMEEADIRLSEI
SKLRYEFDRDVVKGGINPITKIVMSEKFVRHFEERLRQRDTLIDKLRLKN
STLRQQKSKLKMQLKQKEEMGEVLHEVDFKQLKIENTQYLEKIEEKNQEL
MRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQELYDRIQVETI
QVEQEKNKAEMTNDRLRQQLSDYRVPAVMDYVNCVADQYDLNKREKILAR
KVDIAKMALDRHKKIWNQVRHANSAGLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR025254DUF4201
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0034451centriolar satellite
GO:0043234protein complex
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 25..45
NoneNo IPR availableCOILSCoilCoilcoord: 229..256
NoneNo IPR availableCOILSCoilCoilcoord: 378..378
NoneNo IPR availableCOILSCoilCoilcoord: 193..220
NoneNo IPR availableCOILSCoilCoilcoord: 101..135
NoneNo IPR availableCOILSCoilCoilcoord: 299..322
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 63..100
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..84
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..26
NoneNo IPR availablePANTHERPTHR15654UNCHARACTERIZEDcoord: 14..373
NoneNo IPR availablePANTHERPTHR15654:SF2COILED-COIL DOMAIN-CONTAINING PROTEIN 113coord: 14..373
IPR025254Domain of unknown function DUF4201PFAMPF13870DUF4201coord: 187..359
e-value: 4.4E-45
score: 153.6