SMED30034137

Overview
NameSMED30034137
Smed IDSMED30034137
Length (bp)4064
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034137 (SMED30034137) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034137 (SMED30034137) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034137 (SMED30034137) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034137 (SMED30034137) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034137

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034137SMESG000045996.1 SmedASXL_017597SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034137SMESG000045996.1 dd_Smed_v4_13741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034137SMESG000045996.1 dd_Smed_v4_13741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034137SMESG000045996.1 dd_Smed_v4_13741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034137SMESG000045996.1 dd_Smed_v4_13741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034137SMESG000045996.1 dd_Smed_v6_13741_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30034137 vs. TrEMBL
Match: A0A068YD53 (Cadherin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001041800 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 8.711e-21
Identity = 159/737 (21.57%), Postives = 293/737 (39.76%), Query Frame = 3
Query:  588 HNKSLVILWSIGKDYIYNPYLKSLQNFESRFNNGPP----LKINHIQIQ----QWFVG-FLHRQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQ-LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVF----------------SIEDKIVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPP--QDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESK--IYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKI---PKIKIQ---IFTPIKSPLFFDKKQGNKENLLIFDWFFYNELSVSTFCNNPKLDLLDQ---ELYFRSFSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEI-----------------INKTFPKFQYT-----------HFTVTAGIPFKSYVLRRTSLDHSNIKEMRL--ETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLK--------------AMSMNHKIKLSVK----------------TENLNIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDV 2501
              KSL  +W IG  Y+ +  L+ L   E+R    P     + ++ IQ +     W VG + H  +  S+   RR     + +     +G ++     E    +  ++ +T  +  N       P I +Q + PI++   QI N  +P NTF   +  S L++++F                +   + +  +   WIS+++ ++ +R+ P     G     +CAYN   G  C ++++ V PP P  +   I+VS         ++VP+ WF+   V    ++  I  TG+  F W++T   EI  V  ++   I           S   + +   + V A   +K+ T P  R   ++     +   + F+          L   + ++L++   P +K Q   I+  +    F +K +     +L  + F Y  L +        L +L+      + +S S F +   +   +R   IC  +     +   +S +Q    + L    L+   ELE+                 +NK +P    T           +FTV AG+ FK  +     +  + ++ + +  E  + + +  WI ++     L+GLPL+ H R+ AY+F   I   + +T   + F V VV + L+               +  NH++++ +K                  +    + YRW LVT LDKY+R  C     CG  + L D+
Sbjct:   51 QQKSLFFIWKIGCGYLDDNSLQILSKVENRLKESPDISDWMGLSSIQAEAIMLDWMVGEYDHVSKVRSK---RRAFQGYQPIYPSRTAGAVT-----EASGMSPSDLRETHFSSSNAI-----PPILVQPMVPIEITVQQISNIRVPPNTFHSPD-GSKLQLRLFEHIYPMQFGLDFKDPSAARGREIGGNGASWISFDETNEILRLRPYPEHEGTHKFVLCAYNVANGQTCTNINVRVKPPTPIRKSSIIHVSP---GVYWCYSVPVFWFSELRVDAITNI-DISVTGDY-FSWDKTRG-EICIVTELQSDQIMPFFFRGTNRASAETVEVEFRVAVKAPPVEKMITSPRLRIRLRWTNTYNSYEMSEFS---------RLNSSLAQALRVRVNPSVKSQNIFIYDVVHMRKFQEKDRLPMSKILEVE-FVYLPLGLPEADYMKNLSVLEDMTSTPWGKSGSSFGLTRESKQFSRLKNICENAR----LIGSVSAVQAAAESFLP-FQLESVTELEVAGSACDRILQSVDGSADVNKIYPGPLTTTNIPYSDQVIENFTVEAGLAFKKRINPTKVVPMNRVRTIEIIDENYNRLNDSAWITVAEDKTNLFGLPLQNHARKDAYRFWLSIVAVDQRTPINIHFTVDVVKWPLEMTLTSIKYGWFPRPTVVHNHRVRMRMKLGGTVGRGISPTYSWPPTSPETSLSYRWNLVTNLDKYLRPECSP--HCGVGIILMDI 750          
BLAST of SMED30034137 vs. TrEMBL
Match: A0A068WGR9 (Cadherin OS=Echinococcus granulosus OX=6210 GN=EgrG_001041800 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 4.822e-20
Identity = 161/739 (21.79%), Postives = 293/739 (39.65%), Query Frame = 3
Query:  588 HNKSLVILWSIGKDYIYNPYLKSLQNFESRFNNGPP----LKINHIQIQ----QWFVG-FLH----RQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQ-LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVF----------------SIEDKIVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPP--QDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLI------EINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLIFDWFFYNELSVST---FCNNPKLDLLDQELYFRSFSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEI-----------------INKTFPKFQYT-----------HFTVTAGIPFKSYV--LRRTSLDHSNIKEMRLETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLK--------------AMSMNHKIKLSVKTENL----------------NIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDV 2501
              KSL  +W IG  Y+ +  L+ L   E+R    P     + ++ IQ +     W VG + H    R ++ +   Y+    +    A  E SG+            +  ++ +T  +  N     + P I +Q + PI++   QI N  IP NTF   +  S L++++F                +   + +  +   WIS+++ ++ +R+ P     G     +CAYN   G  C ++++ V PP P  +   I+VS         +++P+ WF+   V    ++  I  TG+  F W++T   EI  V  ++   I        N  +    E +  + + +P V    +K+ T P  R   ++     +   + F+  ++  L + L   V  S+K   I I     ++    F +K     + ++   F Y  L +       N   L+ +    + +S S F +   +   +R   IC  +     +   +  +Q    + L    L+   ELE+                 +NK +P    T           +FTV AG+ FK  +   +   ++     E+  E  + + +  WI ++     L+GLPL+ H R+ AY+F   I   + +T   + F V VV + L+               +  NH++++ +K +                     + YRW LVT LDKY+R  C     CG  + L D+
Sbjct:   51 QQKSLFFIWKIGCGYLDDNSLQILSKVENRLKESPDISDWMGLSSIQAEAIMLDWMVGEYDHVSKVRSKRQAFQGYQPIYPSRTAGAVTEASGM------------SPSDLRETHFSSSN-----ANPPILVQPMVPIEITVQQISNIRIPPNTFHSPD-GSKLQLRLFEHIYPMQFGLDFKDPSAARGREIGGNGASWISFDETNEILRLRPYPEHEGTHKFVLCAYNVANGQTCTNINVRVKPPTPIRKSSIIHVSP---GVYWCYSIPVFWFSELRVDAITNI-DISVTGDY-FSWDKTRG-EICIVTELQSDQIMPFFFRGTNRASAETVEVEFRVAVKVPPV----EKMITSPRLRIRLRWTNTYNSYEMSEFSRLNS-SLAQALRVRVNPSVKSQNIFIYDVVHMRK---FQEKDSLPMSKILEVEFVYLPLGLPEADYMRNLSVLEDMTSSPWGKSGSSFGLTRESKQFSRLKNICENAR----LIGSVGAVQAAAESFLP-FQLESVTELEVAGSACARILQSVDGSADVNKVYPGPLTTTNIPYSDQVIENFTVEAGLAFKKRINPTKVVPINRVRTIEIIDENYNRLNDSAWITVAEDKTNLFGLPLQNHARKDAYRFWLSIVAVDQRTPINIHFTVDVVKWPLEMTLTSIKYGWFPRPTVVHNHRVRMRMKLKGTVGRGIFPTYSWPPTSPETSLSYRWNLVTNLDKYLRPECSP--HCGVGIILMDI 750          
BLAST of SMED30034137 vs. TrEMBL
Match: A0A5K3EJ30 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.068e-17
Identity = 157/743 (21.13%), Postives = 279/743 (37.55%), Query Frame = 3
Query:  600 LVILWSIGKDYIYNPYLKSLQNFESRFNNGPPLK--------INHIQIQQWFVGFLH-----RQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQ-LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVF----------------SIEDKIVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKI---PKIKIQ---IFTPIKSPLFFDKKQGNKENLLIFDWFFYNELSVSTFCNNPKLDLLDQELYFRSF-SYFFMVNITILENRF---GGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTFPKFQ---------------------YTHFTVTAGIPFKSYVLRRTSLDH----------------SNIKEMRL--ETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSM--------------NHKIKLSVKTENL----------------NIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDV 2501
            L  LW IG  Y+ +  L  L   E+RF + P +          + + +  W VG        R ++ S  +Y+R   +    A  E SG++S                 +++  LN     S   I +Q + PI++   QI N  IP  TF D    + L++K+F                ++  K + +    W+S++  ++ +R+ P     G     +CAYN  G   C ++ + V PP P   + ++          + VP+ WF+   V    D+  I  TG   F W+     EI  V  ++   I           S   + +        R  +   P+ + +   R +I+      FN  +  + L  L   + + L++   P +  Q   I+  +K   F +K       LL  + F Y  L +     +    LLD EL  RS+ +    ++    +  F    GIC  +     ++  +S +Q     +L    L+   ELE+      +                       Y H   T  +PF   V+   +++                 S I+ + +  E  + + +  WI ++     L+GLPL+  VR+ AY+F   I   + +    + F V VV + LK  S+              NH++++ +K + +                   + YRW L++ LD+Y R +C     CG  + L D+
Sbjct:  205 LYFLWKIGCGYLDDTSLHLLTKIETRFQSKPVISEWLGATTNGSQVVLLDWMVGEYSPKLKVRSKRHSPQVYQRVYPSRTAGAISEASGVVS-----------------SDVESLNLPPSSSTSPIVVQAIAPIEITVNQISNIRIPATTF-DAPDGTKLQLKLFDHMYPMQFGFDFKDPSTVTGKEIDSKGTNWVSFDAANEILRLRPYSEHEGTHKFVLCAYNIAGTRACTNIHVHVKPPTPIK-KSFILHVYPGIFWCYPVPVYWFSELKVVSMSDI-DISVTGEL-FSWDRNKG-EICVVTELQSEQIMAFFFRGTHKASTQAVEVEF------RISVKVPPIEKIISSPRLRIRLRWMNAFNSYEM-RELSRLNSSLAQVLRVRVNPSVTSQNIFIYDVLKIRNFQEKDNSQLSKLLEVE-FVYLPLGLPDASYSEYWSLLD-ELNSRSWRTSTSEISHASKDKHFISLKGICESAR----LSGSVSALQAAAE-SLHPFHLESVTELELSGSACSRILQSSSIGARGDGATQSTDVSKIYPHQITTTNLPFLDQVIDNFTVEAGLAFKKRINPNKVVPMSRIRAIEIIDEYYNRLGDSAWINVAEDKTNLFGLPLQNQVRKDAYRFWLSILTVDHREPINIHFTVDVVKWPLKVTSLPTRHGWFPRLKTVHNHRVRMRMKLDEMAGRGISLTHNWPPKSPEKSLSYRWSLLSNLDRYFRPDCGL--HCGVGIMLIDI 909          
BLAST of SMED30034137 vs. TrEMBL
Match: A0A0X3NYS4 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR165184 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 6.163e-15
Identity = 56/188 (29.79%), Postives = 94/188 (50.00%), Query Frame = 3
Query: 2058 HFTVTAGIPFKSYVLRRTSLDHSNIKEMRL--ETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLK--------------AMSMNHKIKLSVKTENLNIDVQ-----------------YRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAAD 2522
            +FTV AG+ FK  +     +    I+ + +  ET++ + +  W+ +S  +  L+GLPL++H+RE AY+F   I   + +T   + F V VV +  K              + + NH++++ +K  N    VQ                 YRWKLVT LDKY+R +CEA  +CG D+ L +++   + D
Sbjct:  206 NFTVEAGLAFKKLISPVKVVPIRRIRAIEIVDETNTKVNDSSWLKVSNDHSHLFGLPLQQHIREGAYRFWLNILTVDQRTPITIHFTVDVVKWPAKIFSFSRRPNWFQGVSATANHRVRMRLKLANQFAHVQRQAAHNWPLGPPHSSLLYRWKLVTSLDKYLRPSCEA--NCGMDIMLLEISEQGSTD 391          
BLAST of SMED30034137 vs. TrEMBL
Match: A0A4Z2CP11 (Dystroglycan isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_008692 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.740e-13
Identity = 58/204 (28.43%), Postives = 94/204 (46.08%), Query Frame = 3
Query: 1953 SDIQEVKRTTLSSVDLKLAAELEIINKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGI--ENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHY-----DLKAMSMNHKIKLSV-----KTENLNIDV---------QYRWKLVTQLDKYVRENCEAMNDCGKDVALWDV 2501
            S   E   +  S+  L ++A ++ +    P     +FTVTAG+ FK  +          I+ M L  + G+  ++  W++L+  N  L GLPL +HVR+  Y FR  I   + +T   + F V V  +       K+   NH+++L +      + N  I++          YRWKL   +DKY+R NC     C  DV +W +
Sbjct:  799 SGTNETNLSRWSNSHLYMSANVQFMANVVP-----NFTVTAGLRFKKSISPNNVTPLKRIQYMELRDAYGLVLDDSSWMSLTTDNSHLIGLPLNEHVRKQPYVFRLYIHSVDQKTPIVIGFTVEVQDWFEIMKKDKSFQSNHRVRLRILPPIQTSANQPIEIWPTKPSNSLNYRWKLSNAIDKYLRPNCSP--PCNPDVGIWQI 995          

HSP 2 Score: 69.3218 bits (168), Expect = 7.859e-8
Identity = 72/328 (21.95%), Postives = 132/328 (40.24%), Query Frame = 3
Query:  699 KINHIQIQQWFVG-FLHR---------QRKFSRIIYRRGINNAETVAFIE-GSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQLPPIKMHALQIMNYVIPENTFIDKE--FKSLLRIKVFSIEDKIVS-------------------NDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWN-ETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKI 1583
            K+ HI++ +W VG  +H               R + +R   ++    ++E GSG+ S  +  ++  R+    +  +  H N       P +   + PIK    QI N  IP+NTF D +  +   L++ +++   + +S                    D  KW+S++  +Q +R+ P    +G     +CA +      C+   I V  P P   + ++ + +      + +P+ WF         D L ++  G+SPF WN  TG + ++    +   +      T  K    + I   L V     Q L T    R  F++ EK+
Sbjct:  303 KLKHIKLAEWIVGDLIHNSLHDTIQINHENVKRSVSKRSAMSSRVAGYLEEGSGMASFHQFPKMDYRSFMEHSSPDQTHSNI------PRVKNYITPIKTTVYQISNVQIPQNTFYDLQDGYTQNLKLSLYASNSENISYIELKSKENLIQALGEEITRDIKKWVSFDAKNQILRLKPLPDHVGNHTFIVCATDRDQNRACEPFQIIVKRPSP-FRKNFILRISPGVFWCYQIPIYWFKELKTVSF-DKLDLEVKGDSPFSWNVHTGEVCVISSLKISQIITLFFHATNAKLAQSVEIEFRLSVKVPPVQLLITNSKLRMKFQWPEKL 622          
BLAST of SMED30034137 vs. Planmine SMEST
Match: SMESG000045996.1 (SMESG000045996.1)

HSP 1 Score: 2615.11 bits (6777), Expect = 0.000e+0
Identity = 1288/1300 (99.08%), Postives = 1294/1300 (99.54%), Query Frame = 3
Query:   75 MKQFSFSRLIFIQFAFWEICYSSVEVHNLSAYVGYVFEATIIMDKKVSLPNWMYWDNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARPDKIDIENYQSEMFLAALTFSSEAFLSLSIENKIQLIIDIKNIMNIKCPIVITSERISRSVTILTKSNTTILHNKSLVILWSIGKDYIYNPYLKSLQNFESRFNNGPPLKINHIQIQQWFVGFLHRQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQLPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDKIVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLIFDWFFYNELSVSTFCNNPKLDLLDQELYFRSFSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENLNIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPXXXXXXXXXXXXXXXXKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNEWISVNNDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMETITFKFNLIRELTYIKPVDSSPNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLGKIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMFLMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRGGTSPIILAGEYQHSYMPPSRPLILPHEKPPVSPPDYIAENNSVLINDEDA 3974
            MKQFSFSRLIFIQFAFWEICYSSVEVHNLSAYVGYVFEA IIMDKKVSLPNWMYWDNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARPDKIDIENYQSEMFLAALTFSSEAFLSLSIENKIQLIIDIKNIM IKCPIVITSERISRSVTILTKSNTTILHNKSLV+LWSIGKDYIYNPYLKSLQNFESRFNNGPPLKINHIQIQQWFVGFLHRQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPS+NIQLPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDKIVSNDP KWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQA+SKTVFNLTDTWKLLKDLEGYVVKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLL+FDWFFYNELSVSTFCNNPKLDLLDQEL FRSFSYFFMVN+TILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLA ELEIINKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDH+NIKEMRLETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENLNIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPSSSSVSIEISYISLLSKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKL PPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNEWISVNNDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMETITFKFNLIRELTYIKPVDSSPNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLGKIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMFLMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRGGTSPIILAGEYQHSYMPPSRPLILPHEKPPVSPPDYIAENNSVLINDEDA
Sbjct:    1 MKQFSFSRLIFIQFAFWEICYSSVEVHNLSAYVGYVFEAKIIMDKKVSLPNWMYWDNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARPDKIDIENYQSEMFLAALTFSSEAFLSLSIENKIQLIIDIKNIMYIKCPIVITSERISRSVTILTKSNTTILHNKSLVLLWSIGKDYIYNPYLKSLQNFESRFNNGPPLKINHIQIQQWFVGFLHRQRKFSRIIYRRGINNAETVAFIEGSGLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSVNIQLPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDKIVSNDPTKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQANSKTVFNLTDTWKLLKDLEGYVVKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLVFDWFFYNELSVSTFCNNPKLDLLDQELLFRSFSYFFMVNVTILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLATELEIINKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDHNNIKEMRLETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENLNIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPSSSSVSIEISYISLLSKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLQPPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNEWISVNNDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMETITFKFNLIRELTYIKPVDSSPNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLGKIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMFLMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRGGTSPIILAGEYQHSYMPPSRPLILPHEKPPVSPPDYIAENNSVLINDEDA 1300          
BLAST of SMED30034137 vs. Planmine SMEST
Match: SMESG000026871.1 (SMESG000026871.1)

HSP 1 Score: 213.001 bits (541), Expect = 7.425e-56
Identity = 207/819 (25.27%), Postives = 369/819 (45.05%), Query Frame = 3
Query:  948 LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDK-IVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYV-----------VKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLIFDWFFY--NELSVSTFCNNPKLDLLDQELYFRSFSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTF-PKFQY-------THFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGIENEP-WIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENL-NIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPXXXXXXXXXXXXXXXXKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNE---WISVNN---DSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMET 3314
            L P+K+   QIMNYVIP   F    + + + +  F  + + +++ +   W+ +  + +NI+  P   + G   L+IC+        C S+ + V    PQ HQI++ +   DYII +T+PL WF    V K   + I +   + P  W    +L  L+++S+EG ++E  +  L+ N++ + + L +P++++ + +         +++FR  I    K  FN+     L+ +L  ++           V + ++  + +QIF      ++  ++         FDW F+  +EL        PK  L+  E   +SF      N+  +      I S S      T     +++  +TT   +  K +    +   T    FQ+       +   V  GI F+  +          I+EM +        +P WI  S +N  L G+  K    +   +FRF+I   N + Q  V + +I+      + S + K ++ +   ++   DV    K + +L +Y + +CE    C  +++L  V      D          I     +   +++CP++  I    K I T    +  +PN  LK++F   G+G++      L G C+  ++ PPDLG+  ++  IP+  SL+ F  FYNS+V   I   N   N + Y+    WI + N   DS+ L  LA   H +S PY++EL V+    HK++ P+I+ +VK LM H SF+P+ ++ NHQI +++     I      L   +  +++ D Y R +C       +N     CGA+IL   IF +  +ET
Sbjct:  243 LSPLKIVDTQIMNYVIPNMVFPLYSYPNGVNLFYFVNKSRELLTAEMNLWLKFTPSTRNIKFQPTTKNRGIHNLEICSNTLSSNESCVSVQVIVISSSPQVHQIHIREGRNDYIINYTLPLVWFRPQKVIKSSQIQITRVKASIPISWGNHNSLLFLNISSIEGTVLEFMVDVLVNNKTFVQLELMMPLMSLAKSRAI-------IYQFRSSI-TWLKYPFNVPKI--LILELNSFLNTMATRISQLFVGNSRVSILPLQIFRDNFDSIYIQRRD------FTFDWTFFVNSEL--------PKSCLISPESIVKSFEKLSTKNV--INFNTSAIVSKS------TSGCGLMRQALQTTSLPITRKRSTTGPLKTPTVRTDFQWRPIRIPDSKLFVECGIIFQCLLPAAIR----GIQEMFITPVVFTGPKPDWIGFSNNNKSLVGVIAKTICPKR--EFRFMINGSNYKKQVIVNWTLII-EISTPSSSQDQKFQIDMAMISIITFDVIQIIKTIKELKRYTQLDCEEEISCKYNISL--VRPPTKNDE--------TIHMSLEILDYSRVCPQILGIFLRNKLIETP--QRPNSPNPQLKRIFYRYGIGQLNFVSFQLRGKCENKRIFPPDLGEKIIFNNIPYLISLKSFHEFYNSSVELEI--SNISSNGIAYDSYMNWIKIKNKINDSSILYILASTEHTRSHPYIVELTVNPGKRHKMLLPKISFQVKNLMHHPSFIPYIRELNHQISIDVTTNVIIEDTIMPLDITLEVAALADNYMRPSC-------QNASSLDCGADIL---IFLNSVIET 998          
BLAST of SMED30034137 vs. Planmine SMEST
Match: SMESG000026871.1 (SMESG000026871.1)

HSP 1 Score: 212.616 bits (540), Expect = 8.010e-56
Identity = 207/821 (25.21%), Postives = 368/821 (44.82%), Query Frame = 3
Query:  948 LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDK-IVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYV-----------VKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLIFDWFFY--NELSVSTFCNNPKLDLLDQELYFRSFSYFFMVNI------TILENRFGGIC----SFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGIENEP-WIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENL-NIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPXXXXXXXXXXXXXXXXKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNE---WISVNN---DSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMET 3314
            L P+K+   QIMNYVIP   F    + + + +  F  + + +++ +   W+ +  + +NI+  P   + G   L+IC+        C S+ + V    PQ HQI++ +   DYII +T+PL WF    V K   + I +   + P  W    +L  L+++S+EG ++E  +  L+ N++ + + L +P++++ + +         +++FR  I    K  FN+     L+ +L  ++           V + ++  + +QIF      ++  ++         FDW F+  +EL        PK  L+  E   +SF      N+       I+     G      +      P+T+  S    +K  T+ + D +        +K F         V  GI F+  +          I+EM +        +P WI  S +N  L G+  K    +   +FRF+I   N + Q  V + +I+      + S + K ++ +   ++   DV    K + +L +Y + +CE    C  +++L  V      D          I     +   +++CP++  I    K I T    +  +PN  LK++F   G+G++      L G C+  ++ PPDLG+  ++  IP+  SL+ F  FYNS+V   I   N   N + Y+    WI + N   DS+ L  LA   H +S PY++EL V+    HK++ P+I+ +VK LM H SF+P+ ++ NHQI +++     I      L   +  +++ D Y R +C       +N     CGA+IL   IF +  +ET
Sbjct:  243 LSPLKIVDTQIMNYVIPNMVFPLYSYPNGVNLFYFVNKSRELLTAEMNLWLKFTPSTRNIKFQPTTKNRGIHNLEICSNTLSSNESCVSVQVIVISSSPQVHQIHIREGRNDYIINYTLPLVWFRPQKVIKSSQIQITRVKASIPISWGNHNSLLFLNISSIEGTVLEFMVDVLVNNKTFVQLELMMPLMSLAKSRAI-------IYQFRSSI-TWLKYPFNVPKI--LILELNSFLNTMATRISQLFVGNSRVSILPLQIFRDNFDSIYIQRRD------FTFDWTFFVNSEL--------PKSCLISPESIVKSFEKLSTKNVINFNTSAIVSKSTSGCGLMRQALQTTSLPITRKRSTTGPLKTPTVRT-DFQWRPIRIPDSKLF---------VECGIIFQCLLPAAIR----GIQEMFITPVVFTGPKPDWIGFSNNNKSLVGVIAKTICPKR--EFRFMINGSNYKKQVIVNWTLII-EISTPSSSQDQKFQIDMAMISIITFDVIQIIKTIKELKRYTQLDCEEEISCKYNISL--VRPPTKNDE--------TIHMSLEILDYSRVCPQILGIFLRNKLIETP--QRPNSPNPQLKRIFYRYGIGQLNFVSFQLRGKCENKRIFPPDLGEKIIFNNIPYLISLKSFHEFYNSSVELEI--SNISSNGIAYDSYMNWIKIKNKINDSSILYILASTEHTRSHPYIVELTVNPGKRHKMLLPKISFQVKNLMHHPSFIPYIRELNHQISIDVTTNVIIEDTIMPLDITLEVAALADNYMRPSC-------QNASSLDCGADIL---IFLNSVIET 998          
BLAST of SMED30034137 vs. Planmine SMEST
Match: SMESG000026871.1 (SMESG000026871.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.256e-55
Identity = 207/819 (25.27%), Postives = 369/819 (45.05%), Query Frame = 3
Query:  948 LPPIKMHALQIMNYVIPENTFIDKEFKSLLRIKVFSIEDK-IVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYV-----------VKSLKIPKIKIQIFTPIKSPLFFDKKQGNKENLLIFDWFFY--NELSVSTFCNNPKLDLLDQELYFRSFSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTF-PKFQY-------THFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGIENEP-WIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVKTENL-NIDVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPXXXXXXXXXXXXXXXXKNNKICPKLSLIRFHEKYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPDLGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNE---WISVNN---DSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGANILYRRIFNSENMET 3314
            L P+K+   QIMNYVIP   F    + + + +  F  + + +++ +   W+ +  + +NI+  P   + G   L+IC+        C S+ + V    PQ HQI++ +   DYII +T+PL WF    V K   + I +   + P  W    +L  L+++S+EG ++E  +  L+ N++ + + L +P++++ + +         +++FR  I    K  FN+     L+ +L  ++           V + ++  + +QIF      ++  ++         FDW F+  +EL        PK  L+  E   +SF      N+  +      I S S      T     +++  +TT   +  K +    +   T    FQ+       +   V  GI F+  +          I+EM +        +P WI  S +N  L G+  K    +   +FRF+I   N + Q  V + +I+      + S + K ++ +   ++   DV    K + +L +Y + +CE    C  +++L  V      D          I     +   +++CP++  I    K I T    +  +PN  LK++F   G+G++      L G C+  ++ PPDLG+  ++  IP+  SL+ F  FYNS+V   I   N   N + Y+    WI + N   DS+ L  LA   H +S PY++EL V+    HK++ P+I+ +VK LM H SF+P+ ++ NHQI +++     I      L   +  +++ D Y R +C       +N     CGA+IL   IF +  +ET
Sbjct:  243 LSPLKIVDTQIMNYVIPNMVFPLYSYPNGVNLFYFVNKSRELLTAEMNLWLKFTPSTRNIKFQPTTKNRGIHNLEICSNTLSSNESCVSVQVIVISSSPQVHQIHIREGRNDYIINYTLPLVWFRPQKVIKSSQIQITRVKASIPISWGNHNSLLFLNISSIEGTVLEFMVDVLVNNKTFVQLELMMPLMSLAKSRAI-------IYQFRSSI-TWLKYPFNVPKI--LILELNSFLNTMATRISQLFVGNSRVSILPLQIFRDNFDSIYIQRRD------FTFDWTFFVNSEL--------PKSCLISPESIVKSFEKLSTKNV--INFNTSAIVSKS------TSGCGLMRQALQTTSLPITRKRSTTGPLKTPTVRTDFQWRPIRIPDSKLFVECGIIFQCLLPAAIR----GIQEMFITPVVFTGPKPDWIGFSNNNKSLVGVIAKTICPKR--EFRFMINGSNYKKQVIVNWTLII-EISTPSSSQDQKFQIDMAMISIITFDVIQIIKTIKELKRYTQLDCEEEISCKYNISL--VRPPTKNDE--------TIHMSLEILDYSRVCPQILGIFLRNKLIETP--QRPNSPNPQLKRIFYRYGIGQLNFVSFQLRGKCENKRIFPPDLGEKIIFNNIPYLISLKSFHEFYNSSVELEIS--NISSNGIAYDSYMNWIKIKNKINDSSILYILASTEHTRSHPYIVELTVNPGKRHKMLLPKISFQVKNLMHHPSFIPYIRELNHQISIDVTTNVIIEDTIMPLDITLEVAALADNYMRPSC-------QNASSLDCGADIL---IFLNSVIET 998          
BLAST of SMED30034137 vs. Planmine SMEST
Match: SMESG000020071.1 (SMESG000020071.1)

HSP 1 Score: 202.601 bits (514), Expect = 2.555e-52
Identity = 317/1378 (23.00%), Postives = 582/1378 (42.24%), Query Frame = 3
Query:  138 SSVEVHN---LSAYVGYVFEATIIM----------DKKVSLPNWMYW---DNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARPDKIDIENYQSEM---FLAALTFSSEAFLSLSIENKIQLI----IDIKNIMNIKCPIVITSERISRSVTILTKS---NTTILHNKSLVILWSIGKDYIYNPYLKSLQNFESRFNNGPPLK-INHIQIQQWFVGFLHRQRKFSRI----IYRRG------------INNAETVAFIEGSGLLSVKKA-------NELIKRTKENINKTEINHLNKTVIKS----KPSINIQLPPIKMHALQIMNYVIPENTFIDKE--FKSLLRIKVFSIEDK------IVSNDPIKWISYNQNDQNIRINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQNKDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVASMEGRLIEINL-LTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFREKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKIPKIK-------IQIFTPIKSPLF-FDKKQGNKENLLIFDWFFYNELSVSTFCNNPKLDLLDQELYFRS---FSYFFMVNITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEIINKTF-PKFQYTHFTVTAGIPFKSYVLRRTSLDHSNIKEMRL--ETSSGIENEPWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVVHYDLKAMSMNHKIKLSVK-----TENLNI-DVQYRWKLVTQLDKYVRENCEAMNDCGKDVALWDVNSIQAADNPXXXXXXXXXXXXXXXXKNNKICPKLSLIRFHEKYINTAINNKETT-------PNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPDLGQITVYTMIPFYESL--QKFRVFYNSTVWFSIDSGNPYKNKLMYN-------EWISVNNDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQSFLPFFQQPNHQIIVNIRPTSRINPKND----FLSFKVLFSSIMDQYFRSNCIRTGFTIKNLPFPPCGAN---ILY--RRIFNSENMETITFKF-NLIRELTYIKPVDSSPNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLGKIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMFLMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRGGTSPIILAGEYQHSYMPPSRPLILPHEKPPVSPPDYIAEN 3944
            S+VE  N    SA+VG +F  +             +K  S P+W+ +    N  L GLP+  ++G            Y +++ LS+     + R +  D + ++  +    LAA+    +   +L+I  ++ L     +++K    ++    ++S    RS+ +L      +   + +K + ++W IG   +   +LK+LQ  E     G   + I  I ++ W V  L+ + +  R+    +++RG            ++   +   +EGSG+  +          NE    T  N++K        TV+      KP +   L  + +   QI N+ IP  TF D +  +   L +K +    K      I  ND   WISY+++ QNIR  PK   IG   L +CA++     +C+ + I V PP P      V + +   +  H +P  W +        D L     GN+ F ++ +  +  +   ++E R+++I   +T  K    +    TL V  ++        L      F+ +++ + + ++ L      L +       +LK+ KI        + I+  + S  F    +    +++  F   +    + S  C   K  L+D   Y ++    + F++ +I+ +     GIC+ S  P            +K +T+S+   K   + +     F P     +F V AG  F   +  + +++   ++   L  E    + ++ WI LS++  F++GLPLK+HVR+  YKF  ++    +    K +F + V   +  + ++NH I+L+++      EN  I  + +R +L+ ++DK +R +CE    C  D+ L+D+   Q +      S    +     L +    CP  +L + + K IN  I+N E         P  AL +    + +G ++  +I   G C G     PDLG I    ++P   ++    FRV   +       S   Y      N        W++ +  +  L GL M +H  S       +   N + KI S  +   +    +           NH++ + +   S I P  D     L  +   +S ++ Y R  C     +   +    C      IL+   R+ NS+ +  I +   +L+++ +Y K  +    +  N  +  CP ++L+K++  L  E  +  +L  LP +  + +      +     + LG C    N+         E     T P+ +   +D ++MFL+ T++P C+F I  L V LM+A C+++RN       + +  +++ +  G  SP+IL  E   S  PPS+PLILPHEKPP+ PPDY  E+
Sbjct:   24 SNVESTNYCEFSAFVGQIFTMSKTKIRHCVCENYNNKVFSFPDWLMYTGKGNHNLQGLPVNKDIGT-----------YRVSLTLSSCLIINVNRLNNTDPQQFKCNLRWPTLAAIILDVD-LSNLTISQRLNLWNALKLNLKGAAGLRLLEDVSS--FERSIFVLANGLGNSDGRIRSKGVAVVWQIGCGSVEYRHLKTLQWLEKSCLIGEFSQLIGGIPVEMWLVADLYDRDRIRRMKREALWQRGKTGLGLQLNERLMDAKYSGTLLEGSGMPRITGGSGDKPSFNE--SNTIRNVSKIPKIATLPTVVGPPTPFKPVVRRNLSQVVLTIHQINNFKIPRETFYDPQEGYSPKLLVKAYYTSSKTKKKYEIFHNDSY-WISYDKDLQNIRFLPKPPHIGSHKLLLCAFDKQDNNVCERLWIYVRPPTPITKST-VLQISAGVLWVHEMPSQWLDGLTFNTTSD-LTFAIEGNAIFCYDSSKAILQVLTEAVESRILKITFNITNPKEYQTLKYEFTLAVSDVSPVTNILSDL------FQVRLRWTGENLYPLNSIKSFLSEF----ALALKMGKIANYVDPEDLLIYLVLHSRDFRVISRDMTPDDIFAFQIVYKPSKNAS--CE--KAALVDAVPYIQTKQQLANFYIDSISTIP--LKGICNPSQKPTTA--------HLKTSTVSTTIPKPTPKTQRKPPDFNPSLLIDNFDVEAGFAFMRELNIKAAINEKLVRYFNLIDEEEKNVTDKNWIGLSSNGTFIFGLPLKEHVRKLIYKFWIVLYTVTAHI-LKASFSINVKPNNWMSRTINHIIRLTLRINDKSEENSKIKSLSFRVQLMKEIDKVLRPDCEY--KCAMDILLFDLKIYQKSLILIEWSHLPVLDTDGDLKEIGFQCPWNNLKKLY-KNIN-GISNYEIEQRAVQKIPAQALSEELQKAKIGSVVDVKIERMGACAGQV---PDLGVIN-KDLLPNITAICGLGFRVPIKAIQMDKSISQLSYVQLYFENNFAVPRTHWLTASASNQFLYGLPMLIHITSGQKYRLHIFPQNGV-KIQSHFLVTVLPNPFQGSKL-------NHKVTMQLEFIS-IAPLGDNMITGLDLRWKVASALETYIRPQCT---ISTTAVDIQECALRFDVILFSIERVTNSQVLFEIKWSLRSLLQQTSYKKKREIY--STSNYRQYECPREKLLKLKSMLFSEKDN--RLEPLPKLKIHLKTYAGVNLKSAQLKQLGPCININNNE-------PETPLFQTKPSGQ---EDGQKMFLITTVIPVCAFTICILFVALMIALCMKRRN------YSGYMKASQNSQLGPGSPVILPDEIDRSSYPPSKPLILPHEKPPLPPPDYNHES 1317          
The following BLAST results are available for this feature:
BLAST of SMED30034137 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YD538.711e-2121.57Cadherin OS=Echinococcus multilocularis OX=6211 GN... [more]
A0A068WGR94.822e-2021.79Cadherin OS=Echinococcus granulosus OX=6210 GN=Egr... [more]
A0A5K3EJ306.068e-1721.13Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3NYS46.163e-1529.79Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A4Z2CP118.740e-1328.43Dystroglycan isoform 2 OS=Schistosoma japonicum OX... [more]
back to top
BLAST of SMED30034137 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034137 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045996.10.000e+099.08SMESG000045996.1[more]
SMESG000026871.17.425e-5625.27SMESG000026871.1[more]
SMESG000026871.18.010e-5625.21SMESG000026871.1[more]
SMESG000026871.11.256e-5525.27SMESG000026871.1[more]
SMESG000020071.12.555e-5223.00SMESG000020071.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034137 ID=SMED30034137|Name=SMED30034137|organism=Schmidtea mediterranea sexual|type=transcript|length=4064bp
TATCAACGCTTAGATATGCGGAACTTCAACTAGAAAATTTGTTTTAATCT
TCGAATTCGAATAAACGATTTCAAATGAAACAATTCAGCTTTTCTAGGCT
TATTTTTATTCAATTTGCATTTTGGGAGATTTGCTATTCATCAGTTGAAG
TGCATAATCTTTCGGCCTATGTTGGATATGTTTTTGAAGCTACAATAATT
ATGGATAAAAAAGTCTCTCTTCCCAATTGGATGTATTGGGATAATGAAAC
TTTGATTGGTCTTCCATTAGAAAACAACCTTGGAGAACGGTTACTTTTGT
CAAGCACTCCCGGCCAAGAATATATAATCACTGTCAAACTTTCTAATCCT
TGGTGGCGTAAATTAGCAAGACCTGACAAAATTGACATTGAAAATTATCA
GTCGGAAATGTTTCTAGCAGCACTCACATTTAGTAGCGAGGCATTTTTGT
CGTTATCAATAGAAAATAAAATTCAGTTAATAATTGATATAAAAAATATA
ATGAATATTAAATGCCCAATAGTGATAACATCAGAAAGAATTTCCAGATC
AGTGACAATTCTAACCAAAAGTAACACTACAATTTTACACAACAAATCCT
TAGTTATACTTTGGAGCATTGGAAAGGATTACATTTATAATCCCTATTTG
AAGTCTTTACAAAACTTTGAAAGCAGATTTAACAATGGACCACCACTTAA
GATTAACCATATACAAATCCAACAATGGTTTGTAGGGTTTTTGCATCGCC
AAAGAAAATTCAGTAGAATCATTTATAGACGCGGCATTAACAATGCTGAA
ACGGTTGCCTTTATTGAGGGGTCCGGCTTGTTATCTGTCAAGAAAGCCAA
TGAATTGATTAAACGAACAAAAGAAAATATTAATAAAACTGAAATAAACC
ATTTAAACAAAACTGTCATAAAATCTAAACCGTCTATCAATATTCAACTT
CCTCCGATAAAAATGCATGCTTTACAAATTATGAATTATGTCATACCGGA
AAATACTTTTATTGACAAAGAGTTTAAGTCTTTGCTTAGAATTAAAGTCT
TCTCTATCGAAGACAAAATTGTAAGCAACGATCCAATAAAATGGATATCT
TATAACCAAAATGATCAAAATATTAGAATCAATCCAAAATTGACAGACAT
TGGAGAAACGGTTCTTAAGATATGTGCTTATAATGCATTCGGTGGTTATA
TATGTCAAAGCATGTCTATATCAGTAAGTCCTCCACCACCACAAGACCAT
CAAATATACGTATCAAAACAAAATAAAGATTATATCATCAAACATACTGT
ACCTTTAGCATGGTTTAACAGATTTGGAGTTCGAAAACGAAAAGATGTAT
TAATTATAAAAGCTACAGGCAATTCTCCGTTTGACTGGAATGAAACTGGA
AATTTAGAAATTCTCGATGTTGCATCGATGGAGGGCCGACTTATTGAAAT
AAATCTTTTAACTTTAATAAAAAATGAATCAAAAATTTACATTCATCTGA
CCCTTCCAGTGGTCGCAATCAATAGACAAAAACTGGCCACCGGGCCCCTC
TATAGATCAGTATTCAAATTTCGTGAAAAAATCCAAGCTAGCTCAAAAAC
AGTTTTTAATTTAACTGATACTTGGAAACTACTAAAAGATTTAGAAGGTT
ATGTAGTGAAATCACTGAAAATCCCAAAAATAAAAATTCAAATTTTCACT
CCTATTAAATCGCCTTTGTTTTTTGACAAGAAACAAGGAAATAAAGAAAA
TTTATTGATCTTTGATTGGTTTTTCTATAATGAGCTGTCAGTATCAACAT
TTTGCAACAATCCAAAACTTGACTTATTAGATCAAGAGTTGTATTTTCGA
AGTTTTAGTTACTTTTTTATGGTTAATATAACAATTTTGGAAAACCGTTT
TGGTGGGATATGCTCTTTTTCAGTAGATCCAAATCCAGTCACGAAAGATT
TATCAGATATTCAGGAAGTCAAAAGAACGACTCTATCTAGTGTTGACTTG
AAATTAGCAGCTGAACTAGAAATCATCAATAAAACGTTTCCAAAATTTCA
ATATACGCATTTTACTGTGACGGCAGGGATTCCTTTCAAAAGCTACGTTC
TGCGTAGAACATCTCTCGACCATAGCAATATCAAAGAAATGAGATTAGAA
ACCTCTTCCGGTATCGAGAATGAGCCATGGATAGCATTGTCAGCAAGCAA
CGATTTTCTCTATGGACTTCCTTTAAAGAAACATGTGCGTGAATCGGCTT
ATAAATTCAGGTTCATTATAAAACTGAAAAACTCTCAAACTCAATTCAAA
GTTACCTTTCAAGTAATAGTTGTACATTATGATTTGAAGGCAATGTCAAT
GAACCATAAAATAAAATTATCTGTCAAAACCGAAAACTTAAACATTGATG
TCCAATATCGTTGGAAACTTGTTACCCAGCTTGATAAATATGTAAGAGAG
AACTGTGAGGCAATGAATGATTGTGGAAAAGATGTAGCTTTATGGGATGT
CAATTCCATTCAAGCCGCGGATAATCCTTCTTCATCTTCGGTGAGTATTG
AGATCAGTTATATTTCCTTATTATCCAAAAACAATAAAATATGCCCGAAA
CTTTCTCTTATTCGATTTCATGAAAAATATATTAATACGGCGATTAACAA
TAAAGAGACAACTCCTAATTTTGCTTTGAAACAAGTCTTTACTGTGTCGG
GTCTTGGGGAAATAATCGGTTGCCAGATTATTCTCACAGGAATATGCCAG
GGAATGAAGTTGAATCCGCCTGATCTTGGTCAAATCACAGTTTACACTAT
GATTCCATTCTATGAAAGCCTTCAAAAATTCCGAGTTTTTTATAATTCCA
CAGTTTGGTTTTCAATAGATTCCGGGAATCCGTATAAAAATAAGTTGATG
TACAACGAGTGGATATCCGTAAATAATGATTCTACAGCTCTCGTTGGACT
TGCAATGCATGTACACGCTAAATCCGATCCATACTTAATAGAATTAGTCG
TTCATTCAAATACTATTCATAAAATCATGTCACCCAGAATAGCAATCAGA
GTCAAACGTTTGATGGAGCATCAATCCTTCTTACCTTTTTTTCAGCAGCC
AAATCATCAAATAATAGTAAATATTCGGCCAACAAGCCGAATAAATCCAA
AAAATGATTTTCTTTCTTTTAAAGTTTTATTTTCCTCAATTATGGATCAA
TATTTCAGATCAAATTGTATAAGAACCGGGTTCACTATTAAAAATCTTCC
ATTTCCTCCTTGCGGTGCAAATATTCTTTATAGAAGGATTTTCAATTCAG
AAAACATGGAAACAATTACTTTTAAATTTAATTTAATAAGAGAATTAACT
TATATCAAACCAGTTGACAGTTCTCCTAATAACGCTGGGAACGGGTTGAA
AAGTTCCTGTCCAGTTGATCAATTGATAAAAATTGAAAGAAGCCTTATTG
GTGAAAGTGGTTCACCGACTAAATTGGGTATTCTGCCCAGTGTCAATGAA
TATTTTCAGAAATCAAAATTGGGGAAAATTGTTGATATAAATTTCGAATA
TCTTGGTGCATGTTTCCAACAACAAAATCATAGATTTTCTAAAATCGAGG
TTCTTGATGAAATCAACCGGAAGAATACACATCCGACGTTAAAAAAAGTC
AATGATGATAGCCGTCAAATGTTCTTAATGGCTACAATAGTTCCGACTTG
CAGTTTTATAATAATCTCTCTTTGTGTTGGGTTAATGGTTGCGTGCTGTT
TACAAAAAAGAAATCAGAAGTTTATAAGATCCATGAATAGTCATTTTTCA
TCTGCTGAATTCGCCATGAGAGGTGGTACTTCACCAATAATTCTTGCGGG
AGAATATCAGCACTCCTATATGCCTCCGTCACGACCCTTGATTTTGCCAC
ATGAGAAACCTCCGGTATCACCTCCTGATTATATTGCAGAAAATAATTCA
GTTCTTATAAACGATGAAGATGCTTAGCATTTTGTCCACAATGATTTTTT
GATTTTCTTTATTCCATTTTCCAATATTATTTGTACAATATTATAGTTGT
ATAGCCAATTGAAC
back to top

protein sequence of SMED30034137-orf-1

>SMED30034137-orf-1 ID=SMED30034137-orf-1|Name=SMED30034137-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1301bp
MKQFSFSRLIFIQFAFWEICYSSVEVHNLSAYVGYVFEATIIMDKKVSLP
NWMYWDNETLIGLPLENNLGERLLLSSTPGQEYIITVKLSNPWWRKLARP
DKIDIENYQSEMFLAALTFSSEAFLSLSIENKIQLIIDIKNIMNIKCPIV
ITSERISRSVTILTKSNTTILHNKSLVILWSIGKDYIYNPYLKSLQNFES
RFNNGPPLKINHIQIQQWFVGFLHRQRKFSRIIYRRGINNAETVAFIEGS
GLLSVKKANELIKRTKENINKTEINHLNKTVIKSKPSINIQLPPIKMHAL
QIMNYVIPENTFIDKEFKSLLRIKVFSIEDKIVSNDPIKWISYNQNDQNI
RINPKLTDIGETVLKICAYNAFGGYICQSMSISVSPPPPQDHQIYVSKQN
KDYIIKHTVPLAWFNRFGVRKRKDVLIIKATGNSPFDWNETGNLEILDVA
SMEGRLIEINLLTLIKNESKIYIHLTLPVVAINRQKLATGPLYRSVFKFR
EKIQASSKTVFNLTDTWKLLKDLEGYVVKSLKIPKIKIQIFTPIKSPLFF
DKKQGNKENLLIFDWFFYNELSVSTFCNNPKLDLLDQELYFRSFSYFFMV
NITILENRFGGICSFSVDPNPVTKDLSDIQEVKRTTLSSVDLKLAAELEI
INKTFPKFQYTHFTVTAGIPFKSYVLRRTSLDHSNIKEMRLETSSGIENE
PWIALSASNDFLYGLPLKKHVRESAYKFRFIIKLKNSQTQFKVTFQVIVV
HYDLKAMSMNHKIKLSVKTENLNIDVQYRWKLVTQLDKYVRENCEAMNDC
GKDVALWDVNSIQAADNPSSSSVSIEISYISLLSKNNKICPKLSLIRFHE
KYINTAINNKETTPNFALKQVFTVSGLGEIIGCQIILTGICQGMKLNPPD
LGQITVYTMIPFYESLQKFRVFYNSTVWFSIDSGNPYKNKLMYNEWISVN
NDSTALVGLAMHVHAKSDPYLIELVVHSNTIHKIMSPRIAIRVKRLMEHQ
SFLPFFQQPNHQIIVNIRPTSRINPKNDFLSFKVLFSSIMDQYFRSNCIR
TGFTIKNLPFPPCGANILYRRIFNSENMETITFKFNLIRELTYIKPVDSS
PNNAGNGLKSSCPVDQLIKIERSLIGESGSPTKLGILPSVNEYFQKSKLG
KIVDINFEYLGACFQQQNHRFSKIEVLDEINRKNTHPTLKKVNDDSRQMF
LMATIVPTCSFIIISLCVGLMVACCLQKRNQKFIRSMNSHFSSAEFAMRG
GTSPIILAGEYQHSYMPPSRPLILPHEKPPVSPPDYIAENNSVLINDEDA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008465DAG1_C
IPR013783Ig-like_fold
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007016cytoskeletal anchoring at plasma membrane
Vocabulary: cellular component
TermDefinition
GO:0016010dystrophin-associated glycoprotein complex
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 255..275
NoneNo IPR availablePANTHERPTHR21559DYSTROGLYCAN-RELATEDcoord: 661..1292
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.583
NoneNo IPR availableTMHMMTMhelixcoord: 1204..1226
IPR008465Dystroglycan, C-terminalPFAMPF05454DAG1coord: 1109..1291
e-value: 2.9E-12
score: 46.6
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 286..388