coiled-coil domain-containing protein CG32809 isoform X5

Overview
Namecoiled-coil domain-containing protein CG32809 isoform X5
Smed IDSMED30034133
Length (bp)3165
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein CG32809 isoform X5 (SMED30034133) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein CG32809 isoform X5 (SMED30034133) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein CG32809 isoform X5 (SMED30034133) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein CG32809 isoform X5 (SMED30034133) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034133

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034133SMESG000042651.1 SmedASXL_014467SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034133SMESG000042651.1 dd_Smed_v4_13687_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034133SMESG000042651.1 dd_Smed_v6_13687_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Match: KIAA1217 (KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428])

HSP 1 Score: 66.6254 bits (161), Expect = 2.567e-10
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  619 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 739          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Match: KIAA1217 (KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428])

HSP 1 Score: 66.6254 bits (161), Expect = 2.567e-10
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  619 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 739          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Match: KIAA1217 (KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428])

HSP 1 Score: 66.6254 bits (161), Expect = 2.747e-10
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  664 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 784          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Match: KIAA1217 (KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428])

HSP 1 Score: 66.6254 bits (161), Expect = 2.760e-10
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  664 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 784          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Match: KIAA1217 (KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428])

HSP 1 Score: 66.2402 bits (160), Expect = 2.898e-10
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  382 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 502          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Celegans
Match: Y71H2AM.15 (pep chromosome:WBcel235:III:2747130:2752560:-1 gene:WBGene00022180.1 transcript:Y71H2AM.15a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71H2AM.15)

HSP 1 Score: 60.077 bits (144), Expect = 8.146e-9
Identity = 33/122 (27.05%), Postives = 68/122 (55.74%), Query Frame = 3
Query: 1623 EKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            E   +E+ + +   +  L   E  +E +R +VL  + ++ + EVE +   L+ I +  A  K DFP +++ ++Q ++ + E +   +KF++ +   +D SL+ CK L + + T+K+L  VQ+
Sbjct:  524 ESQRNEHASQLAELLHSLTSFETNVETVRGSVLANQKKLRMSEVEDMTEKLTNIGRLAANLKTDFPPIQMAIEQQIKRDMERVVREEKFIRDQSIAVDQSLRRCKALANIMVTMKKLAMVQD 645          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Celegans
Match: Y71H2AM.15 (pep chromosome:WBcel235:III:2747130:2756512:-1 gene:WBGene00022180.1 transcript:Y71H2AM.15b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71H2AM.15)

HSP 1 Score: 60.077 bits (144), Expect = 8.200e-9
Identity = 33/122 (27.05%), Postives = 68/122 (55.74%), Query Frame = 3
Query: 1623 EKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            E   +E+ + +   +  L   E  +E +R +VL  + ++ + EVE +   L+ I +  A  K DFP +++ ++Q ++ + E +   +KF++ +   +D SL+ CK L + + T+K+L  VQ+
Sbjct:  520 ESQRNEHASQLAELLHSLTSFETNVETVRGSVLANQKKLRMSEVEDMTEKLTNIGRLAANLKTDFPPIQMAIEQQIKRDMERVVREEKFIRDQSIAVDQSLRRCKALANIMVTMKKLAMVQD 641          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Match: CG32809 (gene:FBgn0023531 transcript:FBtr0308321)

HSP 1 Score: 117.472 bits (293), Expect = 2.732e-26
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  565 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 753          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Match: CG32809 (gene:FBgn0023531 transcript:FBtr0089815)

HSP 1 Score: 117.472 bits (293), Expect = 2.734e-26
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  566 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 754          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Match: CG32809 (gene:FBgn0023531 transcript:FBtr0333119)

HSP 1 Score: 117.472 bits (293), Expect = 2.844e-26
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  546 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 734          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Match: CG32809 (gene:FBgn0023531 transcript:FBtr0308322)

HSP 1 Score: 117.087 bits (292), Expect = 2.862e-26
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  273 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 461          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Match: CG32809 (gene:FBgn0023531 transcript:FBtr0330408)

HSP 1 Score: 117.472 bits (293), Expect = 3.002e-26
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  566 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 754          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Match: SRCIN1 (si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-699])

HSP 1 Score: 68.9366 bits (167), Expect = 3.691e-11
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 3
Query: 1449 QAELKTLKQEITAL-KRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYT--------PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            Q  L  L+Q  T L K+L Q  ++  +N+  D+   + K   T   L  +        P++ +R+ +E+   +Y  +    I++L DLE ++E+++  +      V + E+E  +  L ++ + L   K  FP L+ +++ +L+ E E +    KFL+ EP RLD+ LK CK +  TL TL+R
Sbjct:  629 QLHLHDLQQNATDLRKQLAQLRKMQLQNQ--DSIRSLLKRTETELSLRLSDALRKQEDPLQRQRLLVEEERLKYLNEEELIIQQLHDLEKSVEEIQKEISVNHRHVTVQELEEKSSMLRKLGETLTELKNQFPGLQSKMRVVLRVEVEAV----KFLKEEPHRLDALLKRCKSITDTLTTLRR 805          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Match: SRCIN1 (si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-699])

HSP 1 Score: 68.5514 bits (166), Expect = 3.884e-11
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 3
Query: 1449 QAELKTLKQEITAL-KRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYT--------PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            Q  L  L+Q  T L K+L Q  ++  +N+  D+   + K   T   L  +        P++ +R+ +E+   +Y  +    I++L DLE ++E+++  +      V + E+E  +  L ++ + L   K  FP L+ +++ +L+ E E +    KFL+ EP RLD+ LK CK +  TL TL+R
Sbjct:  637 QLHLHDLQQNATDLRKQLAQLRKMQLQNQ--DSIRSLLKRTETELSLRLSDALRKQEDPLQRQRLLVEEERLKYLNEEELIIQQLHDLEKSVEEIQKEISVNHRHVTVQELEEKSSMLRKLGETLTELKNQFPGLQSKMRVVLRVEVEAV----KFLKEEPHRLDALLKRCKSITDTLTTLRR 813          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Match: SRCIN1 (si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-699])

HSP 1 Score: 68.5514 bits (166), Expect = 4.246e-11
Identity = 53/183 (28.96%), Postives = 95/183 (51.91%), Query Frame = 3
Query: 1449 QAELKTLKQEITAL-KRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYT--------PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            Q  L  L+Q  T L K+L Q  ++  +N+  D+   + K   T   L  +        P++ +R+ +E+   +Y  +    I++L DLE ++E+++  +      V + E+E  +  L ++ + L   K  FP L+ +++ +L+ E E +    KFL+ EP RLD+ LK CK +  TL TL+R
Sbjct:  520 QLHLHDLQQNATDLRKQLAQLRKMQLQNQ--DSIRSLLKRTETELSLRLSDALRKQEDPLQRQRLLVEEERLKYLNEEELIIQQLHDLEKSVEEIQKEISVNHRHVTVQELEEKSSMLRKLGETLTELKNQFPGLQSKMRVVLRVEVEAV----KFLKEEPHRLDALLKRCKSITDTLTTLRR 696          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Match: si:ch211-285f17.1 (si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607-77])

HSP 1 Score: 67.3958 bits (163), Expect = 8.876e-11
Identity = 42/127 (33.07%), Postives = 69/127 (54.33%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCR--VNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P + +R+ +E+    Y +     + +L DLE  +E LR +      +  V + EVE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  + L  TL  L+R
Sbjct:  746 PTQKQRMLVEEERHRYLSMQERVLTQLGDLEQFVETLRTDSGPAASQRAVTLKEVEDGAVSLRKVGENLAGLKGEFPALQSRMRSVLRVEVEAV----KFLKEEPHKLDSMLKRVRTLTDTLSNLRR 868          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Match: si:ch211-285f17.1 (si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607-77])

HSP 1 Score: 67.3958 bits (163), Expect = 9.578e-11
Identity = 42/127 (33.07%), Postives = 69/127 (54.33%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCR--VNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P + +R+ +E+    Y +     + +L DLE  +E LR +      +  V + EVE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  + L  TL  L+R
Sbjct:  711 PTQKQRMLVEEERHRYLSMQERVLTQLGDLEQFVETLRTDSGPAASQRAVTLKEVEDGAVSLRKVGENLAGLKGEFPALQSRMRSVLRVEVEAV----KFLKEEPHKLDSMLKRVRTLTDTLSNLRR 833          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Match: KIAA1217 (KIAA1217 [Source:NCBI gene;Acc:100496212])

HSP 1 Score: 70.8626 bits (172), Expect = 1.302e-11
Identity = 60/245 (24.49%), Postives = 118/245 (48.16%), Query Frame = 3
Query: 1275 ATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKT-----QAELKTLKQEITALK-RLNQTFRINFKNECNDAFLQMK-------KLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            + PS+  L SA  + S++    N G            ++S    E +  TVIN+ + T        L+ +++ +  L+ +L++  ++  +N+     +  K       K+   + GL   PV+ +R+ +E+   +Y  D    + KL DLE  +E L+ +    +  + + +VE  A  L +I + ++  K +FP L+ +++ +L+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  634 SAPSDRVLKSANGSASSSDRPGNQGV--------AAAKNSLAISETI--TVINQQSSTCSQEMHVSLQDMRRNVAELRLQLHKMRQLQLQNQETVRLMMKKAEMEISSKVTEMVKGLE-DPVQRQRVLVEQERQKYLGDEEQIVAKLCDLEDFVESLKKDQSTSQRSITLKDVEDRAFMLRQIGEAVSNLKGEFPYLQNKMRAVLRVEVEAV----RFLKEEPHKLDSLLKRIRNMTDALSALRR 863          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Match: KIAA1217 (KIAA1217 [Source:NCBI gene;Acc:100496212])

HSP 1 Score: 70.4774 bits (171), Expect = 1.554e-11
Identity = 60/245 (24.49%), Postives = 118/245 (48.16%), Query Frame = 3
Query: 1275 ATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKT-----QAELKTLKQEITALK-RLNQTFRINFKNECNDAFLQMK-------KLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            + PS+  L SA  + S++    N G            ++S    E +  TVIN+ + T        L+ +++ +  L+ +L++  ++  +N+     +  K       K+   + GL   PV+ +R+ +E+   +Y  D    + KL DLE  +E L+ +    +  + + +VE  A  L +I + ++  K +FP L+ +++ +L+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  634 SAPSDRVLKSANGSASSSDRPGNQGV--------AAAKNSLAISETI--TVINQQSSTCSQEMHVSLQDMRRNVAELRLQLHKMRQLQLQNQETVRLMMKKAEMEISSKVTEMVKGLE-DPVQRQRVLVEQERQKYLGDEEQIVAKLCDLEDFVESLKKDQSTSQRSITLKDVEDRAFMLRQIGEAVSNLKGEFPYLQNKMRAVLRVEVEAV----RFLKEEPHKLDSLLKRIRNMTDALSALRR 863          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Match: KIAA1217 (KIAA1217 [Source:NCBI gene;Acc:100496212])

HSP 1 Score: 70.4774 bits (171), Expect = 1.719e-11
Identity = 60/245 (24.49%), Postives = 118/245 (48.16%), Query Frame = 3
Query: 1275 ATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKT-----QAELKTLKQEITALK-RLNQTFRINFKNECNDAFLQMK-------KLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            + PS+  L SA  + S++    N G            ++S    E +  TVIN+ + T        L+ +++ +  L+ +L++  ++  +N+     +  K       K+   + GL   PV+ +R+ +E+   +Y  D    + KL DLE  +E L+ +    +  + + +VE  A  L +I + ++  K +FP L+ +++ +L+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  504 SAPSDRVLKSANGSASSSDRPGNQGV--------AAAKNSLAISETI--TVINQQSSTCSQEMHVSLQDMRRNVAELRLQLHKMRQLQLQNQETVRLMMKKAEMEISSKVTEMVKGLE-DPVQRQRVLVEQERQKYLGDEEQIVAKLCDLEDFVESLKKDQSTSQRSITLKDVEDRAFMLRQIGEAVSNLKGEFPYLQNKMRAVLRVEVEAV----RFLKEEPHKLDSLLKRIRNMTDALSALRR 733          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Match: KIAA1217 (KIAA1217 [Source:NCBI gene;Acc:100496212])

HSP 1 Score: 69.707 bits (169), Expect = 3.176e-11
Identity = 57/233 (24.46%), Postives = 112/233 (48.07%), Query Frame = 3
Query: 1311 SAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKT-----QAELKTLKQEITALK-RLNQTFRINFKNECNDAFLQMK-------KLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            SA  + SS +  G   + +  N    S  +       TVIN+ + T        L+ +++ +  L+ +L++  ++  +N+     +  K       K+   + GL   PV+ +R+ +E+   +Y  D    + KL DLE  +E L+ +    +  + + +VE  A  L +I + ++  K +FP L+ +++ +L+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  484 SANGSASSSDRPGNQGVAAAKNSLAISETI-------TVINQQSSTCSQEMHVSLQDMRRNVAELRLQLHKMRQLQLQNQETVRLMMKKAEMEISSKVTEMVKGLE-DPVQRQRVLVEQERQKYLGDEEQIVAKLCDLEDFVESLKKDQSTSQRSITLKDVEDRAFMLRQIGEAVSNLKGEFPYLQNKMRAVLRVEVEAV----RFLKEEPHKLDSLLKRIRNMTDALSALRR 704          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Match: KIAA1217 (KIAA1217 [Source:NCBI gene;Acc:100496212])

HSP 1 Score: 69.3218 bits (168), Expect = 3.397e-11
Identity = 50/196 (25.51%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 1422 TVINKINKT-----QAELKTLKQEITALK-RLNQTFRINFKNECNDAFLQMK-------KLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            TVIN+ + T        L+ +++ +  L+ +L++  ++  +N+     +  K       K+   + GL   PV+ +R+ +E+   +Y  D    + KL DLE  +E L+ +    +  + + +VE  A  L +I + ++  K +FP L+ +++ +L+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  611 TVINQQSSTCSQEMHVSLQDMRRNVAELRLQLHKMRQLQLQNQETVRLMMKKAEMEISSKVTEMVKGLE-DPVQRQRVLVEQERQKYLGDEEQIVAKLCDLEDFVESLKKDQSTSQRSITLKDVEDRAFMLRQIGEAVSNLKGEFPYLQNKMRAVLRVEVEAV----RFLKEEPHKLDSLLKRIRNMTDALSALRR 801          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Match: Srcin1 (SRC kinase signaling inhibitor 1 [Source:MGI Symbol;Acc:MGI:1933179])

HSP 1 Score: 65.855 bits (159), Expect = 2.798e-10
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  579 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 699          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Match: Srcin1 (SRC kinase signaling inhibitor 1 [Source:MGI Symbol;Acc:MGI:1933179])

HSP 1 Score: 65.855 bits (159), Expect = 2.832e-10
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  708 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 828          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Match: Srcin1 (SRC kinase signaling inhibitor 1 [Source:MGI Symbol;Acc:MGI:1933179])

HSP 1 Score: 65.855 bits (159), Expect = 2.851e-10
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  741 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 861          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Match: Srcin1 (SRC kinase signaling inhibitor 1 [Source:MGI Symbol;Acc:MGI:1933179])

HSP 1 Score: 65.855 bits (159), Expect = 3.069e-10
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  708 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 828          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Match: Srcin1 (SRC kinase signaling inhibitor 1 [Source:MGI Symbol;Acc:MGI:1933179])

HSP 1 Score: 65.855 bits (159), Expect = 3.090e-10
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  742 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 862          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Match: sp|Q7PQ25|CCDCX_ANOGA (Coiled-coil domain-containing protein AGAP005037 OS=Anopheles gambiae OX=7165 GN=AGAP005037 PE=4 SV=4)

HSP 1 Score: 122.865 bits (307), Expect = 6.457e-27
Identity = 70/188 (37.23%), Postives = 108/188 (57.45%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N++   Q +   L+ E+  L+RL QT  +  + +  D F++++  + +  G  +     ER N+ +    Y  +V    + L DLE ++E LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L+  L+ ++  E E +   + FL+ EP RL+++L+ CKKL  TL TLKRL SVQE
Sbjct:  555 VYNQLRGLQKKAMDLRTEVRTLRRLTQTQAVAVREDIKDTFMRIRATLLSNSGFVWGQGDKERTNLTREEEIYKQEVIRLEKDLADLESSVEGLRGEVINRRTRVNMVAVEDMALVLSRASKTVAELKMRFPVLQQGLRNLISNEMEHVCREEAFLKDEPDRLENALRRCKKLTGTLVTLKRLASVQE 742          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Match: sp|Q7KW14|CCDCX_DROME (Coiled-coil domain-containing protein CG32809 OS=Drosophila melanogaster OX=7227 GN=CG32809 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.740e-25
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNE---RINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQE 1988
            V N +   Q + K L+ E+  L+RL+Q   +  + +    F++++  +    G  +    ++   RI+ E+ +  Y  +V    + L DLE ++E+LR  V+NR+ RVN+  VE +AL LSR SK +A  K  FP L   L+ IL  E E +   +KFL+ EP RL+S+L+ CKKL  TL TLKRL SVQE
Sbjct:  566 VYNHLRGLQKKAKDLRMEVRTLRRLSQAQAVAVREDIKGTFMRIRATLLASSGSFWDHQGDQDATRISREEEL--YKQEVIRLEKDLSDLEGSVENLRGEVINRRTRVNMTAVEDMALVLSRASKTVAELKLKFPSLSNGLRCILSNEMEKVVREEKFLKEEPDRLESALRRCKKLTGTLVTLKRLASVQE 754          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Match: sp|Q5T5P2|SKT_HUMAN (Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 1.572e-9
Identity = 38/125 (30.40%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            PV+ +R+ +E+   +Y  +    ++KL +LE  +EDL+ +       V + +VE  A  L ++ + +A  K +FP L+ +++ IL+ E E +    +FL+ EP +LDS LK  + +   L  L+R
Sbjct:  699 PVQRQRVLVEQERQKYLHEEEKIVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMRAILRIEVEAV----RFLKEEPHKLDSLLKRVRSMTDVLTMLRR 819          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Match: sp|Q9QXY2|SRCN1_RAT (SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.717e-9
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  741 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVAHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRVVTDTLAQIRR 861          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Match: sp|Q9C0H9|SRCN1_HUMAN (SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4)

HSP 1 Score: 65.0846 bits (157), Expect = 3.643e-9
Identity = 40/125 (32.00%), Postives = 70/125 (56.00%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+    Y  D     ++L DLE ++E ++ +V +    V   E+E  AL L ++ + L   KA FP L+ +++ +L+ E E +    KFL+ EP+RLD  LK C+ +  TL  ++R
Sbjct:  707 PLQRQRTLVEEERLRYLNDEELITQQLNDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAV----KFLKEEPQRLDGLLKRCRGVTDTLAQIRR 827          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Match: A0A0X3P2G3 (Coiled-coil domain-containing protein CG32809 OS=Schistocephalus solidus OX=70667 GN=CCDCX PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 3.470e-53
Identity = 168/570 (29.47%), Postives = 283/570 (49.65%), Query Frame = 3
Query:  654 LVCTCPPEVHKALLEQQLIQIP-------NHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQ--MCGQINQIPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQ--------QAICHSRQISV--PETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQAXXXXXXXXQSTHVP---PVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSL-DSAYSAKSTTSSD------NNSGYYKITS---------TGNCQIQSSPVFEE-KLPGTV---INKINKTQ-----AELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTLRDI 2222
            LVCTCPPE+H+ + + QL   P       N  ++ +LP           + +IK       + SQQ  +  Q N  P  S L +A   S   +   ++ T + + +  +++P               +    +++   P+T+ EA+ +I  ME Q+ +LT+W++     Q             + T  P   P+  +  LS+  +  PC      C               P   S+ D+A S K   SSD      + + Y ++ S          G  ++Q+    E  ++P ++   ++ + +TQ       L+ +K ++  L+R  ++   + +   +D F ++++L+        + +R  R++++  +S Y  D N   + L DLE  IE+LR++ L R+CRV++ EVE  ALHLSR+S  L   K + PEL+      L  E +++ L+++FL  EPKRLD++L  CK+L  TLFTLKRLGSVQE+  S ++P +R+ RDP+P+DKQ  L+ IR I PDH+ R+  +   ++ R  R+RMLS  +SLKFE+S+  + R L  I
Sbjct:  133 LVCTCPPELHQVIRQSQLPDRPCELVHSTNTQRYPNLPS----------KDIIKETSEALKLPSQQSTIPAQDN-FPDASSLTTAGRWS-TDNFQESDSTDTTSGSGQVAFPIIRGGIPPDVLLTPGVADKFRLATKPPQTLEEAQTRITLMEDQMAFLTSWVRAVQEQQG---------GQIKRTAGPEDSPINRTSLLSKSSSGYPCSYKEDFC---------------PIGPSIPDNAQSPKIANSSDSFCQNVDTTKYVRLPSPKTSNWILQCGRSELQTQARMEVLQVPPSIRCGLDNLKRTQLLHVSKRLREVKNDLGNLRRTQESNIGDLRQISSDLFGEIRRLLEKSSPKKMSTLRAARLDLDSQISTYLTDCNEVEDWLRDLESCIEELRIDALQRRCRVSVSEVETYALHLSRLSGRLVAFKEELPELKRATTTALLAEKKVVQLHERFLDEEPKRLDAALSSCKQLTCTLFTLKRLGSVQEHGLSVNVPPLRTIRDPQPEDKQLYLQQIRNIIPDHEARVLGLACHKRARLRRKRMLSLKDSLKFEQSVGESRRNLDSI 666          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Match: A0A0X3PEP3 (AIP3 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR143604 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 7.473e-53
Identity = 168/574 (29.27%), Postives = 285/574 (49.65%), Query Frame = 3
Query:  642 NQNHLVCTCPPEVHKALLEQQLIQIP-------NHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQ--MCGQINQIPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQ--------QAICHSRQISV--PETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQAXXXXXXXXQSTHVP---PVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSL-DSAYSAKSTTSSD------NNSGYYKITS---------TGNCQIQSSPVFEE-KLPGTV---INKINKTQ-----AELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTLRDI 2222
            ++  LVCTCPPE+H+ + + QL   P       N  ++ +LP           + +IK       + SQQ  +  Q N  P  S L +A   S   +   ++ T + + +  +++P               +    +++   P+T+ EA+ +I  ME Q+ +LT+W++     Q             + T  P   P+  +  LS+  +  PC      C               P   S+ D+A S K   SSD      + + Y ++ S          G  ++Q+    E  ++P ++   ++ + +TQ       L+ +K ++  L+R  ++   + +   +D F ++++L+        + +R  R++++  +S Y  D N   + L DLE  IE+LR++ L R+CRV++ EVE  ALHLSR+S  L   K + PEL+      L  E +++ L+++FL  EPKRLD++L  CK+L  TLFTLKRLGSVQE+  S ++P +R+ RDP+P+DKQ  L+ IR I PDH+ R+  +   ++ R  R+RMLS  +SLKFE+S+  + R L  I
Sbjct:  401 SKEKLVCTCPPELHQVIRQSQLPDRPCELVHSTNTQRYPNLPS----------KDIIKETSEALKLPSQQSTIPAQDN-FPDASSLTTAGRWS-TDNFQESDSTDTTSGSGQVAFPIIRGGIPPDVLLTPGVADKFRLATKPPQTLEEAQTRITLMEDQMAFLTSWVRAVQEQQG---------GQIKRTAGPEDSPINRTSLLSKSSSGYPCSYKEDFC---------------PIGPSIPDNAQSPKIANSSDSFCQNVDTTKYVRLPSPKTSNWILQCGRSELQTQARMEVLQVPPSIRCGLDNLKRTQLLHVSKRLREVKNDLGNLRRTQESNIGDLRQISSDLFGEIRRLLEKSSPKKMSTLRAARLDLDSQISTYLTDCNEVEDWLRDLESCIEELRIDALQRRCRVSVSEVETYALHLSRLSGRLVAFKEELPELKRATTTALLAEKKVVQLHERFLDEEPKRLDAALSSCKQLTCTLFTLKRLGSVQEHGLSVNVPPLRTIRDPQPEDKQLYLQQIRNIIPDHEARVLGLACHKRARLRRKRMLSLKDSLKFEQSVGESRRNLDSI 938          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Match: A0A1S3H2C0 (coiled-coil domain-containing protein CG32809 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106151392 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.286e-45
Identity = 107/266 (40.23%), Postives = 164/266 (61.65%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRS---NRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTL 2213
            V + I   QA+ K LK E   L+R+ +    N ++   +AF ++K  +  +PG +  P+R  R   +     +  D      +L DLE ++E+LR +V+NR+CRVN+ +VE +AL LS ISK L   K  FP L+  LK ++  E E++   +K+L+ EP+RL+S+LK CKKL  TLFTLKRL SVQE+  +  +P++ +     D    +K+A+ E I+ + P+HD RM  IE +E  RE ++++++SHE  KFEKSLELA+R L
Sbjct:  497 VQDSIRGLQAKAKELKTECRNLRRIQEAQADNIRDTIREAFEKIKDAMTGVPGASGHPLRARRSRADVHCDTFKQDCKRVENELSDLESSVEELRSDVINRRCRVNMADVESMALALSHISKALGELKGGFPVLQEELKTVMTAEMEVVVKEEKYLKDEPERLESALKKCKKLTGTLFTLKRLASVQEHR-TPVVPQLMTMTVGED----EKKALFENIQHMIPNHDARMLSIEASENSRERKKKLVTSHEVRKFEKSLELASRAL 757          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Match: A0A1S3H4M9 (coiled-coil domain-containing protein CG32809 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106151392 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.328e-45
Identity = 107/266 (40.23%), Postives = 164/266 (61.65%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRS---NRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTL 2213
            V + I   QA+ K LK E   L+R+ +    N ++   +AF ++K  +  +PG +  P+R  R   +     +  D      +L DLE ++E+LR +V+NR+CRVN+ +VE +AL LS ISK L   K  FP L+  LK ++  E E++   +K+L+ EP+RL+S+LK CKKL  TLFTLKRL SVQE+  +  +P++ +     D    +K+A+ E I+ + P+HD RM  IE +E  RE ++++++SHE  KFEKSLELA+R L
Sbjct:  444 VQDSIRGLQAKAKELKTECRNLRRIQEAQADNIRDTIREAFEKIKDAMTGVPGASGHPLRARRSRADVHCDTFKQDCKRVENELSDLESSVEELRSDVINRRCRVNMADVESMALALSHISKALGELKGGFPVLQEELKTVMTAEMEVVVKEEKYLKDEPERLESALKKCKKLTGTLFTLKRLASVQEHR-TPVVPQLMTMTVGED----EKKALFENIQHMIPNHDARMLSIEASENSRERKKKLVTSHEVRKFEKSLELASRAL 704          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Match: A0A1S3H247 (coiled-coil domain-containing protein AGAP005037 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106151392 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.463e-45
Identity = 107/266 (40.23%), Postives = 164/266 (61.65%), Query Frame = 3
Query: 1425 VINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRS---NRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTL 2213
            V + I   QA+ K LK E   L+R+ +    N ++   +AF ++K  +  +PG +  P+R  R   +     +  D      +L DLE ++E+LR +V+NR+CRVN+ +VE +AL LS ISK L   K  FP L+  LK ++  E E++   +K+L+ EP+RL+S+LK CKKL  TLFTLKRL SVQE+  +  +P++ +     D    +K+A+ E I+ + P+HD RM  IE +E  RE ++++++SHE  KFEKSLELA+R L
Sbjct:  484 VQDSIRGLQAKAKELKTECRNLRRIQEAQADNIRDTIREAFEKIKDAMTGVPGASGHPLRARRSRADVHCDTFKQDCKRVENELSDLESSVEELRSDVINRRCRVNMADVESMALALSHISKALGELKGGFPVLQEELKTVMTAEMEVVVKEEKYLKDEPERLESALKKCKKLTGTLFTLKRLASVQEHR-TPVVPQLMTMTVGED----EKKALFENIQHMIPNHDARMLSIEASENSRERKKKLVTSHEVRKFEKSLELASRAL 744          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Match: si:ch211-285f17.1 (si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607-77])

HSP 1 Score: 78.5666 bits (192), Expect = 3.058e-14
Identity = 70/245 (28.57%), Postives = 116/245 (47.35%), Query Frame = 3
Query: 1278 TPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQI---QSSPVFEEKLPG-TVINKINKTQAELKTLKQEITALK-RLNQTFRINFKN-ECNDAFLQMKKLIHTIPGL-------NYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNR-KCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            TPS++         S  S  + S  +  +S GN  +   +S+ V  E+ P  T        Q  L   ++ ++ L+ +L Q  +I  +N EC    +QMK++   I             P   +R  +E+    Y       + +L DLE  +E L+ +  +    RV++ EVE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  +L TL+R
Sbjct:  654 TPSSNGCSGGMEQASDRSVKSGSPVHSTSSAGNSPVLGPKSAAVPPERSPALTPPLSSAPLQVNLHQFRRNVSDLRVQLQQMRQIQLQNQEC--VRVQMKQVEQEISARLSEALRRQEDPSHRQRAAVEEERHTYLCMEEKVLTQLGDLESYVESLKRDWSSGLGSRVSLKEVEEGAVSLRKVGESLAGLKGEFPALQGRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDSLSTLRR 892          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Match: si:ch211-285f17.1 (si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607-77])

HSP 1 Score: 73.9442 bits (180), Expect = 6.505e-13
Identity = 65/224 (29.02%), Postives = 109/224 (48.66%), Query Frame = 3
Query: 1341 NSGYYKITSTGNCQI---QSSPVFEEKLPG-TVINKINKTQAELKTLKQEITALK-RLNQTFRINFKN-ECNDAFLQMKKLIHTIPGL-------NYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNR-KCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            NS ++    +GN  +   +S+ V  E+ P  T        Q  L   ++ ++ L+ +L Q  +I  +N EC    +QMK++   I             P   +R  +E+    Y       + +L DLE  +E L+ +  +    RV++ EVE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  +L TL+R
Sbjct:  338 NSCWFCFVCSGNSPVLGPKSAAVPPERSPALTPPLSSAPLQVNLHQFRRNVSDLRVQLQQMRQIQLQNQEC--VRVQMKQVEQEISARLSEALRRQEDPSHRQRAAVEEERHTYLCMEEKVLTQLGDLESYVESLKRDWSSGLGSRVSLKEVEEGAVSLRKVGESLAGLKGEFPALQGRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDSLSTLRR 555          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Match: si:ch211-278a6.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002179.1:131679:220089:-1 gene:ENSAMXG00000005298.2 transcript:ENSAMXT00000037008.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:si:ch211-278a6.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.474e-11
Identity = 54/193 (27.98%), Postives = 102/193 (52.85%), Query Frame = 3
Query: 1419 GTVINKINKTQAELKTLKQEITAL-KRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYT--------PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            G+ ++++ + Q  L  L+Q  T L K+L+Q  ++  +N+  D+   + K       +  +        P++ +R+ +E+   +Y  +    I++L DLE ++++++         V++ E+E  A  L R+ + L   K  FP L+ +++ +L+ E E +    KFL+ EP RLD+ LK CK +  TL TLKR
Sbjct:  666 GSTVSRL-QMQLHLHELRQNATDLRKQLDQLRKMQLQNQ--DSVRTLMKRTEAELSVRVSDALRKQEDPLQRQRLLVEEERLKYLNEEELIIQQLHDLEKSVDEIQKESSVNHRHVSVQELEEKATVLRRLGETLTELKNQFPGLQSKMRVVLRVEVEAV----KFLKEEPHRLDALLKRCKTITDTLTTLKR 851          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Match: si:ch211-207d6.2 (si:ch211-207d6.2 [Source:ZFIN;Acc:ZDB-GENE-070912-185])

HSP 1 Score: 69.707 bits (169), Expect = 1.801e-11
Identity = 38/127 (29.92%), Postives = 72/127 (56.69%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCR--VNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P+  +R  +++    Y A     + +L DLE  +E+L+ + ++      + + +VE  A++L ++ + LA  K +FP L+L+++ +L+ E E +    +FL+ EP ++DS LK  K L  TL  L+R
Sbjct:  694 PLNKQRSQVDEERHRYLAMEEKVLLQLGDLEKHVENLKRDSMSMPAHHPITLRDVEEGAVNLRKVGEALAALKGEFPALQLKMRSVLRVEVEAV----RFLKEEPHKMDSMLKRVKALTETLGRLRR 816          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Match: si:ch211-207d6.2 (si:ch211-207d6.2 [Source:ZFIN;Acc:ZDB-GENE-070912-185])

HSP 1 Score: 69.707 bits (169), Expect = 1.885e-11
Identity = 38/127 (29.92%), Postives = 72/127 (56.69%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCR--VNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P+  +R  +++    Y A     + +L DLE  +E+L+ + ++      + + +VE  A++L ++ + LA  K +FP L+L+++ +L+ E E +    +FL+ EP ++DS LK  K L  TL  L+R
Sbjct:  694 PLNKQRSQVDEERHRYLAMEEKVLLQLGDLEKHVENLKRDSMSMPAHHPITLRDVEEGAVNLRKVGEALAALKGEFPALQLKMRSVLRVEVEAV----RFLKEEPHKMDSMLKRVKALTETLGRLRR 816          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Match: si:ch211-285f17.1 (KIAA1217 ortholog [Source:NCBI gene;Acc:101158314])

HSP 1 Score: 66.2402 bits (160), Expect = 1.849e-10
Identity = 38/125 (30.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+   +Y       + +L +LE  +  L+ +    +  V + +VE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  TL  ++R
Sbjct:  685 PIQRQRSLVEEDRHKYLGLEEHVLTQLNELEQYVGSLQKDSATAQKVVTLKDVEEGAITLRKVGESLAGLKGEFPGLQTRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDTLSNMRR 805          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Match: si:ch211-285f17.1 (KIAA1217 ortholog [Source:NCBI gene;Acc:101158314])

HSP 1 Score: 66.2402 bits (160), Expect = 2.068e-10
Identity = 38/125 (30.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+   +Y       + +L +LE  +  L+ +    +  V + +VE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  TL  ++R
Sbjct:  794 PIQRQRSLVEEDRHKYLGLEEHVLTQLNELEQYVGSLQKDSATAQKVVTLKDVEEGAITLRKVGESLAGLKGEFPGLQTRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDTLSNMRR 914          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Match: si:ch211-285f17.1 (KIAA1217 ortholog [Source:NCBI gene;Acc:101158314])

HSP 1 Score: 66.2402 bits (160), Expect = 2.216e-10
Identity = 38/125 (30.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+   +Y       + +L +LE  +  L+ +    +  V + +VE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  TL  ++R
Sbjct:  685 PIQRQRSLVEEDRHKYLGLEEHVLTQLNELEQYVGSLQKDSATAQKVVTLKDVEEGAITLRKVGESLAGLKGEFPGLQTRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDTLSNMRR 805          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Match: si:ch211-285f17.1 (KIAA1217 ortholog [Source:NCBI gene;Acc:101158314])

HSP 1 Score: 65.855 bits (159), Expect = 2.325e-10
Identity = 38/125 (30.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+   +Y       + +L +LE  +  L+ +    +  V + +VE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  TL  ++R
Sbjct:  650 PIQRQRSLVEEDRHKYLGLEEHVLTQLNELEQYVGSLQKDSATAQKVVTLKDVEEGAITLRKVGESLAGLKGEFPGLQTRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDTLSNMRR 770          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Match: si:ch211-285f17.1 (KIAA1217 ortholog [Source:NCBI gene;Acc:101158314])

HSP 1 Score: 65.855 bits (159), Expect = 2.385e-10
Identity = 38/125 (30.40%), Postives = 68/125 (54.40%), Query Frame = 3
Query: 1596 PVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKR 1970
            P++ +R  +E+   +Y       + +L +LE  +  L+ +    +  V + +VE  A+ L ++ + LA  K +FP L+ R++ +L+ E E +    KFL+ EP +LDS LK  K L  TL  ++R
Sbjct:  767 PIQRQRSLVEEDRHKYLGLEEHVLTQLNELEQYVGSLQKDSATAQKVVTLKDVEEGAITLRKVGESLAGLKGEFPGLQTRMRAVLRVEVEAV----KFLKEEPHKLDSMLKRVKTLTDTLSNMRR 887          
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Planmine SMEST
Match: SMESG000042651.1 (SMESG000042651.1)

HSP 1 Score: 1529.61 bits (3959), Expect = 0.000e+0
Identity = 824/828 (99.52%), Postives = 828/828 (100.00%), Query Frame = 3
Query:  402 MRNSGTNKQQYQIDRNILKMSPQMSNSRHPISNSKIDSINNPQSDNCATVNQWKMHQVPIPSQIHMNQYIAQQIQNHLKSNQNHLVCTCPPEVHKALLEQQLIQIPNHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQMCGQINQIPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQQAICHSRQISVPETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQAXXXXXXXXQSTHVPPVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKTQAELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTLRDIKFSPVTNSERISNKDINHTNKVSVGTNSREXXXXXXXXXXXVEPLVLKPDIPVINKDIPHKTIPDFIQRLPLINNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNLKQTTILKTXXXXXXXXXXXKVAFNRMVTVEDGSEFLQLNCPDDDYDEDLSSMTLTSXXXXXXXRLSSQDETVSAPEADIIEGNSRPSNIWYQQYHNSTNGRVPKTES 2885
            MRNSGTNKQQYQIDRNILKMSPQMSNSRHPISNSKIDSINNPQSDNCATVNQWKMHQVPIPSQIHMNQYIAQQIQNHLKSNQNHLVCTCPPEVHKALLEQQLIQIPNHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQMCGQINQIPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQQAICHSRQISVPETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQANNNSVNNNQSTHVPPVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVI+KINKTQAELK+LKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKS+SEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTLRDIKFSPVTNSERIS+KDINHTNKVSVGTNSRETDSLSSLTDSDVEPLVLKPDIPVINKDIPHKTIPDFIQRLPLINNLSHTSSSDTSNEHDSSDNASSSHSRSVGSSKPSSSKLNLKQTTILKTSQHSSRSNRSSKVAFNRMVTVEDGSEFLQLNCPDDDYDEDLSSMTLTSPPPPPPPRLSSQDETVSAPEADIIEGNSRPSNIWYQQYHNSTNGRVPKTES
Sbjct:    1 MRNSGTNKQQYQIDRNILKMSPQMSNSRHPISNSKIDSINNPQSDNCATVNQWKMHQVPIPSQIHMNQYIAQQIQNHLKSNQNHLVCTCPPEVHKALLEQQLIQIPNHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQMCGQINQIPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQQAICHSRQISVPETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQANNNSVNNNQSTHVPPVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSLDSAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVISKINKTQAELKSLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPVRNERINIEKSISEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDEVEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTEPKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDKQAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELAARTLRDIKFSPVTNSERISDKDINHTNKVSVGTNSRETDSLSSLTDSDVEPLVLKPDIPVINKDIPHKTIPDFIQRLPLINNLSHTSSSDTSNEHDSSDNASSSHSRSVGSSKPSSSKLNLKQTTILKTSQHSSRSNRSSKVAFNRMVTVEDGSEFLQLNCPDDDYDEDLSSMTLTSPPPPPPPRLSSQDETVSAPEADIIEGNSRPSNIWYQQYHNSTNGRVPKTES 828          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA12172.567e-1030.40KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428][more]
KIAA12172.567e-1030.40KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428][more]
KIAA12172.747e-1030.40KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428][more]
KIAA12172.760e-1030.40KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428][more]
KIAA12172.898e-1030.40KIAA1217 [Source:HGNC Symbol;Acc:HGNC:25428][more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y71H2AM.158.146e-927.05pep chromosome:WBcel235:III:2747130:2752560:-1 gen... [more]
Y71H2AM.158.200e-927.05pep chromosome:WBcel235:III:2747130:2756512:-1 gen... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG328092.732e-2638.22gene:FBgn0023531 transcript:FBtr0308321[more]
CG328092.734e-2638.22gene:FBgn0023531 transcript:FBtr0089815[more]
CG328092.844e-2638.22gene:FBgn0023531 transcript:FBtr0333119[more]
CG328092.862e-2638.22gene:FBgn0023531 transcript:FBtr0308322[more]
CG328093.002e-2638.22gene:FBgn0023531 transcript:FBtr0330408[more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRCIN13.691e-1128.96si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
SRCIN13.884e-1128.96si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
SRCIN14.246e-1128.96si:ch211-278a6.1 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
si:ch211-285f17.18.876e-1133.07si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
si:ch211-285f17.19.578e-1133.07si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA12171.302e-1124.49KIAA1217 [Source:NCBI gene;Acc:100496212][more]
KIAA12171.554e-1124.49KIAA1217 [Source:NCBI gene;Acc:100496212][more]
KIAA12171.719e-1124.49KIAA1217 [Source:NCBI gene;Acc:100496212][more]
KIAA12173.176e-1124.46KIAA1217 [Source:NCBI gene;Acc:100496212][more]
KIAA12173.397e-1125.51KIAA1217 [Source:NCBI gene;Acc:100496212][more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srcin12.798e-1032.00SRC kinase signaling inhibitor 1 [Source:MGI Symbo... [more]
Srcin12.832e-1032.00SRC kinase signaling inhibitor 1 [Source:MGI Symbo... [more]
Srcin12.851e-1032.00SRC kinase signaling inhibitor 1 [Source:MGI Symbo... [more]
Srcin13.069e-1032.00SRC kinase signaling inhibitor 1 [Source:MGI Symbo... [more]
Srcin13.090e-1032.00SRC kinase signaling inhibitor 1 [Source:MGI Symbo... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7PQ25|CCDCX_ANOGA6.457e-2737.23Coiled-coil domain-containing protein AGAP005037 O... [more]
sp|Q7KW14|CCDCX_DROME2.740e-2538.22Coiled-coil domain-containing protein CG32809 OS=D... [more]
sp|Q5T5P2|SKT_HUMAN1.572e-930.40Sickle tail protein homolog OS=Homo sapiens OX=960... [more]
sp|Q9QXY2|SRCN1_RAT2.717e-932.00SRC kinase signaling inhibitor 1 OS=Rattus norvegi... [more]
sp|Q9C0H9|SRCN1_HUMAN3.643e-932.00SRC kinase signaling inhibitor 1 OS=Homo sapiens O... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P2G33.470e-5329.47Coiled-coil domain-containing protein CG32809 OS=S... [more]
A0A0X3PEP37.473e-5329.27AIP3 domain-containing protein OS=Schistocephalus ... [more]
A0A1S3H2C01.286e-4540.23coiled-coil domain-containing protein CG32809 isof... [more]
A0A1S3H4M91.328e-4540.23coiled-coil domain-containing protein CG32809 isof... [more]
A0A1S3H2471.463e-4540.23coiled-coil domain-containing protein AGAP005037 i... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-285f17.13.058e-1428.57si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
si:ch211-285f17.16.505e-1329.02si:ch211-285f17.1 [Source:ZFIN;Acc:ZDB-GENE-000607... [more]
si:ch211-278a6.11.474e-1127.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:ch211-207d6.21.801e-1129.92si:ch211-207d6.2 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
si:ch211-207d6.21.885e-1129.92si:ch211-207d6.2 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-285f17.11.849e-1030.40KIAA1217 ortholog [Source:NCBI gene;Acc:101158314][more]
si:ch211-285f17.12.068e-1030.40KIAA1217 ortholog [Source:NCBI gene;Acc:101158314][more]
si:ch211-285f17.12.216e-1030.40KIAA1217 ortholog [Source:NCBI gene;Acc:101158314][more]
si:ch211-285f17.12.325e-1030.40KIAA1217 ortholog [Source:NCBI gene;Acc:101158314][more]
si:ch211-285f17.12.385e-1030.40KIAA1217 ortholog [Source:NCBI gene;Acc:101158314][more]
back to top
BLAST of coiled-coil domain-containing protein CG32809 isoform X5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042651.10.000e+099.52SMESG000042651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034133 ID=SMED30034133|Name=coiled-coil domain-containing protein CG32809 isoform X5|organism=Schmidtea mediterranea sexual|type=transcript|length=3165bp
CTCGACATCAAAACTGGTTAGATTAAAATAAATATTGTGGAACAGAAAAT
CATTGTTGTCGTAGCATATTGATTCATGCCCATTACTGCATGGAAGAGAC
ACACAACTTTATTAATGAATCTACAAATTTATAGACTGACACACACGCAT
GGGGAAGAAAATTTTCTCTCACAGAATTCTGCATACACACACGGTTGACT
TGTTTGTACCGCTTATGAGATCATGGCAGTTTATCTGAGTAGCTATTGCT
AGCTTTCAATCGCAAACATTTAATATTCCAATTTGTTATGAATAATTTCC
ATTCGAAAGCATAAGTGAATTTTAAATTTTGAATTTTTCTGGAATCATTA
TTCTATGAAAATCGGATTTTACTTTCTAAAATAACAGTAAATCTCGATAA
AATGCGAAACTCTGGAACTAATAAACAACAATATCAAATTGATAGAAATA
TACTCAAAATGTCTCCTCAAATGTCTAACAGTCGCCATCCAATCTCAAAT
TCCAAAATCGATTCAATTAATAATCCGCAATCCGACAATTGTGCTACTGT
AAACCAATGGAAAATGCACCAAGTTCCCATTCCATCACAGATCCATATGA
ATCAATATATTGCACAACAGATACAGAATCATTTAAAATCCAATCAGAAC
CATTTGGTGTGCACTTGTCCACCCGAAGTTCATAAAGCTTTACTAGAACA
ACAGCTTATACAAATACCAAATCATCATCAACATGCTCATTTACCACAGA
TCCATTTTCAACCTTGTCAACATCAGAGACAAGTTATGATTAAACCGGTT
GTTTCCAATCAAAATGTCGAATCCCAACAAATGTGCGGGCAGATTAACCA
GATACCTTATGGCTCTCAGTTGAAAAGTGCTGCTGTCACTTCTTGTTGTC
CAGATACTACAAATACTAATATGACTCAATCTTTAACAAGCAATCTATCA
ATGAGTTATCCTACATCAAGTTCGCAGCAAGCCATATGTCATTCACGGCA
GATTAGTGTTCCGGAGACAATGACAGAAGCAAGAGCGCAAATAAACAAAA
TGGAATCTCAGATTCTGTATCTAACCACTTGGATTCAGAACAATTTTCAC
ACCCAAAGCCATTTACAAGCAAATAATAATTCTGTAAATAACAACCAGTC
AACTCATGTGCCTCCTGTTACAGAATCTATTAGTCTTTCTCAACACAAAA
ATTGCCTACCGTGCTACATTGTCACAAGTGACTGTCTCCCATCTGATTTC
AGAGATGGTCACATAAATGTTGAAGCTACACCGAGTAATTCCAGTCTCGA
CAGTGCTTACTCTGCAAAAAGCACTACCAGTTCCGATAATAACTCAGGAT
ATTATAAAATCACATCAACAGGAAATTGTCAAATACAATCATCGCCGGTG
TTCGAGGAGAAACTTCCTGGAACTGTAATTAACAAAATTAATAAAACTCA
GGCTGAACTTAAAACACTAAAACAAGAAATCACTGCCTTAAAACGATTAA
ATCAAACCTTTAGAATAAATTTTAAAAACGAATGTAACGACGCATTTCTT
CAAATGAAGAAATTAATTCACACCATTCCTGGTCTAAATTACACTCCAGT
TAGAAATGAACGAATTAATATTGAAAAGAGTGTTTCAGAATACACGGCAG
ATGTGAATACAGAAATAGAAAAGCTTGAAGATCTGGAAATAGCGATTGAA
GATCTTAGAATGAATGTGTTGAATAGAAAATGTCGAGTGAATATTGATGA
AGTAGAAATGTTGGCTCTGCATTTAAGTAGAATCAGCAAATGCTTAGCTA
TTAATAAAGCTGATTTTCCTGAGCTGGAGTTGCGATTGAAACAAATATTG
CAAACCGAAACAGAAATTATCGATTTGAATAAAAAATTCCTTCAAACAGA
ACCGAAAAGATTGGACAGTTCATTAAAATTGTGCAAGAAACTAATCAGTA
CTCTCTTTACTTTAAAGAGGCTCGGATCAGTACAGGAGAATACTGGCAGT
GATTCTATTCCAGAAATCAGATCAAATCGTGATCCTAAACCAAAAGACAA
ACAAGCGATTTTAGAAATCATTCGAACAATTGAACCTGATCATGATTTCA
GAATGCAACAAATTGAACTAGCAGAAAAGCTTAGAGAGTGTCGAAGAAGA
ATGCTATCTTCACATGAATCGTTAAAGTTTGAGAAATCTCTGGAACTGGC
TGCTAGAACACTTCGCGATATAAAATTTTCTCCGGTGACAAATTCAGAAC
GCATTTCAAACAAAGATATTAATCATACAAACAAAGTCAGTGTTGGAACA
AATTCTCGAGAAACAGATTCTTTATCGTCTTTAACTGATTCTGATGTCGA
ACCTCTTGTTTTGAAACCTGACATACCAGTTATCAATAAAGACATACCTC
ATAAAACGATTCCAGATTTTATTCAAAGATTACCTCTCATTAACAACTTA
AGTCATACTAGTAGTAGTGATACATCAAACGAACATGATTCATCAGATAA
TGCTTCATCTAGTCACAGTCGATCTGTGGGTTCTTCGAAACCATCATCAT
CAAAATTGAATTTAAAACAAACTACAATACTCAAAACATCGCAACATTCA
TCTCGCAGCAATCGCAGTTCTAAAGTCGCTTTTAATAGAATGGTAACAGT
AGAAGATGGTTCGGAGTTCCTTCAATTGAATTGTCCAGATGATGATTATG
ATGAAGATCTTAGCTCAATGACGTTAACGTCCCCTCCACCGCCTCCTCCG
CCTAGGCTTAGTAGTCAAGATGAAACAGTATCTGCTCCTGAAGCAGATAT
AATTGAAGGGAATTCTAGACCTAGTAATATTTGGTATCAACAATATCATA
ATTCAACAAATGGCAGAGTTCCGAAAACTGAGTCGTGATTGTTTGTAAAA
TGTCCCTATTCCAAAGAGTCACATACCTAGGAAAATGAAAAACTTGCTGT
ATTAAATTGATCTGAGTATCTGCAACTATTATTCATAACTTTTATTCCTT
ATTTCAATTTCTTCTCATTTCAGATGCATATTTTTGTTTGAAATGATATT
TTTCTTACGTAACATTCAATGTTGTTTATCTTAAATTTAATTTGTTAAAT
GGATTTTCTTGGTTGCCTTTTATTTTCCGCTAAAAGCAGAAAGTATTTTC
TTAAATATAAGAAAA
back to top

protein sequence of SMED30034133-orf-1

>SMED30034133-orf-1 ID=SMED30034133-orf-1|Name=SMED30034133-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=829bp
MRNSGTNKQQYQIDRNILKMSPQMSNSRHPISNSKIDSINNPQSDNCATV
NQWKMHQVPIPSQIHMNQYIAQQIQNHLKSNQNHLVCTCPPEVHKALLEQ
QLIQIPNHHQHAHLPQIHFQPCQHQRQVMIKPVVSNQNVESQQMCGQINQ
IPYGSQLKSAAVTSCCPDTTNTNMTQSLTSNLSMSYPTSSSQQAICHSRQ
ISVPETMTEARAQINKMESQILYLTTWIQNNFHTQSHLQANNNSVNNNQS
THVPPVTESISLSQHKNCLPCYIVTSDCLPSDFRDGHINVEATPSNSSLD
SAYSAKSTTSSDNNSGYYKITSTGNCQIQSSPVFEEKLPGTVINKINKTQ
AELKTLKQEITALKRLNQTFRINFKNECNDAFLQMKKLIHTIPGLNYTPV
RNERINIEKSVSEYTADVNTEIEKLEDLEIAIEDLRMNVLNRKCRVNIDE
VEMLALHLSRISKCLAINKADFPELELRLKQILQTETEIIDLNKKFLQTE
PKRLDSSLKLCKKLISTLFTLKRLGSVQENTGSDSIPEIRSNRDPKPKDK
QAILEIIRTIEPDHDFRMQQIELAEKLRECRRRMLSSHESLKFEKSLELA
ARTLRDIKFSPVTNSERISNKDINHTNKVSVGTNSRETDSLSSLTDSDVE
PLVLKPDIPVINKDIPHKTIPDFIQRLPLINNLSHTSSSDTSNEHDSSDN
ASSSHSRSVGSSKPSSSKLNLKQTTILKTSQHSSRSNRSSKVAFNRMVTV
EDGSEFLQLNCPDDDYDEDLSSMTLTSPPPPPPPRLSSQDETVSAPEADI
IEGNSRPSNIWYQQYHNSTNGRVPKTES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051125regulation of actin nucleation
GO:0051017actin filament bundle assembly
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005613AIP3
IPR022782AIP3-like_C
Vocabulary: molecular function
TermDefinition
GO:0005519cytoskeletal regulatory protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 346..373
NoneNo IPR availableCOILSCoilCoilcoord: 411..438
NoneNo IPR availableGENE3DG3DSA:1.20.58.1540coord: 398..534
e-value: 2.5E-5
score: 25.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 686..740
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 768..828
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 806..828
NoneNo IPR availablePANTHERPTHR22741P140CAP/SNIP-RELATEDcoord: 83..787
IPR005613Actin interacting protein 3, C-terminalSMARTSM00806aip3coord: 252..607
e-value: 0.0019
score: -234.5
IPR022782Actin interacting protein 3-like, C-terminalPFAMPF03915AIP3coord: 211..596
e-value: 2.6E-15
score: 56.5