Zinc finger BED domain-containing protein 5

Overview
NameZinc finger BED domain-containing protein 5
Smed IDSMED30034129
Length (bp)357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger BED domain-containing protein 5 (SMED30034129) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger BED domain-containing protein 5 (SMED30034129) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger BED domain-containing protein 5 (SMED30034129) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger BED domain-containing protein 5 (SMED30034129) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 64.3142 bits (155), Expect = 1.103e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   96 IQTY---QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            IQ Y    R+ +  L P    ++C +GFS Y +TKTKYR +L+A   MRI+LS+I P+I +IC    Q H SH
Sbjct:  621 IQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693          

HSP 2 Score: 56.6102 bits (135), Expect = 6.294e-10
Identity = 22/48 (45.83%), Postives = 37/48 (77.08%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFAT 145
            E+ ID+  DS ++  F +L L+DFW S+ +EYP+++++AV +L+PFAT
Sbjct:  593 ESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFAT 640          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 64.3142 bits (155), Expect = 1.103e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   96 IQTY---QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            IQ Y    R+ +  L P    ++C +GFS Y +TKTKYR +L+A   MRI+LS+I P+I +IC    Q H SH
Sbjct:  621 IQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693          

HSP 2 Score: 56.6102 bits (135), Expect = 6.294e-10
Identity = 22/48 (45.83%), Postives = 37/48 (77.08%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFAT 145
            E+ ID+  DS ++  F +L L+DFW S+ +EYP+++++AV +L+PFAT
Sbjct:  593 ESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFAT 640          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: FAM200A (family with sequence similarity 200 member A [Source:HGNC Symbol;Acc:HGNC:25401])

HSP 1 Score: 57.7658 bits (138), Expect = 2.600e-10
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:   84 LKKNIQTYQRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            +K +     RK ++ L P    Y+C  GFS     KTK RN+LN+  DMR+ LSS  PD  ++   N+Q H SH
Sbjct:  502 IKDDFPLLSRKSILLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPDWKELM--NRQAHPSH 573          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 46.2098 bits (108), Expect = 7.065e-10
Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   44 KFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            +FE + L DFWC+    +PNL+K A+ IL+PFATT
Sbjct:  507 EFETMKLEDFWCAQFTAFPNLAKTALEILMPFATT 541          

HSP 2 Score: 34.2686 bits (77), Expect = 7.065e-10
Identity = 19/56 (33.93%), Postives = 27/56 (48.21%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVH 296
            L P    Y+C  GFSS +  KTK R+  N   D+R+ +S   P    I +   Q+ 
Sbjct:  535 LMPFATTYLCELGFSSLLHFKTKSRSCFNLSDDIRVAISKKVPRFSDIIEQKLQLQ 590          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 46.2098 bits (108), Expect = 7.065e-10
Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   44 KFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            +FE + L DFWC+    +PNL+K A+ IL+PFATT
Sbjct:  507 EFETMKLEDFWCAQFTAFPNLAKTALEILMPFATT 541          

HSP 2 Score: 34.2686 bits (77), Expect = 7.065e-10
Identity = 19/56 (33.93%), Postives = 27/56 (48.21%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVH 296
            L P    Y+C  GFSS +  KTK R+  N   D+R+ +S   P    I +   Q+ 
Sbjct:  535 LMPFATTYLCELGFSSLLHFKTKSRSCFNLSDDIRVAISKKVPRFSDIIEQKLQLQ 590          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.902e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   96 IQTY---QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            IQ Y    R+ +  L P    ++C +GFS Y +TKTKYR +L+A   MRI+LS+I P+I +IC    Q H SH
Sbjct:  622 IQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 694          

HSP 2 Score: 56.6102 bits (135), Expect = 2.825e-9
Identity = 22/48 (45.83%), Postives = 37/48 (77.08%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFAT 145
            E+ ID+  DS ++  F +L L+DFW S+ +EYP+++++AV +L+PFAT
Sbjct:  594 ESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFAT 641          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.096e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   96 IQTY---QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            IQ Y    R+ +  L P    ++C +GFS Y +TKTKYR +L+A   MRI+LS+I P+I +IC    Q H SH
Sbjct:  622 IQEYPSVARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 694          

HSP 2 Score: 56.225 bits (134), Expect = 3.497e-9
Identity = 22/48 (45.83%), Postives = 37/48 (77.08%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFAT 145
            E+ ID+  DS ++  F +L L+DFW S+ +EYP+++++AV +L+PFAT
Sbjct:  594 ESLIDLTSDSQVKQSFSELSLNDFWSSLIQEYPSVARRAVRVLLPFAT 641          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 5.297e-12
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 3
Query:   96 IQTY---QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            IQ Y    R+ +  L P    ++C +GFS Y +TKTKYR +L+A   MRI+LS+I P+I +IC    Q H SH
Sbjct:  621 IQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693          

HSP 2 Score: 56.6102 bits (135), Expect = 3.023e-9
Identity = 22/48 (45.83%), Postives = 37/48 (77.08%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFAT 145
            E+ ID+  DS ++  F +L L+DFW S+ +EYP+++++AV +L+PFAT
Sbjct:  593 ESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFAT 640          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q8TCP9|F200A_HUMAN (Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.249e-9
Identity = 30/74 (40.54%), Postives = 41/74 (55.41%), Query Frame = 3
Query:   84 LKKNIQTYQRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            +K +     RK ++ L P    Y+C  GFS     KTK RN+LN+  DMR+ LSS  PD  ++   N+Q H SH
Sbjct:  502 IKDDFPLLSRKSILLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPDWKELM--NRQAHPSH 573          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q8IZ13|ZBED8_HUMAN (Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=1 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 3.453e-9
Identity = 19/35 (54.29%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   44 KFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            +FE + L DFWC+    +PNL+K A+ IL+PFATT
Sbjct:  507 EFETMKLEDFWCAQFTAFPNLAKTALEILMPFATT 541          

HSP 2 Score: 34.2686 bits (77), Expect = 3.453e-9
Identity = 19/56 (33.93%), Postives = 27/56 (48.21%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVH 296
            L P    Y+C  GFSS +  KTK R+  N   D+R+ +S   P    I +   Q+ 
Sbjct:  535 LMPFATTYLCELGFSSLLHFKTKSRSCFNLSDDIRVAISKKVPRFSDIIEQKLQLQ 590          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4C1SM77 (Zinc finger BED domain-containing protein 5 OS=Eumeta variegata OX=151549 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.623e-22
Identity = 34/58 (58.62%), Postives = 47/58 (81.03%), Query Frame = 3
Query:  132 FPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            FP+   Y+C +GFS+Y +TKTKYRN+L+AE DMR+QLSSI+PDI ++ +N K  H+SH
Sbjct:   72 FPTT--YLCETGFSTYAATKTKYRNRLDAEPDMRLQLSSIKPDINQLMKNKKPFHTSH 127          

HSP 2 Score: 55.8398 bits (133), Expect = 4.623e-22
Identity = 24/49 (48.98%), Postives = 35/49 (71.43%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E+ ++M  D S++S F+  P +DFWC I++EYP L K A+NIL+ F TT
Sbjct:   27 ESLLEMSSDISMESLFKTTPFNDFWCRIRDEYPMLGKMALNILLSFPTT 75          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4Y2KUS3 (Zinc finger BED domain-containing protein 5 OS=Araneus ventricosus OX=182803 GN=ZBED5_192 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.314e-21
Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS YV+TKTKYRNKL+A  DMRIQLS++ P+  +I ++ KQVH SH
Sbjct:  309 LLPFATTYLCEAGFSKYVATKTKYRNKLDAAPDMRIQLSNLTPNFKRIMESKKQVHPSH 367          

HSP 2 Score: 55.4546 bits (132), Expect = 1.314e-21
Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 2
Query:    8 FIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
             I++I D+ L++KF  + L+ FW  + +EYPNL+K+A+ IL+PFATT
Sbjct:  269 MIELISDTQLEAKFRTVSLTIFWSDVFDEYPNLAKQAIRILLPFATT 315          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4Y2H6D2 (Zinc finger BED domain-containing protein 5 OS=Araneus ventricosus OX=182803 GN=ZBED5_278 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.687e-21
Identity = 35/59 (59.32%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS YV+TKTKYRNKL+A  DMRIQLSS+ P+  +I ++ KQVH SH
Sbjct:   94 LLPFATTYLCEAGFSKYVATKTKYRNKLDAAQDMRIQLSSLTPNFKRIMESKKQVHPSH 152          

HSP 2 Score: 54.299 bits (129), Expect = 1.687e-21
Identity = 23/49 (46.94%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E  I++  D+ L++KF  + L+ FW  + +EYPNL+K+A+ IL+PFATT
Sbjct:   52 ENLIELSSDTQLEAKFRTVSLTIFWSDVFDEYPNLAKQAIRILLPFATT 100          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4Y2ECM9 (Zinc finger BED domain-containing protein 5 OS=Araneus ventricosus OX=182803 GN=ZBED5_266 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.606e-21
Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS YV+TKTKYRNKL+A  DMRIQLS++ P+  +I ++ KQVH SH
Sbjct:   92 LLPFATTYLCEAGFSKYVATKTKYRNKLDAAPDMRIQLSNLTPNFKRIMESKKQVHPSH 150          

HSP 2 Score: 53.9138 bits (128), Expect = 4.606e-21
Identity = 23/49 (46.94%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E  I++  D+ L++KF  + L+ FW  + +EYPNL+K+A+ IL+PFATT
Sbjct:   50 ENLIELSSDTQLEAKFRTVSLTIFWSDVFDEYPNLAKQAIRILLPFATT 98          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4Y2E3L6 (Zinc finger BED domain-containing protein 5 OS=Araneus ventricosus OX=182803 GN=ZBED5_8 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.736e-21
Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS YV+TKTKYRNKL+A  DMRIQLS++ P+  +I ++ KQVH SH
Sbjct:  175 LLPFATTYLCEAGFSKYVATKTKYRNKLDAAPDMRIQLSNLTPNFKRIMESKKQVHPSH 233          

HSP 2 Score: 54.299 bits (129), Expect = 4.736e-21
Identity = 23/49 (46.94%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E  I++  D+ L++KF  + L+ FW  + +EYPNL+K+A+ IL+PFATT
Sbjct:  133 EKLIELSSDTQLEAKFRTVSLTIFWSDVFDEYPNLAKQAIRILLPFATT 181          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.163e-12
Identity = 27/50 (54.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query:  114 KQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI 263
            K + +L P    Y+C +GFS  V  KTKYRN+LN E D+R+QLS++QPDI
Sbjct:  609 KAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDI 658          

HSP 2 Score: 46.9802 bits (110), Expect = 8.786e-7
Identity = 22/49 (44.90%), Postives = 31/49 (63.27%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            +  ID+  DS+L+  F +  L +FW   + EYP+LS KAV  L+PF TT
Sbjct:  572 DRLIDLSCDSALKLIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTT 620          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.999e-11
Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  114 KQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            K + +L P    Y+C +GFS  V  KTKYRN+LN E D+R+QLS++QPDI  +    KQ   SH
Sbjct:  566 KAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDIHHLVA-GKQHQPSH 628          

HSP 2 Score: 46.595 bits (109), Expect = 9.521e-7
Identity = 22/49 (44.90%), Postives = 31/49 (63.27%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            +  ID+  DS+L+  F +  L +FW   + EYP+LS KAV  L+PF TT
Sbjct:  529 DRLIDLSCDSALKFIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTT 577          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.803e-17
Identity = 22/49 (44.90%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            + FIDM  DS+L+ +F    LS+FW +++ +YP L ++A+ IL+PFAT+
Sbjct:  513 DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATS 561          

HSP 2 Score: 51.2174 bits (121), Expect = 1.803e-17
Identity = 24/59 (40.68%), Postives = 37/59 (62.71%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS+  + KTKYR++LN E ++R+ +S  +P   K+C   K+ H SH
Sbjct:  555 LLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLC-TAKRAHCSH 612          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.803e-17
Identity = 22/49 (44.90%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            + FIDM  DS+L+ +F    LS+FW +++ +YP L ++A+ IL+PFAT+
Sbjct:  513 DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATS 561          

HSP 2 Score: 51.2174 bits (121), Expect = 1.803e-17
Identity = 24/59 (40.68%), Postives = 37/59 (62.71%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C +GFS+  + KTKYR++LN E ++R+ +S  +P   K+C   K+ H SH
Sbjct:  555 LLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLC-TAKRAHCSH 612          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000033301.1 (pep primary_assembly:ASM223467v1:24:1653567:1654763:-1 gene:ENSORLG00000025431.1 transcript:ENSORLT00000033301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 6.751e-17
Identity = 22/49 (44.90%), Postives = 36/49 (73.47%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            + FIDM  DS+L+ +F    LS+FW +++ +YP L ++A+ IL+PFAT+
Sbjct:  297 DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATS 345          

HSP 2 Score: 49.2914 bits (116), Expect = 6.751e-17
Identity = 23/58 (39.66%), Postives = 36/58 (62.07%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSS 302
            L P    Y+C +GFS+  + KTKYR++LN E ++R+ +S  +P   K+C   K+ H S
Sbjct:  339 LLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLC-TAKRAHCS 395          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000030244.1 (pep primary_assembly:ASM223467v1:13:28104458:28106771:-1 gene:ENSORLG00000022768.1 transcript:ENSORLT00000030244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 2.369e-13
Identity = 19/47 (40.43%), Postives = 32/47 (68.09%), Query Frame = 2
Query:    8 FIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
             +++  DS+L+ ++ KL L  FW  + +EYP L+ +AV +L+PF TT
Sbjct:  370 LLEVSTDSTLKGQWGKLDLGSFWIVVSKEYPLLALRAVKVLLPFTTT 416          

HSP 2 Score: 45.4394 bits (106), Expect = 2.369e-13
Identity = 25/61 (40.98%), Postives = 37/61 (60.66%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNA--EADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            L P    Y+C SGFS+  +TKTK R++L A  EA +R+ LS I P +  + ++ +Q   SH
Sbjct:  410 LLPFTTTYLCESGFSTVATTKTKARSRLRASLEATLRVSLSPIPPRL-DLIRSKRQAQVSH 469          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 1.067e-11
Identity = 18/47 (38.30%), Postives = 31/47 (65.96%), Query Frame = 2
Query:    8 FIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
             +++  DS+L+ ++ KL L  FW  + +EYP L+ +A  +L+PF TT
Sbjct:  499 LLEVSTDSTLKGQWGKLDLGSFWIVVSKEYPLLALRAFKVLLPFTTT 545          

HSP 2 Score: 42.3578 bits (98), Expect = 1.067e-11
Identity = 22/45 (48.89%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  129 LFPSQLPYMC*SGFSSYVSTKTKYRNKLNA--EADMRIQLSSIQP 257
            L P    Y+C SGFS+  +TKTK R++L A  EA +R+ LS I P
Sbjct:  539 LLPFTTTYLCESGFSTVATTKTKARSRLRASLEATLRVSLSPIPP 583          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000079121.1 (SMESG000079121.1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.805e-24
Identity = 32/49 (65.31%), Postives = 41/49 (83.67%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E FIDMILDSSL S +EK+ L +FWC+++EEY +LSKKA+ IL+ FATT
Sbjct:  278 EVFIDMILDSSLLSIYEKVSLPEFWCNLREEYVDLSKKAIKILLHFATT 326          

HSP 2 Score: 59.3066 bits (142), Expect = 2.805e-24
Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 3
Query:  150 YMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI 263
            Y+C S FSSY + KTK+ N+L+AEADMRIQL++I+PDI
Sbjct:  327 YLCESEFSSYAAIKTKHHNRLDAEADMRIQLTTIKPDI 364          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000079121.1 (SMESG000079121.1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.858e-24
Identity = 32/49 (65.31%), Postives = 41/49 (83.67%), Query Frame = 2
Query:    2 EAFIDMILDSSLQSKFEKLPLSDFWCSIKEEYPNLSKKAVNILIPFATT 148
            E FIDMILDSSL S +EK+ L +FWC+++EEY +LSKKA+ IL+ FATT
Sbjct:  278 EVFIDMILDSSLLSIYEKVSLPEFWCNLREEYVDLSKKAIKILLHFATT 326          

HSP 2 Score: 59.3066 bits (142), Expect = 2.858e-24
Identity = 25/38 (65.79%), Postives = 33/38 (86.84%), Query Frame = 3
Query:  150 YMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI 263
            Y+C S FSSY + KTK+ N+L+AEADMRIQL++I+PDI
Sbjct:  327 YLCESEFSSYAAIKTKHHNRLDAEADMRIQLTTIKPDI 364          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000029188.1 (SMESG000029188.1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.593e-17
Identity = 39/83 (46.99%), Postives = 51/83 (61.45%), Query Frame = 3
Query:   57 YLCRISGALLKKNIQTYQRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            +L    G L+ ++ +    + +  L P    Y+C +GFS Y STKTKYRN+LN  ADMRIQLS+I P+I  ICQ  KQ H  H
Sbjct: 1982 HLTTFWGNLISEH-KVLAERAIRVLLPFSTTYLCETGFSYYTSTKTKYRNRLNCSADMRIQLSAITPNISMICQEKKQQHCPH 2063          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000027415.1 (SMESG000027415.1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.086e-16
Identity = 40/96 (41.67%), Postives = 58/96 (60.42%), Query Frame = 3
Query:   36 CSQNLKNYLCRISGALLKKNIQTY------QRKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            C  +LK+ L    G +L   +Q Y      +++ +I+L P    Y+C   FS Y++TKTKYRN+L+AE DMR+Q++SI P+   IC N KQ   SH
Sbjct:   12 CDLSLKSKLIT-GGDILNFWLQIYKQYPELEKRAIIHLMPFVTTYICEKTFSLYIATKTKYRNRLDAENDMRLQITSIIPNFDDIC-NEKQAQPSH 105          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000007707.1 (SMESG000007707.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.147e-13
Identity = 38/96 (39.58%), Postives = 57/96 (59.38%), Query Frame = 3
Query:   36 CSQNLKNYLCRISGALLKKNIQTYQ------RKQLIYLFPSQLPYMC*SGFSSYVSTKTKYRNKLNAEADMRIQLSSIQPDI*KICQNNKQVHSSH 305
            C  +LK+ L    G +L   +Q Y+      ++ + +L P    Y+C   FS Y++TKTKY N+L+AE DMR+Q++SI P+   IC N KQ  SS+
Sbjct:   12 CDLSLKSKLIT-GGDILNFWLQIYKQYPELAKRAIKHLMPFVTTYICEKTFSLYIATKTKYGNRLDAENDMRLQITSIIPNFDDIC-NEKQAQSSN 105          
The following BLAST results are available for this feature:
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED51.103e-1245.21zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED51.103e-1245.21zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
FAM200A2.600e-1040.54family with sequence similarity 200 member A [Sour... [more]
ZBED87.065e-1054.29zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
ZBED87.065e-1054.29zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4Z944|ZBED5_CANLF4.902e-1245.21Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|A4Z943|ZBED5_BOVIN5.096e-1245.21Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|Q49AG3|ZBED5_HUMAN5.297e-1245.21Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|Q8TCP9|F200A_HUMAN1.249e-940.54Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A... [more]
sp|Q8IZ13|ZBED8_HUMAN3.453e-954.29Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1SM774.623e-2258.62Zinc finger BED domain-containing protein 5 OS=Eum... [more]
A0A4Y2KUS31.314e-2157.63Zinc finger BED domain-containing protein 5 OS=Ara... [more]
A0A4Y2H6D21.687e-2159.32Zinc finger BED domain-containing protein 5 OS=Ara... [more]
A0A4Y2ECM94.606e-2157.63Zinc finger BED domain-containing protein 5 OS=Ara... [more]
A0A4Y2E3L64.736e-2157.63Zinc finger BED domain-containing protein 5 OS=Ara... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000051422.15.163e-1254.00pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.12.999e-1148.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040389.11.803e-1744.90pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000035512.11.803e-1744.90pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000033301.16.751e-1744.90pep primary_assembly:ASM223467v1:24:1653567:165476... [more]
ENSORLT00000030244.12.369e-1340.43pep primary_assembly:ASM223467v1:13:28104458:28106... [more]
ENSORLT00000032459.11.067e-1138.30pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079121.12.805e-2465.31SMESG000079121.1[more]
SMESG000079121.12.858e-2465.31SMESG000079121.1[more]
SMESG000029188.14.593e-1746.99SMESG000029188.1[more]
SMESG000027415.11.086e-1641.67SMESG000027415.1[more]
SMESG000007707.11.147e-1339.58SMESG000007707.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034129 ID=SMED30034129|Name=Zinc finger BED domain-containing protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=357bp
TGAAGCTTTTATTGATATGATTTTGGATTCCTCACTGCAGTCAAAATTTG
AAAAACTACCTTTGTCGGATTTCTGGTGCTCTATTAAAGAAGAATATCCA
AACTTATCAAAGAAAGCAGTTAATATACTTATTCCCTTCGCAACTACCCT
ATATGTGTTAGTCTGGATTTTCATCTTACGTGTCGACGAAAACCAAATAC
CGCAATAAACTAAACGCAGAAGCTGACATGCGGATTCAACTATCATCCAT
ACAACCAGACATTTAAAAAATCTGCCAAAATAACAAACAAGTGCATTCAT
CTCATTAAAAAAATTATTTTTAGTTTTGTTTTTGCAGTCTTTGTTTCTAA
TGGGCAA
back to top

protein sequence of SMED30034129-orf-1

>SMED30034129-orf-1 ID=SMED30034129-orf-1|Name=SMED30034129-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
LPIRNKDCKNKTKNNFFNEMNALVCYFGRFFKCLVVWMIVESACQLLRLV
YCGIWFSSTRKMKIQTNTYRVVAKGISILTAFFDKFGYSSLIEHQKSDKG
SFSNFDCSEESKIISIKAS
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter