Peptidase S1 domain-containing protein

Overview
NamePeptidase S1 domain-containing protein
Smed IDSMED30034127
Length (bp)1273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase S1 domain-containing protein (SMED30034127) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30034127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase S1 domain-containing protein (SMED30034127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30034127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30034127h1SMcG0011199 SmedASXL_008038SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30034127h1SMcG0011199 dd_Smed_v4_7541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034127h1SMcG0011199 dd_Smed_v4_7541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034127h1SMcG0011199 dd_Smed_v4_7541_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034127h1SMcG0011199 Contig49240newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034127h1SMcG0011199 Contig49240uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034127h1SMcG0011199 dd_Smed_v4_7541_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PRSS1 (serine protease 1 [Source:HGNC Symbol;Acc:HGNC:9475])

HSP 1 Score: 94.7449 bits (234), Expect = 1.981e-21
Identity = 81/291 (27.84%), Postives = 118/291 (40.55%), Query Frame = 1
Query:  352 FCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNK--INMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGP-IMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            FC GSLI+ QW+V+A HC+                                K+  K KF+ +  +  +I+             VRL    ++    E   +F+N              +K++RHP YD   L ND+ L+KL ++  IN  +   S  LP        T  P  G  C + GWG     G    + L  +  PV + + C   Y   I       FC G+  G K  C GDSGGP++C  NG+  L GVVS          PG+++++  +  WI N I  N
Sbjct:   47 FCGGSLINEQWVVSAGHCY--------------------------------KSAIKSKFSGRGCEYHRIQ-------------VRLGEHNIE--VLEGNEQFIN-------------AAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTIS--LP--------TAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT---SNMFCVGFLEGGKDSCQGDSGGPVVC--NGQ--LQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAAN 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PRSS1 (serine protease 1 [Source:HGNC Symbol;Acc:HGNC:9475])

HSP 1 Score: 94.7449 bits (234), Expect = 1.981e-21
Identity = 81/291 (27.84%), Postives = 118/291 (40.55%), Query Frame = 1
Query:  352 FCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNK--INMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGP-IMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            FC GSLI+ QW+V+A HC+                                K+  K KF+ +  +  +I+             VRL    ++    E   +F+N              +K++RHP YD   L ND+ L+KL ++  IN  +   S  LP        T  P  G  C + GWG     G    + L  +  PV + + C   Y   I       FC G+  G K  C GDSGGP++C  NG+  L GVVS          PG+++++  +  WI N I  N
Sbjct:   47 FCGGSLINEQWVVSAGHCY--------------------------------KSAIKSKFSGRGCEYHRIQ-------------VRLGEHNIE--VLEGNEQFIN-------------AAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTIS--LP--------TAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT---SNMFCVGFLEGGKDSCQGDSGGPVVC--NGQ--LQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAAN 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: TMPRSS15 (transmembrane serine protease 15 [Source:HGNC Symbol;Acc:HGNC:9490])

HSP 1 Score: 98.5969 bits (244), Expect = 2.221e-21
Identity = 56/174 (32.18%), Postives = 91/174 (52.30%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            Q V   + ++V +P Y+    +ND+A++ L+ K+N T +     LP  N +        PG+ C + GWG     G   N L    +P+ ++  C+     + N+T++   CAGY  G    C GDSGGP++C EN +  LAGV S  +K      PG+++R+S F+ WI + +
Sbjct:  853 QTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEENQVFP------PGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQ-QMPEYNITENM-ICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFL 1018          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PRSS33 (serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30405])

HSP 1 Score: 92.8189 bits (229), Expect = 1.103e-20
Identity = 57/201 (28.36%), Postives = 94/201 (46.77%), Query Frame = 1
Query:  616 QTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMN--RLHSVLLPVQNSSYCRLIYRADINLTDHQE------FCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            + L   ++ RL     R      + +   V +V+  P Y  +    D+AL++L+  + ++    +R+ P+   +      P PG  C+V GWG      P+     L  V +P+ +S  C  +Y    ++   +        CAGY  GHK  C GDSGGP+ CL++G  VL GVVS          PG+++ ++ +S WI
Sbjct:   82 RALPAEYRVRLGAL--RLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLS----ARVQPVCLPVPGAR--PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PRSS33 (serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30405])

HSP 1 Score: 92.8189 bits (229), Expect = 1.103e-20
Identity = 57/201 (28.36%), Postives = 94/201 (46.77%), Query Frame = 1
Query:  616 QTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMN--RLHSVLLPVQNSSYCRLIYRADINLTDHQE------FCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            + L   ++ RL     R      + +   V +V+  P Y  +    D+AL++L+  + ++    +R+ P+   +      P PG  C+V GWG      P+     L  V +P+ +S  C  +Y    ++   +        CAGY  GHK  C GDSGGP+ CL++G  VL GVVS          PG+++ ++ +S WI
Sbjct:   82 RALPAEYRVRLGAL--RLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLS----ARVQPVCLPVPGAR--PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 73.559 bits (179), Expect = 1.072e-13
Identity = 56/180 (31.11%), Postives = 87/180 (48.33%), Query Frame = 1
Query:  682 NQKVYYKVSKVVRHPMYDPNYLENDVALVKLK-NKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYC---RLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILC-LENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            N++++Y + ++  +P+Y  +   +D+A++++    I    +     LP       K     PG+ C V GWG   +      RL + L+P+ N   C     IY +         FCAGY  G    C GDSGGP  C  E+G  VLAGV+S        K PGI++ ++ + SWIS +I
Sbjct:  781 NEQIFY-LQRIHFYPLYK-DIFSHDIAILEIPYPGIEFNEYAQPICLP------SKDFVYTPGRQCVVSGWGSMGLR--YAERLQAALIPIINRFDCVNSSQIYSS----MSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAII 946          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 67.0106 bits (162), Expect = 3.618e-12
Identity = 46/173 (26.59%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  697 YKVSKVVRHPMYDPNYLEN-DVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGC----KEIDGPIMNRLHSVLLPVQNSSYCRLI--YRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            ++V+ V  HP Y+  +  + D A++++   +N +       LP   ++ ++        +C V GWG       +  P +  +H   +P+ ++ +C  +  Y   I+L      CAGY  G    C GDSGGP++C  +G   L GVVS          PG++  +   S+WI
Sbjct:  125 HRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSLPAVENR--------LCVVTGWGSTIEGSSLSAPTLREIH---VPLLSTLFCSSLPNYIGRIHLP--SMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWI 284          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 57.7658 bits (138), Expect = 4.461e-9
Identity = 71/256 (27.73%), Postives = 113/256 (44.14%), Query Frame = 1
Query:  493 DENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIID-KTLWPYPGQMCKVIGWGC---KEIDGP--IMNR--LHSVLLPVQNSSYC----RLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLE-NGKPVLAGVVSATHKN-----DPSKFPGIFSRISYFSSWISNVI 1206
            D+    M K      NG+ I     +ID     +W V  A   L+   + R   +V     K N++  + V +   H  Y+    +ND+AL+++ + ++        I P+     D K L  Y   +  VIG+G    ++  G   ++N   L S  +P+ +   C    R +    + +T +Q  CAG Y    G   GDSGGP+L  + NG+ V  G+ S          D  KFPG+++RIS +  WI  VI
Sbjct:   45 DDGANWMAKLVSYGDNGQGILCGATVID----DFWLVTAAHCALQ--LQTRSFVYVRE--PKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKL-----GIKPVCLVHDDSKLLKQYKNGV--VIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQ-ICAGAY--LHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 282          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 56.9954 bits (136), Expect = 5.273e-9
Identity = 65/240 (27.08%), Postives = 109/240 (45.42%), Query Frame = 1
Query:  538 NGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGC---KEIDGP--IMNR--LHSVLLPVQNSSYC----RLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLE-NGKPVLAGVVSATHKN-----DPSKFPGIFSRISYFSSWISNVI 1206
            NG+ I     +ID     +W V  A   L+   + R   +V     K N++  + V +   H  Y+    +ND+AL+++ +  +++      +  + +    K L  Y   +  VIG+G    ++  G   ++N   L S  +P+ +   C    R +    + +T +Q  CAG Y    G   GDSGGP+L  + NG+ V  G+ S          D  KFPG+++RIS +  WI  VI
Sbjct:   10 NGQGILCGATVID----DFWLVTAAHCALQ--LQTRSFVYVRE--PKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISS--DLSKLGIKPVCLVHDD--SKLLKQYKNGV--VIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQ-ICAGAY--LHGTAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 232          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: tpr (gene:FBgn0034661 transcript:FBtr0071743)

HSP 1 Score: 97.8265 bits (242), Expect = 4.034e-22
Identity = 57/183 (31.15%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCK-----VIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENG--KPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKN 1212
            QK+  KV++V+ HP Y+    +ND+A++KL   +              N ++     P PG+  K     V GWG  ++ GP  + L  V +P+ +   CR   R    +TD+   C GY  G K  C GDSGGP+  + +G  +  +AGVVS       + +PG+++R++ + +WI N+ K 
Sbjct:  192 QKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEF------------NEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRK-SRYGNKITDNM-LCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: flz (gene:FBgn0286782 transcript:FBtr0273384)

HSP 1 Score: 94.7449 bits (234), Expect = 2.278e-20
Identity = 59/178 (33.15%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPIT--NSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCR-LIYRADINLTDHQEF-CAGYYNGHKGICAGDSGGP-ILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
            + V   V +V+ H  YDP   END+AL++L + +       + I+PI   N + D     + G+M  V GWG  +  G + + L  V +P+  +S C+ + + A  N      F CAGY NG K  C GDSGGP +L   +G+  LAG VS   K      PG++ R +++  W+ ++
Sbjct: 1502 RSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFD----THIVPICMPNDVAD-----FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSI 1670          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: flz (gene:FBgn0286782 transcript:FBtr0273385)

HSP 1 Score: 94.7449 bits (234), Expect = 2.284e-20
Identity = 59/178 (33.15%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPIT--NSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCR-LIYRADINLTDHQEF-CAGYYNGHKGICAGDSGGP-ILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
            + V   V +V+ H  YDP   END+AL++L + +       + I+PI   N + D     + G+M  V GWG  +  G + + L  V +P+  +S C+ + + A  N      F CAGY NG K  C GDSGGP +L   +G+  LAG VS   K      PG++ R +++  W+ ++
Sbjct: 1521 RSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFD----THIVPICMPNDVAD-----FTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSI 1689          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG18735 (gene:FBgn0042098 transcript:FBtr0071744)

HSP 1 Score: 91.2781 bits (225), Expect = 6.336e-20
Identity = 59/204 (28.92%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  607 LAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYY-NGHKGICAGDSGGPILCLENGKPV-LAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKN 1212
            + V+ L+   ++  +K V+R           +VS+V+ HP Y     ++D+AL++    + + I      +P  +         Y GQ   V GWG     GPI + L  V +P+ +   CR     +  +TD+   CAGY   G K  C GDSGGP+  L +G    LAG+VS          PG+++R+  F+ WI+   ++
Sbjct:  133 ITVRLLEHNRQDSHVKIVDR-----------RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSE-------NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNM-ICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG3355 (gene:FBgn0031619 transcript:FBtr0077376)

HSP 1 Score: 87.8113 bits (216), Expect = 4.510e-19
Identity = 65/185 (35.14%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  643 RLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGY-YNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            RLL+ ++R    P   +  KV +   HP YDPN + NDVAL+KL++ + +T       LP  N   D       G+   V GWG  +  G   N L  V +PV  ++ CR     D         CAG    G K  C GDSGGP++ +  G+  LAGVVS  +       PG+++R+S F  WI
Sbjct:  131 RLLQ-IDRSSRDPG--IVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFD-------GKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKD--KIAEVMLCAGLVQQGGKDACQGDSGGPLI-VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:92590 (zgc:92590 [Source:ZFIN;Acc:ZDB-GENE-041024-15])

HSP 1 Score: 92.8189 bits (229), Expect = 4.050e-21
Identity = 60/174 (34.48%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFN-FSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIM-NRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            K  KV+ HP Y+   L+ND  L+KLK      +FN + + +P+T S   +      G+ C V GWG     G +  + L  + LPV   + C   Y   I       FCAG+  G K  C GDSGGP++C  NG+  L GVVS  +    S +PG+++ +  ++ W+++ I NN
Sbjct:   90 KAEKVIPHPKYNDYTLDNDFMLIKLKEP---AVFNQYVQPIPLTTSCSSE------GEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAYGWQIT---KNMFCAGFMEGGKDACQGDSGGPVIC--NGE--LRGVVSWGYGCADSGYPGVYTEVCRYTDWVASTIANN 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: prss59.2 (serine protease 59, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110408-10])

HSP 1 Score: 92.8189 bits (229), Expect = 5.731e-21
Identity = 64/209 (30.62%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  589 KYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            +YW V  A    K   + RL +  N   ++  ++ +    KV+R+P YD   +++D+ L+KL     +  +     LP      D       G MC+V GWG         N+L  + +P+ +   C+  Y   I  T    FCAGY  G K  C GDSGGP++C  NG+  L G+VS  +       PG++ ++  FS WI++ ++NN
Sbjct:   67 EYWVVS-AAHCYKSRLEVRLGEH-NIVINEGTEQ-FITSEKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQPVALP-NGCAAD-------GTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSYPGMITDT---MFCAGYLEGGKDSCQGDSGGPVVC--NGE--LQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADTMRNN 257          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: prss59.1 (serine protease 59, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1173])

HSP 1 Score: 92.0485 bits (227), Expect = 7.656e-21
Identity = 65/209 (31.10%), Postives = 100/209 (47.85%), Query Frame = 1
Query:  589 KYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            +YW V  A    K   + RL +  N   ++  ++ +    KV+R+P YD   L++D+ L+KL     +  +     LP      D       G MC+V GWG         N+L  + +P+ +   C   Y   I  T    FCAGY  G K  C GDSGGP++C  NG+  L G+VS  +       PG++ ++  FS WI++ ++NN
Sbjct:   60 EYWVVS-AAHCYKSRVEVRLGEH-NIVINEGTEQ-FITSEKVIRNPNYDSWDLDSDIMLIKLSKPATLNKYVQPVALP-NGCAAD-------GTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNSYPGMITDT---MFCAGYLEGGKDSCQGDSGGPVVC--NGE--LHGIVSWGYGCAEKNHPGVYGKVCMFSQWIADTMRNN 250          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: prss1 (serine protease 1 [Source:ZFIN;Acc:ZDB-GENE-010131-7])

HSP 1 Score: 91.2781 bits (225), Expect = 1.647e-20
Identity = 55/170 (32.35%), Postives = 84/170 (49.41%), Query Frame = 1
Query:  709 KVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGP-IMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            KV+RHP Y+ N L+NDV L+KL +   +  +  +  LP +            G  C + GWG     G    +RL  +  P+ + S CR  Y   I+      FCAG+  G K  C GDSGGP++C       L G+VS  +       PG+++++  F++WI N + +N
Sbjct:   93 KVIRHPSYNSNTLDNDVMLIKLSSSAQINSYVKTVSLPSS--------CASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRNAYPGQIS---SNMFCAGFMEGGKDSCQGDSGGPVVCNNQ----LQGIVSWGYGCAQRNKPGVYAKVCNFTTWIRNTMNSN 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: CU062628.1 (trypsin-2-like [Source:NCBI gene;Acc:103908930])

HSP 1 Score: 88.5817 bits (218), Expect = 1.038e-19
Identity = 58/182 (31.87%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  673 DKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFN-FSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            +K  Q++  +  KV  HP +     +ND+ L+KLK+     +FN + + +P+  S   +      G+ C V GWG  E+  P +  L  + L VQ+   C  +Y+           CAG+  G KG+C GDSGGP++C  NG+  L GVVS         +P ++  +  +S WI+  I NN
Sbjct:   82 EKTEQRI--RTEKVFPHPEFKFPSEDNDIMLIKLKDP---AVFNQYVQPIPLATSCSSE------GEQCLVSGWGYTEVGLPSV--LQCLDLAVQSRQECERVYKDKFT---QNMLCAGFMEGGKGVCHGDSGGPLVC--NGE--LRGVVSWGAGCAEPGYPAVYVEVCRYSDWIATTIANN 243          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016164.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:2540736:2543374:1 gene:ENSXETG00000009594.1 transcript:ENSXETT00000016164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 2.913e-23
Identity = 67/217 (30.88%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  577 FTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG-CKEIDGPIMNRLHSVLLPVQNSSYCRLIY-------RADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
             T  ++WK        K +F+  +  +     DK  Q V   V +++ HP Y   YL +++AL++L  K+ M        LP      D ++    GQ C V GWG   + D P    L  V + + ++  C  ++       R   NLTD    CAGY  G +  C GD GGP++C ++G+  LAGVVS          PGI++R+S +  WI+ V
Sbjct:   73 LTAARWWKREGVSNNTKSSFQVFVGDYNLDNKDKGEQPV--SVKRIIIHPSYREGYLNDNIALLELATKVQMNKVTLPVCLP------DASVTFPDGQKCSVTGWGQIMDADPPSPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTM-LCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWITGV 280          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016187.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:2540727:2543374:1 gene:ENSXETG00000009594.1 transcript:ENSXETT00000016187.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.170e-22
Identity = 62/185 (33.51%), Postives = 91/185 (49.19%), Query Frame = 1
Query:  673 DKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG-CKEIDGPIMNRLHSVLLPVQNSSYCRLIY-------RADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
            DK  Q V   V +++ HP Y   YL +++AL++L  K+ M        LP      D ++    GQ C V GWG   + D P    L  V + + ++  C  ++       R   NLTD    CAGY  G +  C GD GGP++C ++G+  LAGVVS          PGI++R+S +  WI+ V
Sbjct:   81 DKGEQPV--SVKRIIIHPSYREGYLNDNIALLELATKVQMNKVTLPVCLP------DASVTFPDGQKCSVTGWGQIMDADPPSPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTM-LCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWITGV 256          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016256.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:2527332:2543374:1 gene:ENSXETG00000009594.1 transcript:ENSXETT00000016256.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 2.643e-22
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  682 NQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKE--IDGPIMNRLHSVLLPVQNSSYCRLIY-------RADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
            + ++   V  +  HP Y+   + ND+ L +L   ++ T +     LP  ++I +      PGQ C V GWG  E   D P    L  V + + ++  C  ++       R   NLTD    CAGY  G +  C GD GGP++C ++G+  LAGVVS          PGI++R+S +  WI+ V
Sbjct:   81 SNEMAVSVKNIYIHPNYNDTDITNDIGLAELTQAVSFTSYVIPVCLPTASTIFN------PGQSCWVTGWGVTEFNTDPPSPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTM-LCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWITGV 256          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016199.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:2540727:2543529:1 gene:ENSXETG00000009594.1 transcript:ENSXETT00000016199.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 9.186e-22
Identity = 61/185 (32.97%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  673 DKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGC-KEIDGPIMNRLHSVLLPVQNSSYCRLIY-------RADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
            DK  Q V   V +++ HP Y   YL +++AL++L  K+ M        LP  +           GQ C V GWG   E   P    L  V + + ++  C  ++       R   NLTD    CAGY  G +  C GD GGP++C ++G+  LAGVVS          PGI++R+S +  WI+ V
Sbjct:   81 DKGEQPV--SVKRIIIHPSYREGYLNDNIALLELATKVQMNKVTLPVCLPDASVTFPD------GQKCSVTGWGALNEPVPPYPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTM-LCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWITGV 256          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016135.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:2540736:2543374:1 gene:ENSXETG00000009594.1 transcript:ENSXETT00000016135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 3.038e-21
Identity = 57/177 (32.20%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG--CKEIDGPIMNRLHSVLLPVQNSSYCRLIY-------RADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV 1203
             V +++ HP Y   YL +++AL++L  K+ M        LP  +           GQ C V GWG      D P    L  V + + ++  C  ++       R   NLTD    CAGY  G +  C GD GGP++C ++G+  LAGVVS          PGI++R+S +  WI+ V
Sbjct:   89 SVKRIIIHPSYREGYLNDNIALLELATKVQMNKVTLPVCLPDASVTFPD------GQKCSVTGWGQIMDGADPPSPRVLREVEVKMMSNDRCNTLFNIPDAYGRTTANLTDTM-LCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGGDGCGKPNRPGIYTRVSSYIKWITGV 258          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss6 (transmembrane serine protease 6 [Source:MGI Symbol;Acc:MGI:1919003])

HSP 1 Score: 95.5153 bits (236), Expect = 1.483e-20
Identity = 55/174 (31.61%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  688 KVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLE-NGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            +V +KVS++  HP ++ +  + DVAL++L + +  +       LP  +   +      PGQ C + GWG +   GP+ N L  V + +     C   YR  ++    +  CAGY  G K  C GDSGGP++C E +G+  LAG+VS         F G+++R++   +WI  V+
Sbjct:  634 EVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFE------PGQHCWITGWGAQREGGPVSNTLQKVDVQLVPQDLCSEAYRYQVS---PRMLCAGYRKGKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVINWIQQVL 798          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss6 (transmembrane serine protease 6 [Source:MGI Symbol;Acc:MGI:1919003])

HSP 1 Score: 95.5153 bits (236), Expect = 1.523e-20
Identity = 55/174 (31.61%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  688 KVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLE-NGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            +V +KVS++  HP ++ +  + DVAL++L + +  +       LP  +   +      PGQ C + GWG +   GP+ N L  V + +     C   YR  ++    +  CAGY  G K  C GDSGGP++C E +G+  LAG+VS         F G+++R++   +WI  V+
Sbjct:  646 EVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFE------PGQHCWITGWGAQREGGPVSNTLQKVDVQLVPQDLCSEAYRYQVS---PRMLCAGYRKGKKDACQGDSGGPLVCREPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVINWIQQVL 810          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Prss32 (protease, serine 32 [Source:MGI Symbol;Acc:MGI:1917064])

HSP 1 Score: 88.1965 bits (217), Expect = 7.749e-19
Identity = 59/197 (29.95%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  646 LLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPN-YLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMN--RLHSVLLPVQNSSYCRLIYRAD-INLTD----HQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKN 1212
            LL  ++ + +    K    V++ ++HP Y  + +   D+ALV+L + I+   +     LP     +D      PG MC V GWG    + P+     L  + +P+ ++  C   Y+ + I  T+        CAG+  G K  C GDSGGP++C  N   + AGVVS        K PG+++ +S + SWI N + N
Sbjct:  108 LLGTISSYPEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLD------PGTMCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGGPLVCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTMWN 298          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Gzmb (granzyme B [Source:MGI Symbol;Acc:MGI:109267])

HSP 1 Score: 85.8853 bits (211), Expect = 1.400e-18
Identity = 58/169 (34.32%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  709 KVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            K + HP Y+P    ND+ L+KLK+K   T       LP  N  +       PG +C V GWG     G   N L  V L VQ    C   ++   N T+  + CAG     +    GDSGGP++C    K V AG+VS  +K+     P  F+++S F SWI   +K++
Sbjct:   93 KCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVK------PGDVCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTN--QICAGDPKTKRASFRGDSGGPLVC----KKVAAGIVSYGYKDGSP--PRAFTKVSSFLSWIKKTMKSS 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Tmprss15 (transmembrane protease, serine 15 [Source:MGI Symbol;Acc:MGI:1197523])

HSP 1 Score: 89.3521 bits (220), Expect = 1.422e-18
Identity = 57/175 (32.57%), Postives = 89/175 (50.86%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEID-GPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            Q V   V ++V +P YD     ND+A++ L+ K+N T +     LP  N I        PG+ C + GWG  +I+ G  ++ L    +P+ ++  C+     + N+T+    CAGY  G    C GDSGGP++C EN +  L GV S   +      PG++ R+S F  WI + +
Sbjct:  887 QVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIF------IPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQ-QLPEYNITESM-ICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFL 1053          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P21842|CMA1_CANLF (Chymase OS=Canis lupus familiaris OX=9615 GN=CMA1 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.124e-21
Identity = 63/172 (36.63%), Postives = 92/172 (53.49%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            +V K   HP YD   L +D+ L+KLK K N+T+   +  LP++         P PG+MC+V GWG ++++G   + L  V L + +   CR     D NL    + C G     K    GDSGGP+LC      V  G+VS   +ND +K P +F+RIS++  WI+ V+K N
Sbjct:   92 EVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGT--LPLSPQF---NFVP-PGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNL----QLCVGNPRKTKSAFKGDSGGPLLCAG----VAQGIVSYG-QND-AKPPAVFTRISHYRPWINKVLKQN 247          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9N2D1|TRYT_PIG (Tryptase OS=Sus scrofa OX=9823 GN=MCT7 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.743e-21
Identity = 89/329 (27.05%), Postives = 134/329 (40.73%), Query Frame = 1
Query:  274 LSLAALIGEK---GYSWDI---LKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYP-GQMCKVIGWGCKEIDGPIMNR--LHSVLLPVQNSSYCRLIYRADINLTDH------QEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            L  A ++G K   G+ W     L+   ++ K FC GSLI  QW++TAAHCF   K                                                      DP Y +V+L  Q L   +++RLL                 VS+++ HP Y       D+AL++L++ +N++    S + P+T     +T   +P G  C V GWG      P+     L  V +P+  +S C + Y   ++  D+         CAG   GH   C GDSGGP++C  NG  + AGVVS          PGI++R++++  WI   I   
Sbjct:   26 LERAGIVGGKEAPGHKWPWQVSLRCLDQYWKHFCGGSLIHPQWVLTAAHCFGPEK-----------------------------------------------------ADPLYIRVQLGEQHLY--YQDRLLL----------------VSRIIVHPNYYDEVNGADIALLELEDPVNLS----SHVQPVTLPPASET---FPKGTRCWVTGWGDVHSGWPLPPPYPLKQVRVPIVENSECDMQYHLGLSTGDNIPIVRDDMLCAGS-EGHDS-CQGDSGGPLVCRVNGTWLQAGVVSWGEGCALPNRPGIYTRVTHYLDWIHQCIPRE 274          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P98073|ENTK_HUMAN (Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.067e-20
Identity = 56/174 (32.18%), Postives = 91/174 (52.30%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            Q V   + ++V +P Y+    +ND+A++ L+ K+N T +     LP  N +        PG+ C + GWG     G   N L    +P+ ++  C+     + N+T++   CAGY  G    C GDSGGP++C EN +  LAGV S  +K      PG+++R+S F+ WI + +
Sbjct:  853 QTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEENQVFP------PGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQ-QMPEYNITENM-ICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFL 1018          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P16049|TRY1_GADMO (Trypsin-1 OS=Gadus morhua OX=8049 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.911e-20
Identity = 66/208 (31.73%), Postives = 93/208 (44.71%), Query Frame = 1
Query:  589 KYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKN 1212
            K W V  A    K   + RL +   R  +   Q  Y   S V+RHP Y    + ND+ L+KL     +  +  +  LP T    D T       MC V GWG         ++L  + LP+ + + C   Y   I       FCAGY  G K  C GDSGGP++C  NG  VL GVVS  +       PG+++++   S W+ + + N
Sbjct:   51 KDWVVS-AAHCYKSVLRVRLGEHHIRVNEGTEQ--YISSSSVIRHPNYSSYNINNDIMLIKLTKPATLNQYVHAVALP-TECAADAT-------MCTVSGWGNTMSSVADGDKLQCLSLPILSHADCANSYPGMIT---QSMFCAGYLEGGKDSCQGDSGGPVVC--NG--VLQGVVSWGYGCAERDHPGVYAKVCVLSGWVRDTMAN 240          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NF86|PRS33_HUMAN (Serine protease 33 OS=Homo sapiens OX=9606 GN=PRSS33 PE=1 SV=3)

HSP 1 Score: 92.8189 bits (229), Expect = 5.299e-20
Identity = 57/201 (28.36%), Postives = 94/201 (46.77%), Query Frame = 1
Query:  616 QTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMN--RLHSVLLPVQNSSYCRLIYRADINLTDHQE------FCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            + L   ++ RL     R      + +   V +V+  P Y  +    D+AL++L+  + ++    +R+ P+   +      P PG  C+V GWG      P+     L  V +P+ +S  C  +Y    ++   +        CAGY  GHK  C GDSGGP+ CL++G  VL GVVS          PG+++ ++ +S WI
Sbjct:   82 RALPAEYRVRLGAL--RLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLS----ARVQPVCLPVPGAR--PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A430QBE3 (Peptidase S1 domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0008529 PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 8.006e-63
Identity = 120/334 (35.93%), Postives = 169/334 (50.60%), Query Frame = 1
Query:  226 RVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDK----PNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            R KRIIGGQ          A++  ++  SW  L    E    +C  +LI   WI+TAAHC                         +S  D+                      E+I +  PK W VR+A + L P   ERL    NR F+        + +Y V ++  HP Y+P  LE D+AL KLK    +   N   ++ + +  I +  WP P Q C  +GWGC  +DGP   ++ +V LPV  S  C  +Y A INLT+  EFCAGY+N  KG+C GDSGGP++C ++G+  LAG+VSATH   P+ +P IF+R+SYF+ WI++VI+ N
Sbjct:    8 RFKRIIGGQSVPRGTYPWAASIQAKRHTSWSTLVTGSEQH--YCGAALIKPDWIITAAHCL-----------------------YDSGEDD----------------------EIISYLHPKMWHVRMATEKLSPGILERLKGAFNRVFNSIFGHVKLQTFYHVEEIFHHPKYEPGNLEYDIALFKLKETPVLWKINHLDLIELPDKKIGEE-WPKPNQKCVAVGWGCSFVDGPPTLKIQAVELPVLQSKTCMSMYSAYINLTEEHEFCAGYHNFGKGVCPGDSGGPLVCEDDGEYRLAGIVSATHSKLPADYPAIFTRVSYFAKWINDVIREN 293          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A3Q0KUP0 (Subfamily S1A unassigned peptidase (S01 family) OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.719e-61
Identity = 121/355 (34.08%), Postives = 176/355 (49.58%), Query Frame = 1
Query:  163 ILIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDK----PNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
             LI  F  + + +   ++   R KRIIGGQ          A++  ++  SW  L    E    +C  +LI   WI+TAAHC                         +S  ++                      E+I +  PK W VR+A + L P   ERL    NR F+        + +Y V ++  HP Y+P  LE D+AL KLK    +   N   ++ + +   +   WP P Q C  +GWGC  +DGP   ++ +V LPV  S  C  +Y A INLT+  EFCAGY+N  KG+C GDSGGP++C ++G+  LAG+VSATH   P+ +P IF+R+SYF+ WI++VI+ N
Sbjct:    6 FLICTFIYIYAQSICSSERLNRFKRIIGGQSVPRGTYPWAASIQAKRHTSWSTLVTGSEQH--YCGAALIKPDWIITAAHCL-----------------------YDSGEED----------------------EIISYLHPKMWHVRMATEKLSPGILERLKGAFNRVFNSIFGHVKLQTFYHVEEIFHHPKYEPGNLEYDIALFKLKETPVLWKINHLDLIELPDKK-NGEEWPKPNQKCVAVGWGCSFVDGPPTLKIQAVELPVLQSKTCMSMYSAYINLTEEHEFCAGYHNFGKGVCPGDSGGPLVCEDDGEYKLAGIVSATHSKLPADYPAIFTRVSYFTKWINDVIREN 312          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A4Z2DL25 (Transmembrane protease serine 11C isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_011244 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 9.012e-60
Identity = 122/337 (36.20%), Postives = 168/337 (49.85%), Query Frame = 1
Query:  226 RVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFD------KPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLE-NGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            R KRIIGGQ          A++  ++  SW  L    E    +C  +LI   WI+TAAHC                         +S  D+                      E+I +  PK W VR+A + L P   ER+    NR F+      KP  + +Y V ++  HP Y+P  LE D+AL KLK    +   N   ++ + +  + K  WP   Q C  +GWGC  +DGP   ++ +V LPV     C  +Y A INLTD  EFCAGY+N  KG+C GDSGGP++C + NG   LAG+VSATH   P+ +P IF+R+SYF+ WI++VIK N
Sbjct:   27 RYKRIIGGQSVPRGTYPWAASIQAKRIPSWSTLVTGTEQH--YCGAALIRPDWIITAAHCL-----------------------YDSGDDD----------------------EIISYLHPKMWHVRMATEKLSPGILERIKGAFNRVFNSIFGHVKP--QTFYHVEEIFHHPKYEPGNLEYDIALFKLKETPVLWKINHLDLIELPDENVGKE-WPETNQKCIAVGWGCSFVDGPPTLKIQAVELPVLQPKTCMSMYSAYINLTDEHEFCAGYHNSGKGVCPGDSGGPLVCEDSNGDYKLAGIVSATHSKLPADYPAIFTRVSYFTKWINDVIKEN 313          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A5K3F8T1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.968e-59
Identity = 117/337 (34.72%), Postives = 170/337 (50.45%), Query Frame = 1
Query:  226 RVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWG-EHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFD------KPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            RV+RII G+L        + ++  +       L   G EH   FC G+L++ +WI+TAAHC   +                                       K+G       ELI    PK W VR++   LKP+  +RL  F +R F+      KP  + +Y + K V HP Y   YLEND+AL+KLK  + +   N   ++ + +  +   +WP  GQ C  IGWGC     P    + ++ +P+ +   C+ +Y+A INLT  +EFC+G++N + GIC GDSGGP++C  NG  +LAGVVSATH   P  FP +F+R++YF  WI   IKNN
Sbjct:   19 RVRRIINGELAKKNRYPFIVSIQAKLSNDLHSLLFGGIEH---FCGGALVAPRWILTAAHCMYAYS--------------------------------------KDG-------ELIPLLTPKSWHVRMSTDKLKPSTIDRLKGFFHRAFNTLFGYIKP--QTFYHIEKFVLHPHYVEGYLENDIALLKLKEHVQVHRMNTLDVIKLPDPKLVGEMWPKTGQECTAIGWGCACAHCPPEMYMKTIKMPIIDPRKCKAMYKAPINLTVAKEFCSGFFNRNSGICPGDSGGPLVCDFNGNQLLAGVVSATHAKKPESFPAVFTRVTYFRDWILETIKNN 305          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A0R3U3S5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1250 PE=3 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 1.814e-58
Identity = 117/337 (34.72%), Postives = 170/337 (50.45%), Query Frame = 1
Query:  226 RVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWG-EHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFD------KPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            RV+RII G+L        + ++  +       L   G EH   FC G+L++ +WI+TAAHC   +                                       K+G       ELI    PK W VR++   LKP+  +RL  F +R F+      KP  + +Y + K V HP Y   YLEND+AL+KLK  + +   N   ++ + +  +   +WP  GQ C  IGWGC     P    + ++ +P+ +   C+ +Y+A INLT  +EFC+G++N + GIC GDSGGP++C  NG  +LAGVVSATH   P  FP +F+R++YF  WI   IKNN
Sbjct:   61 RVRRIINGELAKKNRYPFIVSIQAKLSNDLHSLLFGGIEH---FCGGALVAPRWILTAAHCMYAYS--------------------------------------KDG-------ELIPLLTPKSWHVRMSTDKLKPSTIDRLKGFFHRAFNTLFGYIKP--QTFYHIEKFVLHPHYVEGYLENDIALLKLKEHVQVHRMNTLDVIKLPDPKLVGEMWPKTGQECTAIGWGCACAHCPPEMYMKTIKMPIIDPRKCKAMYKAPINLTVAKEFCSGFFNRNSGICPGDSGGPLVCDFNGNQLLAGVVSATHAKKPESFPAVFTRVTYFRDWILETIKNN 347          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: gzm3 (granzyme 3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-070912-132])

HSP 1 Score: 96.6709 bits (239), Expect = 1.886e-21
Identity = 57/168 (33.93%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  703 VSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            V K ++HP Y  N + +D+ L+KLKNK  +  F  ++ LP TN  +         QMC + GWG    +GP  N L  V L +Q    C  I+R   N    Q       +G +  C GDSG P++C  N KP   G+ +  +  D  K P ++++I +F  WI  VI
Sbjct:   40 VQKCIKHPSYKQNEVHHDIMLLKLKNKAKINKFTKNKALPKTNDKLPAN------QMCSIAGWGFTAPNGPPSNVLREVSLKLQFDIECNYIWRNHFN---SQHMICTSSDGKRTFCKGDSGSPLIC--NNKP--QGIAAFANLTDCRKGPQVYTKIGFFLPWIKKVI 194          

HSP 2 Score: 72.0182 bits (175), Expect = 2.469e-13
Identity = 59/193 (30.57%), Postives = 89/193 (46.11%), Query Frame = 1
Query:  640 ERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLEN--DVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKND--PSKFPGIFSRISYFSSWISNVI 1206
            E LL   N    +P+Q+   +V K ++HP Y      +  D+ L+ LKNK  +T       LP  N  I         + C + GWG  E  G   + L  V L +Q +  C+ I++      D Q       +G KG C GDSG P++C  N K  L G+   T+  +    K+PG++ +++YF  WI   I
Sbjct:  277 EVLLGAHNISRKEPSQR-RIEVKKYIKHPSYKEGQHNHSYDIMLLNLKNKAKLTKSVQIITLPKNNKNIPAN------KDCSIAGWGKTEPCGSASDVLKEVRLKLQFNVECKNIWQMYF---DSQRMICTASDGEKGFCQGDSGSPLMC--NNK--LTGLAVFTYPGNCIKRKYPGVYIKVAYFHPWIQKEI 455          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: gzm3 (granzyme 3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-070912-132])

HSP 1 Score: 96.6709 bits (239), Expect = 2.813e-21
Identity = 57/168 (33.93%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  703 VSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            V K ++HP Y  N + +D+ L+KLKNK  +  F  ++ LP TN  +         QMC + GWG    +GP  N L  V L +Q    C  I+R   N    Q       +G +  C GDSG P++C  N KP   G+ +  +  D  K P ++++I +F  WI  VI
Sbjct:   96 VQKCIKHPSYKQNEVHHDIMLLKLKNKAKINKFTKNKALPKTNDKLPAN------QMCSIAGWGFTAPNGPPSNVLREVSLKLQFDIECNYIWRNHFN---SQHMICTSSDGKRTFCKGDSGSPLIC--NNKP--QGIAAFANLTDCRKGPQVYTKIGFFLPWIKKVI 250          

HSP 2 Score: 72.4034 bits (176), Expect = 2.667e-13
Identity = 59/193 (30.57%), Postives = 89/193 (46.11%), Query Frame = 1
Query:  640 ERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLEN--DVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKND--PSKFPGIFSRISYFSSWISNVI 1206
            E LL   N    +P+Q+   +V K ++HP Y      +  D+ L+ LKNK  +T       LP  N  I         + C + GWG  E  G   + L  V L +Q +  C+ I++      D Q       +G KG C GDSG P++C  N K  L G+   T+  +    K+PG++ +++YF  WI   I
Sbjct:  333 EVLLGAHNISRKEPSQR-RIEVKKYIKHPSYKEGQHNHSYDIMLLNLKNKAKLTKSVQIITLPKNNKNIPAN------KDCSIAGWGKTEPCGSASDVLKEVRLKLQFNVECKNIWQMYF---DSQRMICTASDGEKGFCQGDSGSPLMC--NNK--LTGLAVFTYPGNCIKRKYPGVYIKVAYFHPWIQKEI 511          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-33m11.7 (trypsin-like [Source:NCBI gene;Acc:103026411])

HSP 1 Score: 93.2041 bits (230), Expect = 3.071e-21
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  694 YYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG-CKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            Y+K   ++ HP+Y+      D+ L+KL+  I+   +     LP  N+ +       PG++C+V GWG      G I   LH+V LP+ +++ C        N+T +   CAGY  G K  C GDSGGP++C  +G+  + G+VS  +    ++FPG+++ +S F  WI   I
Sbjct:   84 YFKPHSLIPHPLYNKTTNNADIMLIKLRAPIDQNRYVSLAPLPRQNTGV------LPGRVCRVSGWGSTSHSGGEIPPTLHTVKLPIVSTAKCNSSESFSGNITSNM-ICAGYSTGGKDACKGDSGGPLVC--DGR--VYGLVSWGNGCGDARFPGVYTAVSRFRRWIDQTI 244          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-33m11.7 (trypsin-like [Source:NCBI gene;Acc:103026411])

HSP 1 Score: 93.2041 bits (230), Expect = 4.231e-21
Identity = 56/172 (32.56%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  694 YYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG-CKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVI 1206
            Y+K   ++ HP+Y+      D+ L+KL+  I+   +     LP  N+ +       PG++C+V GWG      G I   LH+V LP+ +++ C        N+T +   CAGY  G K  C GDSGGP++C  +G+  + G+VS  +    ++FPG+++ +S F  WI   I
Sbjct:  101 YFKPHSLIPHPLYNKTTNNADIMLIKLRAPIDQNRYVSLAPLPRQNTGV------LPGRVCRVSGWGSTSHSGGEIPPTLHTVKLPIVSTAKCNSSESFSGNITSNM-ICAGYSTGGKDACKGDSGGPLVC--DGR--VYGLVSWGNGCGDARFPGVYTAVSRFRRWIDQTI 261          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029927.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:7841535:7850029:1 gene:ENSAMXG00000043149.1 transcript:ENSAMXT00000029927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 7.994e-21
Identity = 56/170 (32.94%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  706 SKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            S+V+R+P Y+   L++D+ LVKL    N+  +     LP + +          G MC V GWG         N+L  + +P+ +++ C   Y   I  T    FCAGY  G K  C GDSGGP++C  NG+  L GVVS  +       PG+++++  FS+W+++ + +N
Sbjct:   88 SRVIRNPNYNSWTLDSDIMLVKLSQPANLNSYVKPVSLPKSCAA--------AGTMCLVSGWGNTMSSTADSNKLQCLEIPIISTTDCENSYPGMITNT---MFCAGYLEGGKDSCQGDSGGPVVC--NGE--LQGVVSWGYGCAEKNHPGVYAKVCMFSTWLADTMASN 242          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004829.1 (pep scaffold:Pmarinus_7.0:GL487651:3325:6603:-1 gene:ENSPMAG00000004392.1 transcript:ENSPMAT00000004829.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 4.815e-23
Identity = 54/172 (31.40%), Postives = 91/172 (52.91%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            + SK +RHP Y+   ++ND+ L+KL +    T+  +++ +P+ +S +        G MC + GWG  +      + L  V  PV + + CR  Y  DI    +   C GY  G K  C GDSGGP++C  NG+  L G+VS         +PG+++++  ++SWI++ +  N
Sbjct:   89 QASKAIRHPQYNSATIDNDIMLIKLSSP--ATLNQYAQAIPLPSSCVGT------GVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDIT---NNMICLGYLEGGKDSCQGDSGGPVVC--NGQ--LQGIVSWGRGCALPNYPGVYTKVCNYNSWIASTMAAN 245          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009259.1 (pep scaffold:Pmarinus_7.0:GL478809:471847:475891:1 gene:ENSPMAG00000008373.1 transcript:ENSPMAT00000009259.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 7.511e-23
Identity = 54/172 (31.40%), Postives = 90/172 (52.33%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            + SK +RHP Y    ++ND+ L+KL +    T+  +++ +P+ +S +        G MC + GWG  +      + L  V  PV + + CR  Y  DI    +   C GY  G K  C GDSGGP++C  NG+  L G+VS         +PG+++++  ++SWI++ +  N
Sbjct:   89 QASKAIRHPQYSSATIDNDIMLIKLSSP--ATLNQYAQAVPLPSSCVGT------GVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDIT---NNMICLGYLEGGKDSCQGDSGGPVVC--NGQ--LQGIVSWGRGCALPNYPGVYTKVCNYNSWIASTMAAN 245          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: zmp:0000001088 (zmp:0000001088 [Source:ZFIN;Acc:ZDB-GENE-140106-48])

HSP 1 Score: 91.6633 bits (226), Expect = 4.377e-22
Identity = 56/173 (32.37%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIM-NRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            KVSKV+ HP Y+ N + NDV L+KL+   ++  +  +  LP   + +        G  C+V GWG     G    ++L +V +PV +++ C         +T +   CAG+  G K  C GDSGGP++C      +L GVVS  +       PG+++R++ F SWI   +  N
Sbjct:   24 KVSKVISHPSYNANTMNNDVLLIKLQTAASLNSYVGTVGLPSQGASLSD------GTSCRVSGWGNTRASGSSYPDKLMAVDVPVISTTTCNAGSAYGGQITANM-VCAGFMAGGKDSCQGDSGGPMVC----GGLLHGVVSWGYGCAQPNKPGVYARVASFRSWIDQTMAAN 185          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007992.1 (pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gene:ENSPMAG00000007230.1 transcript:ENSPMAT00000007992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 4.723e-21
Identity = 56/187 (29.95%), Postives = 95/187 (50.80%), Query Frame = 1
Query:  655 FVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            FVN   ++  Q      SK ++HP Y+   ++ND+ L+KL +    T+  +++ + + +S ++       G MC + GWG  +      + L  V  PV + + CR  Y  DI    +   C GY  G K  C GDSGGP++C  NG+  L G+VS         +PG+++++  +++WI+  I  N
Sbjct:   68 FVNEGTEQQIQ-----ASKAIQHPQYNSWTIDNDIMLIKLSSP--ATLNQYAQAIALPSSCVNT------GVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDIT---NNMICLGYLEGGKDSCQGDSGGPVVC--NGE--LQGIVSWGRGCALPNYPGVYTKVCNYNAWIAQTIAAN 234          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004281.1 (pep scaffold:Pmarinus_7.0:GL479205:9482:14995:-1 gene:ENSPMAG00000003912.1 transcript:ENSPMAT00000004281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 7.035e-21
Identity = 56/187 (29.95%), Postives = 95/187 (50.80%), Query Frame = 1
Query:  655 FVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            FVN   ++  Q      SK ++HP Y+   ++ND+ L+KL +    T+  +++ + + +S ++       G MC + GWG  +      + L  V  PV + + CR  Y  DI    +   C GY  G K  C GDSGGP++C  NG+  L G+VS         +PG+++++  +++WI+  I  N
Sbjct:   81 FVNEGTEQQIQ-----ASKAIQHPQYNSWTIDNDIMLIKLSSP--ATLNQYAQAIALPSSCVNT------GVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSYPGDIT---NNMICLGYLEGGKDSCQGDSGGPVVC--NGE--LQGIVSWGRGCALPNYPGVYTKVCNYNAWIAQTIAAN 247          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO34771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNF5])

HSP 1 Score: 92.4337 bits (228), Expect = 2.391e-21
Identity = 57/185 (30.81%), Postives = 93/185 (50.27%), Query Frame = 1
Query:  703 VSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAG-YYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN**TKCNFFIFNKF 1254
            VS V+ HP YD   ++ND+AL++L   +      F R   +  + +     P PG+ C + GWG     G     L   +LP+ + + C+  Y   ++ T H   CAG   +G  G C GDSGGP++C +NG+  L G VS    + P+ +  +F+R++ ++ WI  V  N    +C   ++  F
Sbjct:   89 VSHVIEHPEYDDRKIKNDIALLELSRPVK-----FDREGKVGTACLTNQQ-PTPGKRCYITGWGSTIGTGNSPRILQQAMLPIASHNDCKNKYYG-VSSTAH--LCAGEARSGASGGCNGDSGGPLVCEDNGRWYLHGAVSYGKLHCPTTYYTVFARVASYTDWIKQVTGN----QCFLILYTLF 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW60])

HSP 1 Score: 90.1225 bits (222), Expect = 1.034e-20
Identity = 55/169 (32.54%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNR---LHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHK-GICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            +VS+V+ HP YD     ND+AL++L   +          + +TN        P PG+ C + GWG   ++G        L   +LP+ +   CR  Y  D++ T H   CAG       G C GDSGGP++C +NG   L G VS   K  P+    +F+R++ ++ WI
Sbjct:   75 RVSQVLEHPRYDSQRDVNDIALIELATPVEFDSAGKVGTVCLTNQR------PAPGKQCYITGWG--AVNGHTQQSPDILQQAMLPIASHENCRRKY-GDVSSTAH--LCAGEARSDAAGGCNGDSGGPLVCEDNGSWFLHGAVSYGMKYCPTTHYTVFARVASYTDWI 232          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW61])

HSP 1 Score: 88.5817 bits (218), Expect = 2.809e-20
Identity = 52/169 (30.77%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  700 KVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNR---LHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHK-GICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            ++S+++ HP Y+   + ND+AL++L   +          + +T+        P PG+ C + GWG   I+G        L   +LP+ +   CR  Y  D++ T H   CAG       G C GDSGGP++C +NG   L G VS   +N P+    +F+R++ ++ WI
Sbjct:   75 RLSQIIEHPKYNDRRIVNDIALIELATPVQFDSAGKVGTVCLTDQR------PAPGKRCYITGWG--AINGDTQQSPDILQQAMLPIASHENCRRKY-GDVSSTAH--LCAGEARSDAAGGCNGDSGGPLVCEDNGSWFLHGAVSYGLRNCPTTHYTVFARVASYTDWI 232          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO43454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYF8])

HSP 1 Score: 85.1149 bits (209), Expect = 5.182e-19
Identity = 58/202 (28.71%), Postives = 86/202 (42.57%), Query Frame = 1
Query:  619 TLKPTFKERLLKFV---NRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKN-DPSKFPGIFSRISYFSSWISNVIKN 1212
            T KP    R   +    ++ +     +    +  +V HP Y  N L+ D+AL+KL+  I    +     LP    +         G  C V GWG      P  N L    +P+ +   C   YR    +T     CAG Y   KG C GDSGGP++C   G+ VL GV S ++     S + G+++ + YF  WI   +  
Sbjct:   46 TTKPPGASRYTMYAFSEHQLYQLDGSEQNIPIEGIVVHPSY--NDLDYDIALLKLRQPITFNAYVSQVCLPQAALLA--------GTPCYVSGWGRIGESSPGSNVLQEASIPLVDQRACEEQYRNLKPITARMR-CAGIYGTPKGTCKGDSGGPLVCESKGRWVLMGVTSWSYNGCADSGYAGVYADVVYFKDWIRQTVST 236          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO33459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS64])

HSP 1 Score: 84.3445 bits (207), Expect = 1.568e-18
Identity = 56/164 (34.15%), Postives = 79/164 (48.17%), Query Frame = 1
Query:  703 VSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI 1194
            +SK+  H  Y  + L +DVAL+KL   ++++    +  LP   S +     P  G  C + GWG     G   N L    L V + S C+      +++      CAG     KG C GDSGGP +C E GK VL G VS  H N  +    +F+R++ F SWI
Sbjct:   80 ISKIYSHEKYSSSLLTSDVALIKLSKAVSLSKHVNTVCLP---SGLSSDEAP-AGSKCFITGWGRMVAGGSGANTLQQADLLVASHSDCQARMGYMLSVDKATMICAGSQG--KGGCQGDSGGPFVCEEGGKWVLRGAVSWGHVNCLTDHYTVFARVNSFISWI 237          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040914.1 (pep primary_assembly:ASM223467v1:8:2529365:2537213:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000040914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.979e-22
Identity = 61/196 (31.12%), Postives = 96/196 (48.98%), Query Frame = 1
Query:  628 PTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            PT +  +L   +     PN +V   ++ ++ HP ++     ND+AL++L + +  T +     LP T S        Y G    V GWG   I  P    L  V +P+  +  C+  Y A + +TD+   CAG   G K  C GDSGGP++  +N + + AG+VS         FPGI++R+S + +WI+  I  N
Sbjct:   77 PTVQMLVLGLQSLQGSNPN-RVSRTITTLIVHPNFNSATQNNDIALLQLSSPVTFTNYITPVCLPSTGSTF------YSGVNTWVTGWGTIRISLPAPQTLQEVQIPIVGNRRCKCSYGASL-ITDNM-MCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPGIYTRVSQYQTWINTQITTN 263          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028845.1 (transmembrane protease serine 9-like [Source:NCBI gene;Acc:101157216])

HSP 1 Score: 96.6709 bits (239), Expect = 1.995e-21
Identity = 61/183 (33.33%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  673 DKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGC--KEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
              PN  V   V+ V+ HP Y+    +ND+AL++L + +N T +    I P+  S  + T   Y G    V GWG     +  P    L  V +P+  +  C+  Y A  ++TD+   CAG   G K  C GDSGGP++  +N + + AGVVS         FPG+++R+S + +WI+  I +N
Sbjct:   76 SNPN-SVSQTVTTVIVHPNYNSETSDNDIALLQLSSPVNFTNY----ITPVCLSATNSTF--YSGVNTWVTGWGTIRSGVSLPAPQTLQEVQVPIVGNRQCKCSYGAS-SITDNM-VCAGLLAGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGEGCALPNFPGVYTRVSQYQTWINTQISSN 249          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041614.1 (pep primary_assembly:ASM223467v1:8:2529637:2537084:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000041614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 2.141e-21
Identity = 58/181 (32.04%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  673 DKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
              PN +V   ++ ++ HP ++     ND+AL++L + +  T +     LP T S        Y G    V GWG   I  P    L  V +P+  +  C+  Y A + +TD+   CAG   G K  C GDSGGP++  +N + + AG+VS         FPGI++R+S + +WI+  I  N
Sbjct:   89 SNPN-RVSRTITTLIVHPNFNSATQNNDIALLQLSSPVTFTNYITPVCLPSTGSTF------YSGVNTWVTGWGTIRISLPAPQTLQEVQIPIVGNRRCKCSYGASL-ITDNM-MCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPGIYTRVSQYQTWINTQITTN 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001489.2 (pep primary_assembly:ASM223467v1:8:2648866:2652769:1 gene:ENSORLG00000001209.2 transcript:ENSORLT00000001489.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.107e-20
Identity = 59/190 (31.05%), Postives = 96/190 (50.53%), Query Frame = 1
Query:  652 KFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWG--CKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
              +++    PN  V   + K++ HP Y  + LEND+ L+ L + +N   FN   I P+  +    +   Y G    V GWG     +  P    L  V +P+  +  C+  Y A+ ++TD+   CAG   G K  C GDSGGP++  ++ + + AGVVS  +      FPG+++R+S + +WI+  I  N
Sbjct:   27 SLLSKVRSNPN-AVSRSIVKIIIHPGYSSSTLENDITLLMLASPVN---FN-DHIAPVCLAAASSSF--YSGTDSWVTGWGNIGSGVSLPAPQNLQEVQVPIVGNRQCKCSYGAN-SITDNM-VCAGLLEGGKDSCQGDSGGPLVIKQSNRWIQAGVVSFGNGCAQPDFPGVYTRVSQYQTWINTQITTN 207          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040545.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 90.8929 bits (224), Expect = 2.182e-20
Identity = 60/178 (33.71%), Postives = 87/178 (48.88%), Query Frame = 1
Query:  685 QKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCK-VIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
             +V   VSK++ HP YD     ND+ L+KL + +    +    I P+  +        +PG     V G+G     GP+ + L  V +P+ +++ C   Y    N    Q  CAG   G    C GDSGGP++   + + V AGVVS         FPG+++R+S F SWI NVI NN
Sbjct:   84 HQVSLSVSKIIVHPNYDSRTNNNDLTLLKLASPVTFNDY----ISPVCLAAAGSD---FPGGTSSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAYGGITN----QMICAGLTTGGLDSCQGDSGGPLVIKNSTRWVQAGVVSFGEGCAKPNFPGVYARVSEFQSWI-NVIINN 249          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000076526.1 (SMESG000076526.1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 1
Query:  154 MTKILIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            MTKILIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTEEKYENENENSSNFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN
Sbjct:    1 MTKILIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTEEKYENENENSSNFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 354          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000076823.1 (SMESG000076823.1)

HSP 1 Score: 342.813 bits (878), Expect = 9.269e-116
Identity = 165/353 (46.74%), Postives = 233/353 (66.01%), Query Frame = 1
Query:  166 LIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEKGYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKS---DENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNVIKNN 1215
            +I +FC+LL          +RVKRIIGG+L  + +Q  L ALIGEKGYSWDIL++WG++ K  C+G++IS++WI+TAAHCF+  +  +++   ++  S     E ++     DE +         IK        KE+ID +DP YWK R+ V+ L+PT+KE ++ F+ +  +K  + +Y+++SKV+RHP+YDP YLEND+AL+KLK K+N +  +   I+ +T+       WP  GQ+CK IGWGCKE  GPI N  +    P+   S+CR  Y  +INLTD QEFCAG +N +KGICAGDSGGP+LC ENG PVLAG+  ATH + P  +PGI+SRISYF SWI+ ++K N
Sbjct:   10 IIFIFCILLH----FQNCAVRVKRIIGGELYVTTNQDFLVALIGEKGYSWDILRIWGDYHKSHCTGAVISDEWIITAAHCFSTIREIDDEVSGKDNESVTASEEEDTDYEYYDEIVTETVDTIHLIKKKSSGSAIKEIIDLSDPTYWKARIGVRQLEPTYKEVIVNFLQKILNKNPKTLYHEISKVIRHPLYDPLYLENDIALLKLKTKLNTSQNSNIGIISMTSHNDTNITWPISGQICKAIGWGCKEFKGPITNEPYFTHFPILKPSFCRKFYNGNINLTDQQEFCAGNFNKNKGICAGDSGGPLLCNENGMPVLAGIAEATHSDFPKDYPGIYSRISYFKSWINEIMKYN 358          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000012752.1 (SMESG000012752.1)

HSP 1 Score: 166.392 bits (420), Expect = 8.405e-48
Identity = 103/308 (33.44%), Postives = 141/308 (45.78%), Query Frame = 1
Query:  355 CSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRF----------------FDK---PNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFN-FSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI-SNVIKNN 1215
            C  SLI  QW++TAAHCF                               L A +K                L++ TDP  W  R   + L+  + +   K+   +                +DK   P   +   VSK++ HP Y P+ +E D+AL+KL++ I     N F  ++P+  S  D   WP  GQMC +IGWGCK   G I  R     L +Q++ +C  +Y    +L D  EFCAG Y    G+C GDSG  + C +  K  LAGV SATH   P  +PGIF+R+SYF SWI  N+ K N
Sbjct:   57 CGASLIDKQWLLTAAHCF-------------------------------LAAQEKS---------------LLNSTDPILWHARAGARKLETEYVKYEHKYEKAYKGWYEETSDFDGTDGKWDKRRVPESYLDLHVSKIILHPNYKPDEIEWDIALMKLQSPIEEKYLNEFLEVIPLP-SEADSKPWPKIGQMCILIGWGCKTNGGSISERAQIANLKIQSNKFCEKVYNQGADLNDEHEFCAGKYKSGHGLCEGDSGSGLACKKGNKWTLAGVASATHAELPGNYPGIFTRVSYFISWILENINKQN 317          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000012752.1 (SMESG000012752.1)

HSP 1 Score: 166.007 bits (419), Expect = 1.465e-47
Identity = 103/310 (33.23%), Postives = 140/310 (45.16%), Query Frame = 1
Query:  355 CSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRF---------FDK------------PNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFN-FSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI-SNVIKNN 1215
            C  SLI  QW++TAAHCF                               L A +K                L++ TDP  W  R   + L+  + +   K+   +         FD             P   +   VSK++ HP Y P+ +E D+AL+KL++ I     N F  ++P+  S  D   WP  GQMC +IGWGCK   G I  R     L +Q++ +C  +Y    +L D  EFCAG Y    G+C GDSG  + C +  K  LAGV SATH   P  +PGIF+R+SYF SWI  N+ K N
Sbjct:   57 CGASLIDKQWLLTAAHCF-------------------------------LAAQEKS---------------LLNSTDPILWHARAGARKLETEYVKYEHKYEKAYKGWYEETSDFDDLGTDGKWDKRRVPESYLDLHVSKIILHPNYKPDEIEWDIALMKLQSPIEEKYLNEFLEVIPLP-SEADSKPWPKIGQMCILIGWGCKTNGGSISERAQIANLKIQSNKFCEKVYNQGADLNDEHEFCAGKYKSGHGLCEGDSGSGLACKKGNKWTLAGVASATHAELPGNYPGIFTRVSYFISWILENINKQN 319          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000012752.1 (SMESG000012752.1)

HSP 1 Score: 165.236 bits (417), Expect = 2.541e-47
Identity = 103/311 (33.12%), Postives = 141/311 (45.34%), Query Frame = 1
Query:  355 CSGSLISNQWIVTAAHCFNIFKVTXXXXXXXXXXXXXFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKVRLAVQTLKPTFKERLLKFVNRF-------------------FDK---PNQKVYYKVSKVVRHPMYDPNYLENDVALVKLKNKINMTIFN-FSRILPITNSIIDKTLWPYPGQMCKVIGWGCKEIDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGICAGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWI-SNVIKNN 1215
            C  SLI  QW++TAAHCF                               L A +K                L++ TDP  W  R   + L+  + +   K+   +                   +DK   P   +   VSK++ HP Y P+ +E D+AL+KL++ I     N F  ++P+  S  D   WP  GQMC +IGWGCK   G I  R     L +Q++ +C  +Y    +L D  EFCAG Y    G+C GDSG  + C +  K  LAGV SATH   P  +PGIF+R+SYF SWI  N+ K N
Sbjct:   57 CGASLIDKQWLLTAAHCF-------------------------------LAAQEKS---------------LLNSTDPILWHARAGARKLETEYVKYEHKYEKAYKGWYEETSDFDGMKRTDGKWDKRRVPESYLDLHVSKIILHPNYKPDEIEWDIALMKLQSPIEEKYLNEFLEVIPLP-SEADSKPWPKIGQMCILIGWGCKTNGGSISERAQIANLKIQSNKFCEKVYNQGADLNDEHEFCAGKYKSGHGLCEGDSGSGLACKKGNKWTLAGVASATHAELPGNYPGIFTRVSYFISWILENINKQN 320          
The following BLAST results are available for this feature:
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRSS11.981e-2127.84serine protease 1 [Source:HGNC Symbol;Acc:HGNC:947... [more]
PRSS11.981e-2127.84serine protease 1 [Source:HGNC Symbol;Acc:HGNC:947... [more]
TMPRSS152.221e-2132.18transmembrane serine protease 15 [Source:HGNC Symb... [more]
PRSS331.103e-2028.36serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30... [more]
PRSS331.103e-2028.36serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
svh-11.072e-1331.11HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-13.618e-1226.59TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-34.461e-927.73TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-35.273e-927.08TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpr4.034e-2231.15gene:FBgn0034661 transcript:FBtr0071743[more]
flz2.278e-2033.15gene:FBgn0286782 transcript:FBtr0273384[more]
flz2.284e-2033.15gene:FBgn0286782 transcript:FBtr0273385[more]
CG187356.336e-2028.92gene:FBgn0042098 transcript:FBtr0071744[more]
CG33554.510e-1935.14gene:FBgn0031619 transcript:FBtr0077376[more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:925904.050e-2134.48zgc:92590 [Source:ZFIN;Acc:ZDB-GENE-041024-15][more]
prss59.25.731e-2130.62serine protease 59, tandem duplicate 2 [Source:ZFI... [more]
prss59.17.656e-2131.10serine protease 59, tandem duplicate 1 [Source:ZFI... [more]
prss11.647e-2032.35serine protease 1 [Source:ZFIN;Acc:ZDB-GENE-010131... [more]
CU062628.11.038e-1931.87trypsin-2-like [Source:NCBI gene;Acc:103908930][more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000016164.12.913e-2330.88pep primary_assembly:Xenopus_tropicalis_v9.1:9:254... [more]
ENSXETT00000016187.12.170e-2233.51pep primary_assembly:Xenopus_tropicalis_v9.1:9:254... [more]
ENSXETT00000016256.12.643e-2231.69pep primary_assembly:Xenopus_tropicalis_v9.1:9:252... [more]
ENSXETT00000016199.19.186e-2232.97pep primary_assembly:Xenopus_tropicalis_v9.1:9:254... [more]
ENSXETT00000016135.13.038e-2132.20pep primary_assembly:Xenopus_tropicalis_v9.1:9:254... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmprss61.483e-2031.61transmembrane serine protease 6 [Source:MGI Symbol... [more]
Tmprss61.523e-2031.61transmembrane serine protease 6 [Source:MGI Symbol... [more]
Prss327.749e-1929.95protease, serine 32 [Source:MGI Symbol;Acc:MGI:191... [more]
Gzmb1.400e-1834.32granzyme B [Source:MGI Symbol;Acc:MGI:109267][more]
Tmprss151.422e-1832.57transmembrane protease, serine 15 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21842|CMA1_CANLF7.124e-2136.63Chymase OS=Canis lupus familiaris OX=9615 GN=CMA1 ... [more]
sp|Q9N2D1|TRYT_PIG7.743e-2127.05Tryptase OS=Sus scrofa OX=9823 GN=MCT7 PE=2 SV=1[more]
sp|P98073|ENTK_HUMAN1.067e-2032.18Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS1... [more]
sp|P16049|TRY1_GADMO2.911e-2031.73Trypsin-1 OS=Gadus morhua OX=8049 PE=1 SV=2[more]
sp|Q8NF86|PRS33_HUMAN5.299e-2028.36Serine protease 33 OS=Homo sapiens OX=9606 GN=PRSS... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QBE38.006e-6335.93Peptidase S1 domain-containing protein OS=Schistos... [more]
A0A3Q0KUP01.719e-6134.08Subfamily S1A unassigned peptidase (S01 family) OS... [more]
A0A4Z2DL259.012e-6036.20Transmembrane protease serine 11C isoform 2 OS=Sch... [more]
A0A5K3F8T13.968e-5934.72Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U3S51.814e-5834.72Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gzm31.886e-2133.93granzyme 3, tandem duplicate 1 [Source:ZFIN;Acc:ZD... [more]
gzm32.813e-2133.93granzyme 3, tandem duplicate 1 [Source:ZFIN;Acc:ZD... [more]
si:dkey-33m11.73.071e-2132.56trypsin-like [Source:NCBI gene;Acc:103026411][more]
si:dkey-33m11.74.231e-2132.56trypsin-like [Source:NCBI gene;Acc:103026411][more]
ENSAMXT00000029927.17.994e-2132.94pep primary_assembly:Astyanax_mexicanus-2.0:3:7841... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004829.14.815e-2331.40pep scaffold:Pmarinus_7.0:GL487651:3325:6603:-1 ge... [more]
ENSPMAT00000009259.17.511e-2331.40pep scaffold:Pmarinus_7.0:GL478809:471847:475891:1... [more]
zmp:00000010884.377e-2232.37zmp:0000001088 [Source:ZFIN;Acc:ZDB-GENE-140106-48... [more]
ENSPMAT00000007992.14.723e-2129.95pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gen... [more]
ENSPMAT00000004281.17.035e-2129.95pep scaffold:Pmarinus_7.0:GL479205:9482:14995:-1 g... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347712.391e-2130.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442071.034e-2032.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442082.809e-2030.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434545.182e-1928.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334591.568e-1834.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040914.11.979e-2231.12pep primary_assembly:ASM223467v1:8:2529365:2537213... [more]
ENSORLT00000028845.11.995e-2133.33transmembrane protease serine 9-like [Source:NCBI ... [more]
ENSORLT00000041614.12.141e-2132.04pep primary_assembly:ASM223467v1:8:2529637:2537084... [more]
ENSORLT00000001489.21.107e-2031.05pep primary_assembly:ASM223467v1:8:2648866:2652769... [more]
ENSORLT00000040545.12.182e-2033.71tryptase [Source:NCBI gene;Acc:101156896][more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076526.10.000e+0100.00SMESG000076526.1[more]
SMESG000076823.19.269e-11646.74SMESG000076823.1[more]
SMESG000012752.18.405e-4833.44SMESG000012752.1[more]
SMESG000012752.11.465e-4733.23SMESG000012752.1[more]
SMESG000012752.12.541e-4733.12SMESG000012752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034127 ID=SMED30034127|Name=Peptidase S1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1273bp
GAAAATGTTGTTTTATCAACTATAGCAATGAAAGTGACCAAATTTATGAG
TGTTTGATAAGGGTTTGTCAAGTGATTGAGAGGCAGATATACTCCCGATA
ATAACTTCATTTGATAAAGTTTATTCAATTAAAACTTTTAGAAATACTAT
TTCATGACAAAAATATTAATTATTGTTTTTTGCCTTTTACTTAGCTGCGC
ATTTATCCTCGCCAAGAGTGGAATTAGAGTCAAACGAATCATAGGAGGCC
AACTAGACGACTCAGTTGACCAGCTATCGCTTGCAGCGTTAATTGGTGAG
AAAGGATATTCATGGGACATACTCAAAGTCTGGGGTGAACATAGGAAATT
ATTCTGCAGCGGTTCCCTCATTAGTAATCAGTGGATTGTCACTGCCGCAC
ATTGTTTCAATATATTCAAAGTAACGGAGGAAAAATATGAAAACGAGAAT
GAAAACAGTTCAAATTTTATCCATGAACGCGAATCAAAATCCGATGAAAA
TCTAAAAGCAATGCAGAAAAAAAAATTTACAATTAAAAATGGCAAAGTTA
TTAAAATTAAAAAGGAATTAATTGATTTTACTGATCCTAAGTATTGGAAA
GTGAGATTAGCAGTTCAGACTTTGAAACCAACTTTTAAAGAAAGACTTTT
GAAATTTGTAAACAGATTCTTTGACAAACCTAATCAAAAGGTTTATTACA
AGGTATCAAAGGTAGTACGACATCCAATGTATGATCCAAACTACCTGGAA
AATGATGTGGCTCTTGTTAAATTGAAAAATAAAATTAATATGACCATTTT
TAACTTTTCTCGAATATTACCAATTACAAATTCAATTATAGACAAAACGT
TGTGGCCCTATCCGGGGCAGATGTGCAAAGTAATTGGATGGGGTTGCAAG
GAAATTGACGGGCCCATAATGAATCGGTTGCATTCAGTATTACTGCCAGT
TCAGAATTCTAGTTACTGTCGACTAATTTATCGGGCTGATATTAACCTCA
CAGATCACCAAGAATTCTGTGCAGGATATTACAACGGACATAAAGGAATA
TGTGCAGGTGACAGTGGAGGCCCAATTTTGTGTTTAGAAAATGGCAAACC
CGTTTTAGCTGGAGTAGTGTCTGCCACTCATAAAAATGATCCCAGCAAAT
TTCCAGGAATATTTTCAAGAATAAGTTATTTTAGCAGTTGGATCAGTAAT
GTAATTAAAAATAATTAATAAACTAAATGTAATTTTTTTATTTTTAATAA
ATTTATGTGTCAGACAAAAAAAA
back to top

protein sequence of SMED30034127-orf-1

>SMED30034127-orf-1 ID=SMED30034127-orf-1|Name=SMED30034127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MTKILIIVFCLLLSCAFILAKSGIRVKRIIGGQLDDSVDQLSLAALIGEK
GYSWDILKVWGEHRKLFCSGSLISNQWIVTAAHCFNIFKVTEEKYENENE
NSSNFIHERESKSDENLKAMQKKKFTIKNGKVIKIKKELIDFTDPKYWKV
RLAVQTLKPTFKERLLKFVNRFFDKPNQKVYYKVSKVVRHPMYDPNYLEN
DVALVKLKNKINMTIFNFSRILPITNSIIDKTLWPYPGQMCKVIGWGCKE
IDGPIMNRLHSVLLPVQNSSYCRLIYRADINLTDHQEFCAGYYNGHKGIC
AGDSGGPILCLENGKPVLAGVVSATHKNDPSKFPGIFSRISYFSSWISNV
IKNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR001314Peptidase_S1A
IPR001254Trypsin_dom
IPR033116TRYPSIN_SER
IPR018114TRYPSIN_HIS
IPR009003Peptidase_S1_PA
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin familyPRINTSPR00722CHYMOTRYPSINcoord: 69..84
score: 54.86
coord: 297..309
score: 55.64
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 28..347
e-value: 1.3E-43
score: 160.8
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 177..347
e-value: 3.2E-30
score: 105.6
coord: 63..99
e-value: 2.9E-8
score: 33.8
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 29..352
score: 25.473
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 60..350
e-value: 1.31113E-50
score: 166.683
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 153..354
e-value: 6.1E-39
score: 135.8
NoneNo IPR availableGENE3DG3DSA:2.40.10.120coord: 58..140
e-value: 9.6E-10
score: 40.7
NoneNo IPR availablePANTHERPTHR24256TRANSMEMBRANE PROTEASE, SERINEcoord: 54..350
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..15
score: 5.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.902
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
IPR018114Serine proteases, trypsin family, histidine active sitePROSITEPS00134TRYPSIN_HIScoord: 79..84
IPR033116Serine proteases, trypsin family, serine active sitePROSITEPS00135TRYPSIN_SERcoord: 298..309
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 8..353