SPRY domain-containing SOCS box protein 3

Overview
NameSPRY domain-containing SOCS box protein 3
Smed IDSMED30034119
Length (bp)2404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SPRY domain-containing SOCS box protein 3 (SMED30034119) t-SNE clustered cells

Violin plots show distribution of expression levels for SPRY domain-containing SOCS box protein 3 (SMED30034119) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SPRY domain-containing SOCS box protein 3 (SMED30034119) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SPRY domain-containing SOCS box protein 3 (SMED30034119) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034119

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034119SMESG000010967.1 Contig3231GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034119SMESG000069126.1 Contig3231GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034119SMESG000027213.1 Contig958newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30034119SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034119SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30034119SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034119SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034119SMESG000069126.1 SMESG000069122.1 dd_Smed_v4_2076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30034119 dd_Smed_v4_9874_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034119 dd_Smed_v4_9874_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Match: SPSB3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:HGNC Symbol;Acc:HGNC:30629])

HSP 1 Score: 87.0409 bits (214), Expect = 1.327e-17
Identity = 67/210 (31.90%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +T    S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKR---FYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Match: SPSB3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:HGNC Symbol;Acc:HGNC:30629])

HSP 1 Score: 87.0409 bits (214), Expect = 1.327e-17
Identity = 67/210 (31.90%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +T    S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKR---FYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Match: SPSB4 (splA/ryanodine receptor domain and SOCS box containing 4 [Source:HGNC Symbol;Acc:HGNC:30630])

HSP 1 Score: 78.1814 bits (191), Expect = 3.466e-15
Identity = 63/224 (28.12%), Postives = 106/224 (47.32%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQFC--PAF------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCC---SMENFSKLPIPGCLKELL 2265
            W+  D+S  V + ++  +  FH  P+  + ST GIR  +G + G+  W+        GT  +VGV T +APLH     Y  L+G D +SWG    +  ++H+G  +     PAF      ++   ++   L++ +GTL F  D     VAF+G+    G+ L+ + S+     E+ +  Y   ++     L +LC   I        +++ S LP+P  LK  L
Sbjct:   56 WNPEDRSLNVFVKDDDRLT-FHRHPV--AQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLH--SVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGL---KGKKLYPVVSAVWGHCEVTM-RYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYL 270          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Match: SPSB1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:HGNC Symbol;Acc:HGNC:30628])

HSP 1 Score: 77.0258 bits (188), Expect = 8.743e-15
Identity = 64/225 (28.44%), Postives = 104/225 (46.22%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTT------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W+++D+S  V + E+  +  FH  P+  + ST  IR  +G++ G+  W+        GT  +VGV T  APLH     Y  L+G + +SWG    +  ++H+G  +  +  PAF     T          L++ DGTL F  D     VAF+G+    G+ L+ + S+     EI +  Y   ++     L +LC   +      E   +   LP+P  LK  L+
Sbjct:   56 WNNNDRSLNVFVKEDDKLI-FHRHPV--AQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLH--SVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGL---KGKKLYPVVSAVWGHCEIRM-RYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Match: SPSB1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:HGNC Symbol;Acc:HGNC:30628])

HSP 1 Score: 77.0258 bits (188), Expect = 8.743e-15
Identity = 64/225 (28.44%), Postives = 104/225 (46.22%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTT------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W+++D+S  V + E+  +  FH  P+  + ST  IR  +G++ G+  W+        GT  +VGV T  APLH     Y  L+G + +SWG    +  ++H+G  +  +  PAF     T          L++ DGTL F  D     VAF+G+    G+ L+ + S+     EI +  Y   ++     L +LC   +      E   +   LP+P  LK  L+
Sbjct:   56 WNNNDRSLNVFVKEDDKLI-FHRHPV--AQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLH--SVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGL---KGKKLYPVVSAVWGHCEIRM-RYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Match: spsb-2 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:Q965N7])

HSP 1 Score: 67.0106 bits (162), Expect = 4.964e-12
Identity = 60/235 (25.53%), Postives = 99/235 (42.13%), Query Frame = 1
Query: 1615 GEILKSIIKWSSHDKSPAVSL-SENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCP-----AFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSM-----------ENFSKLPIPGCLKELLV 2268
              +++    W+  D+SP + +  ++K   Y H  P    N T  IR  +G+S G   W+    E   GT  +VGV TK APL   +  Y  L+G +++S+G +      H G  K   P       ++    I C L++  G L F  D     V FQ +    G+ L+   ++     EI +T     + +L+ + +  +F  C             +    L IP  +KE L+
Sbjct:   18 NRLIQEQHSWNPDDRSPNIIVKDQDKLTLYRHPVP----NCTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLQAAE--YTTLVGSNNESYGWNIATRECHYGSWKWKYPYGNGRDGFNVPEKIYCILDMEQGNLSFATDNEYLGVVFQNL---RGKRLYPAVATLYGDCEITMT----HLGSLEPVEMLPLFELCRRRFRSIMGPDPDKRIKPLMIPPVMKEYLL 239          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 65.4698 bits (158), Expect = 5.379e-11
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 1
Query: 1618 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 2277
            + ++    W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  127 QFIQEQHSWNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 352          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 65.0846 bits (157), Expect = 6.018e-11
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 1
Query: 1618 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 2277
            + ++    W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  125 QFIQEQHSWNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 350          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 65.0846 bits (157), Expect = 6.018e-11
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 1
Query: 1618 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 2277
            + ++    W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  125 QFIQEQHSWNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 350          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Match: spsb-1 (SPSB (SPry and Socs Box) family [Source:UniProtKB/TrEMBL;Acc:U4PM56])

HSP 1 Score: 64.3142 bits (155), Expect = 1.627e-10
Identity = 59/227 (25.99%), Postives = 100/227 (44.05%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAF--------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELC---LGVIFRCCSMENFSKLPIPGCLKELLVSTF 2277
            W+  D+S  + + +      FH  P+  + ST  IR  +G+S G   W+    E   GT  +VGV TK APLH     Y  LIG  D+S+G        H+  +      +        Y+      C L++ +G + F  D+    VAF+ +    G++L+ + ++     EI++  Y  S+     +L ELC   + +       ++  +L IP  LK  L+  +
Sbjct:  248 WNPEDRSLNIFVKDEDKFT-FHRHPV--AQSTDCIRGKMGYSRGFHVWQIEWPERQRGTHAVVGVATKNAPLHAA--GYTALIGTTDESYGWDITRRECHHDSKHTMTWRYPFSNSRDVYNVPDKFYCILDMDEGYMAFATDDEFLGVAFRNL---KGKTLYPIVAAVWGHCEISM-RYLGSLEPEPLSLSELCRRRVRIEMGAQPEDHIEQLMIPPILKRYLMYQY 465          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0079004)

HSP 1 Score: 100.523 bits (249), Expect = 8.273e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 2244
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0333534)

HSP 1 Score: 100.523 bits (249), Expect = 8.273e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 2244
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0333535)

HSP 1 Score: 100.138 bits (248), Expect = 9.290e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 2244
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Match: SP555 (gene:FBgn0260470 transcript:FBtr0079005)

HSP 1 Score: 100.138 bits (248), Expect = 9.290e-23
Identity = 67/207 (32.37%), Postives = 101/207 (48.79%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFY-SKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR----CCSMENFSKLPIP 2244
            WS   +S  V L   N    +FH +    S  TAG++     + G   W+  + +   GTS+M G+GTK A LH     + N++G ++  WGLS+KG++WH GV   +   F  ++ T I    + ++GTL F  D     VAF+G   +  E L+ +  STAA  E+ +         LQ+ C  VI R       +E   KLP+P
Sbjct:   67 WSKRHRSKEVVLRGPNSRTVHFHPN---WSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHAN--AFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAFRG-LDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNLQDRCRAVIMRRVRSAAQLEKL-KLPLP 266          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Match: Fsn (gene:FBgn0043010 transcript:FBtr0087762)

HSP 1 Score: 65.855 bits (159), Expect = 1.812e-11
Identity = 55/175 (31.43%), Postives = 83/175 (47.43%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQFCPAF-----YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAIT 2148
            WS +D S  V +  N      H +P+ +S   A  R  IGF  G   W+  + E PLGT  ++G+ TK+A L    + YV L+G DDQSWG +  +  + HNG  +   P       Y     I+  L+  D TL F+ +     VAF+G+  K    L+   S+     E+++ 
Sbjct:   83 WSPNDCSRNVYIKPNGFT--LHRNPVAQSTDAA--RGKIGFRHGRHTWE-VIWEGPLGTVAVIGISTKEAALQC--HGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDK---KLYPTVSAVYGNTEVSMV 247          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Match: si:dkey-23n7.10 (si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-64])

HSP 1 Score: 171.014 bits (432), Expect = 5.016e-48
Identity = 87/206 (42.23%), Postives = 124/206 (60.19%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCL 2253
            +W    KSP   +S  +   YFH+ P+ +S  TAG+R   GF+ G   W+   LEPP G+SVMVGVGT+ A LH GD  +VNLIG D +SWGLSYKG IWH G  +++  AFY + T I   L+L  GTL F  +  +  VAF G+  + G++L+ + SSTA   E+ +   +  +++LQE C+ +I +  S    +K LP+P  L
Sbjct:   14 EWDPDSKSPDAHVSVCRQAVYFHISPLLDSQGTAGVRGTKGFTHGEHYWEIEFLEPPYGSSVMVGVGTQNALLHTGDQTFVNLIGMDSESWGLSYKGYIWHKGRSRKYTEAFYERNTVIGVLLDLSAGTLTFSRNGVNLGVAFTGL-EQVGKALYPLVSSTAPETELQLGLRSQRISSLQEHCIHIITQSLSQGRRAKGLPLPASL 218          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Match: si:dkey-23n7.10 (si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-64])

HSP 1 Score: 95.5153 bits (236), Expect = 3.037e-23
Identity = 47/88 (53.41%), Postives = 59/88 (67.05%), Query Frame = 1
Query: 1813 GTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGV 2076
            G+SVMVGVGT+ A LH GD  +VNLIG D +SWGLSYKG IWH G  +++  AFY + T I   L+L  GTL F  +  +  VAF G+
Sbjct:    1 GSSVMVGVGTQNALLHTGDQTFVNLIGMDSESWGLSYKGYIWHKGRSRKYTEAFYERNTVIGVLLDLSAGTLTFSRNGVNLGVAFTGL 88          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Match: spsb3a (splA/ryanodine receptor domain and SOCS box containing 3a [Source:ZFIN;Acc:ZDB-GENE-030131-4182])

HSP 1 Score: 88.5817 bits (218), Expect = 2.373e-18
Identity = 70/215 (32.56%), Postives = 103/215 (47.91%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRC--CSMENFSKLPIPGCLKELLVSTF 2277
            W    +S A  LS EN+ V+ FH +    S  TA IR +   S G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ HNG +  F   F  + + I   L+   GTL F  +     VA   +  K+   +F MA STAA   + +     +  +LQ LC   + +     ++    LP+P  L+ LL S  
Sbjct:  107 WDEGSRSSATLLSCENRKVS-FHSE---YSCGTAAIRGSRELSEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDEDSWGLSYTGLLHHNGDKVSFSSRF-GQGSIIGVHLDTWHGTLTFYKNRKCIGVAATEMKNKH---VFPMACSTAAKSSMKVIRSVSAPTSLQYLCCSRLRKLLPSGVDALRVLPLPPGLRHLLHSKL 313          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Match: spsb1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6122])

HSP 1 Score: 79.337 bits (194), Expect = 9.502e-16
Identity = 67/225 (29.78%), Postives = 107/225 (47.56%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTTI---QCFLNLLD---GTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W++ D+S  + + E+  +  FH  P+  + ST  IR  +G++ G+  W+ +      GT  +VGV T +APLH     Y  L+G + +SWG    +  ++H+G  +  +  PAF     T      FL +LD   GTL F  D     VAF+G+    G+ L+ + S+     EI I  Y   ++     L +LC   +      E  S+   LP+P  LK  L+
Sbjct:   56 WNNDDRSLNIFVKEDNKLI-FHRHPV--AQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATGEAPLH--SVGYTALVGNNSESWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVVLDMDEGTLSFIVDGQYLGVAFRGL---KGKKLYPVVSAVWGHCEIRI-RYINGLDPEPLPLMDLCRRSVRVALGRERLSEIHGLPLPASLKNYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Match: spsb1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6122])

HSP 1 Score: 79.337 bits (194), Expect = 9.502e-16
Identity = 67/225 (29.78%), Postives = 107/225 (47.56%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTTI---QCFLNLLD---GTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W++ D+S  + + E+  +  FH  P+  + ST  IR  +G++ G+  W+ +      GT  +VGV T +APLH     Y  L+G + +SWG    +  ++H+G  +  +  PAF     T      FL +LD   GTL F  D     VAF+G+    G+ L+ + S+     EI I  Y   ++     L +LC   +      E  S+   LP+P  LK  L+
Sbjct:   56 WNNDDRSLNIFVKEDNKLI-FHRHPV--AQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATGEAPLH--SVGYTALVGNNSESWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVVLDMDEGTLSFIVDGQYLGVAFRGL---KGKKLYPVVSAVWGHCEIRI-RYINGLDPEPLPLMDLCRRSVRVALGRERLSEIHGLPLPASLKNYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Match: ints13 (integrator complex subunit 13 [Source:Xenbase;Acc:XB-GENE-997276])

HSP 1 Score: 172.94 bits (437), Expect = 2.291e-48
Identity = 90/211 (42.65%), Postives = 123/211 (58.29%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCLKELLVS 2271
            W +H ++P   LS    V YFH DP+ ES  TAG+R + GF  G   W+   LEPP G SVMVGVGT +A LH GD+ +VNL+G D +SWGLSYKG  WH G  +++   FY K T I   LN+ +GTL F  +     VAF G+  K    L+ M SST+ G E+A+     ++ +LQE CL  +    + ++    LP+P  ++ LL S
Sbjct:   23 WDAHCQTPGTELSPCHRVVYFHTDPVLESCGTAGMRGSTGFLHGEHYWEIEFLEPPSGLSVMVGVGTGRAALHAGDFQFVNLLGMDTESWGLSYKGTAWHGGTSRRYTEPFYEKGTVIGVHLNIDEGTLAFYRNRQSLGVAFTGL-QKVQSPLYPMVSSTSPGTELAVGLQCSTLPSLQERCLSTLAHSLAQKDMVDCLPLPAAVRWLLKS 232          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Match: ints13 (integrator complex subunit 13 [Source:Xenbase;Acc:XB-GENE-997276])

HSP 1 Score: 172.94 bits (437), Expect = 2.616e-48
Identity = 90/211 (42.65%), Postives = 123/211 (58.29%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCLKELLVS 2271
            W +H ++P   LS    V YFH DP+ ES  TAG+R + GF  G   W+   LEPP G SVMVGVGT +A LH GD+ +VNL+G D +SWGLSYKG  WH G  +++   FY K T I   LN+ +GTL F  +     VAF G+  K    L+ M SST+ G E+A+     ++ +LQE CL  +    + ++    LP+P  ++ LL S
Sbjct:   32 WDAHCQTPGTELSPCHRVVYFHTDPVLESCGTAGMRGSTGFLHGEHYWEIEFLEPPSGLSVMVGVGTGRAALHAGDFQFVNLLGMDTESWGLSYKGTAWHGGTSRRYTEPFYEKGTVIGVHLNIDEGTLAFYRNRQSLGVAFTGL-QKVQSPLYPMVSSTSPGTELAVGLQCSTLPSLQERCLSTLAHSLAQKDMVDCLPLPAAVRWLLKS 241          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:550104])

HSP 1 Score: 90.1225 bits (222), Expect = 9.740e-19
Identity = 67/210 (31.90%), Postives = 98/210 (46.67%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC--SMENFSKLPIPGCLKELL 2265
            W    KS A  LS +     FH++    S  TA IR N   + G   W+  +  P  GT +MVG+GT    L    + + +L+G D +SWGLSY GL+ H G +  F   F  + + I   L+   G L F  +     VA   +  K    LF M  STAA   + +    C   +LQ LC   + +    S+++   LP+P  LK++L
Sbjct:  107 WDDCSKSTATVLSCDNRKVSFHME---YSCGTAAIRGNRMLTEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGLLQHKGDKSNFSSRF-GQGSIIGVHLDTWHGVLTFYKNRKCIGVAATQLRNK---KLFPMVCSTAAKSSMKVIRSCCCRTSLQYLCCARLRQLLPDSVDSLEVLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Match: SPSB1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:NCBI gene;Acc:100380153])

HSP 1 Score: 77.7962 bits (190), Expect = 4.199e-15
Identity = 64/225 (28.44%), Postives = 106/225 (47.11%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTT------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W+++D+S  V + E+  +  FH  P+  + ST  IR  IG++ G+  W+   +    GT  +VGV T  APLH     Y  LIG + +SWG    +  ++H+G  +  +  PAF     T          L++ DGTL F  D     +AF+G+    G+ L+ + S+     EI +  Y   ++     L +LC   +      +  ++   LP+P  LK  L+
Sbjct:   56 WNNNDRSLNVFVKEDDKLV-FHRHPV--AQSTDAIRGKIGYTRGLHVWEITWVMRQRGTHAVVGVATADAPLH--SVGYTTLIGSNGKSWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVVLDMDDGTLSFVVDGQYMGIAFRGL---KGKKLYPVVSAVWGHCEIKM-RYLNGLDPEPLPLMDLCRRSVRLALGKDRLNEIQALPLPAALKGYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:550104])

HSP 1 Score: 71.633 bits (174), Expect = 9.275e-13
Identity = 59/210 (28.10%), Postives = 86/210 (40.95%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC--SMENFSKLPIPGCLKELL 2265
            W    KS A  LS +     FH++    S  TA IR N   + G   W+  +  P  GT +MVG+GT    L    + + +L+G D +SWGLSY G +W               YT                       V F  +     + LF M  STAA   + +    C   +LQ LC   + +    S+++   LP+P  LK++L
Sbjct:  107 WDDCSKSTATVLSCDNRKVSFHME---YSCGTAAIRGNRMLTEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGKLW--------------PYT-----------------------VGFAHL--ARNKKLFPMVCSTAAKSSMKVIRSCCCRTSLQYLCCARLRQLLPDSVDSLEVLPLPPGLKQVL 274          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.5741 bits (205), Expect = 1.080e-16
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.5741 bits (205), Expect = 1.080e-16
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 83.5741 bits (205), Expect = 1.379e-16
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  142 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 344          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Match: Spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:MGI Symbol;Acc:MGI:1891471])

HSP 1 Score: 82.8037 bits (203), Expect = 4.842e-16
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  253 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 455          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Match: Spsb4 (splA/ryanodine receptor domain and SOCS box containing 4 [Source:MGI Symbol;Acc:MGI:2183445])

HSP 1 Score: 77.0258 bits (188), Expect = 6.290e-15
Identity = 62/224 (27.68%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQFC--PAF------YSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCC---SMENFSKLPIPGCLKELL 2265
            W+  D+S  V + ++  +  FH  P+  + ST GIR  +G + G+  W+        GT  +VGV T +APLH     Y  L+G D +SWG    +  ++H+G  +     PAF      ++   ++   L++ +GTL F  D     VAF+G+    G+ L+ + S+     E+ +  Y   ++     L +LC   I        + +   LP+P  LK  L
Sbjct:   56 WNPEDRSLNVFVKDDDRLT-FHRHPV--AQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATARAPLH--SVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGL---KGKKLYPVVSAVWGHCEVTM-RYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYL 270          
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Match: sp|Q28DT9|SPSB3_XENTR (SPRY domain-containing SOCS box protein 3 OS=Xenopus tropicalis OX=8364 GN=spsb3 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 5.160e-18
Identity = 67/210 (31.90%), Postives = 98/210 (46.67%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC--SMENFSKLPIPGCLKELL 2265
            W    KS A  LS +     FH++    S  TA IR N   + G   W+  +  P  GT +MVG+GT    L    + + +L+G D +SWGLSY GL+ H G +  F   F  + + I   L+   G L F  +     VA   +  K    LF M  STAA   + +    C   +LQ LC   + +    S+++   LP+P  LK++L
Sbjct:  107 WDDCSKSTATVLSCDNRKVSFHME---YSCGTAAIRGNRMLTEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGLLQHKGDKSNFSSRF-GQGSIIGVHLDTWHGVLTFYKNRKCIGVAATQLRNK---KLFPMVCSTAAKSSMKVIRSCCCRTSLQYLCCARLRQLLPDSVDSLEVLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Match: sp|Q5M9B1|SPSB3_XENLA (SPRY domain-containing SOCS box protein 3 OS=Xenopus laevis OX=8355 GN=spsb3 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 8.477e-18
Identity = 66/210 (31.43%), Postives = 98/210 (46.67%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC--SMENFSKLPIPGCLKELL 2265
            W    KS A  LS +     FH++    S  TA IR N   + G   W+  +  P  GT +MVG+GT    L    + + +L+G D +SWGLSY GL+ H G +  F   F  + + I   L+   G L F  +     VA   +  K    LF +  STAA   + +    C   +LQ LC   + +    S+++   LP+P  LK++L
Sbjct:  107 WDDCSKSTATVLSCDDRKVSFHME---YSCGTAAIRGNKMLTEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGLLQHKGDKSNFSSRF-GQGSIIGVHLDTWHGVLTFYKNRKRIGVAATQLRNK---KLFPLVCSTAAKSSMKVIRSCCCRTSLQYLCCARLRQLLPGSVDSLEVLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Match: sp|Q6PJ21|SPSB3_HUMAN (SPRY domain-containing SOCS box protein 3 OS=Homo sapiens OX=9606 GN=SPSB3 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 6.371e-17
Identity = 67/210 (31.90%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +T    S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATKLQNKR---FYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Match: sp|Q3MHZ2|SPSB3_BOVIN (SPRY domain-containing SOCS box protein 3 OS=Bos taurus OX=9913 GN=SPSB3 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.802e-16
Identity = 66/210 (31.43%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +     S+ +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  106 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATQLQNK---RFYPMVCSTAAKSSMKVIRSCASVTSLQYLCCFRLRQLRPGSGDTLEGLPLPPGLKQVL 308          
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Match: sp|Q571F5|SPSB3_MOUSE (SPRY domain-containing SOCS box protein 3 OS=Mus musculus OX=10090 GN=Spsb3 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 7.554e-16
Identity = 65/210 (30.95%), Postives = 94/210 (44.76%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI--FRCCSMENFSKLPIPGCLKELL 2265
            W   +KS A  LS +     FH++    S  TA IR       G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     VA   +        + M  STAA   + +     S  +LQ LC   +   R  S +    LP+P  LK++L
Sbjct:  107 WDDLNKSSATLLSCDNRKVSFHME---YSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRL---QNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVL 309          
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Match: C3Y974 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118668 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.433e-50
Identity = 97/214 (45.33%), Postives = 129/214 (60.28%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCS-MENFSKLPIPGCLKELLVSTF 2277
            +W  ++KSP V LS  +  AYFHVDP+  S  TAG+R   GF+TG   W+   LEPP GTSVMVGVGTKKA LH G+Y Y+NL+G D++SWGLSYKG  WHNG  +Q+   FY + T I   LNL +GTL +  +     VAF+ +    GE L+ +  STAA  E+ +   +C  N+LQE C   I +     +   KLP+P  +K  L   +
Sbjct:   23 RWDVNNKSPEVQLSSCQLAAYFHVDPVDSSIGTAGVRGTKGFTTGEHYWEVIFLEPPHGTSVMVGVGTKKALLHLGNYQYINLLGRDEESWGLSYKGTTWHNGKYQQYTEPFYDQTTVIGVHLNLYNGTLTYYRNGKSLGVAFRSI--NRGEELYPIICSTAAETEMELGMRSCRFNSLQEKCCFTIMQAMKGKQAVDKLPLPTVIKSRLKEQY 234          
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Match: A0A4W3JEU6 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=LOC103174954 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 5.075e-49
Identity = 93/210 (44.29%), Postives = 130/210 (61.90%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMEN-FSKLPIPGCLKELL 2265
            +W  + KSPA  LS  +   YFH+DP+ +S  TAG+R   GF+ G   W+   LEPP GTSVMVG GT++A LH G+Y ++N++G D +SWGLSYKG IWH+G  +Q+   FY + T I   LNL  GT+ F  +  +  VAF G+  K G SL+ +ASSTAA  E+ +    C  ++LQE CL  + +    +N  + LP+P  +K LL
Sbjct:   20 EWDINAKSPAAQLSPCRRAVYFHIDPVLKSVGTAGVRGTKGFNHGEHYWEIEFLEPPYGTSVMVGAGTRRALLHTGNYQFINMLGMDSESWGLSYKGTIWHDGQSRQYTEPFYEQATIIGINLNLYTGTMTFYRNGQNLGVAFSGL-NKVGASLYPIASSTAAETELQLGVRGCRFHSLQEWCLYTVLQNLRDKNHINALPLPELIKGLL 228          
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Match: A0A401P950 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0010594 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.831e-47
Identity = 97/213 (45.54%), Postives = 129/213 (60.56%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSME-NFSKLPIP----GCLKEL 2262
            +W  + KSPAV LS  +   YFHVD + +S +TAG+R   GF+ G+  W+   LEPP GTSVMVG GT++A LH G+Y +VNL+G D +SWGLSYKG IWH G  K++   FY K T I   LNL DGT+ F  +  +  VAF G+  K G  L+ M SSTAA  E+ +   +C   +LQE CL  + +    + +   LP+P    G LKE 
Sbjct:   20 EWDINAKSPAVLLSPCRRAVYFHVDSLLQSEATAGVRGTKGFAHGVHYWEVKFLEPPYGTSVMVGAGTEQACLHLGNYTFVNLLGMDSESWGLSYKGTIWHGGRSKRYTEPFYDKATIIGVDLNLYDGTMAFYKNGHNLGVAFTGL-NKIGMPLYPMTSSTAAETELQLGVRSCRFASLQEQCLHTVLQHLEDKAHIDTLPLPEFIRGQLKEF 231          
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Match: W5MER4 (Si:dkey-23n7.10 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.803e-46
Identity = 92/210 (43.81%), Postives = 121/210 (57.62%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSK-LPIPGCLKELL 2265
            +W    KSPA  LS  +   YFH DP+ ES  TAG+R   GFS G   W+   LEPP G+SVMVG+GTKKA LH G+Y +++L+G D +SWGLSYKG +WH G  + +   FY K T I   LNL  GTL F  +     +AF G+  + G  L+ + SSTA   E+ +   TC   +LQE CL  I +       +  LP+P  L+E L
Sbjct:   10 EWDMDAKSPAARLSPCRRAVYFHTDPVLESEGTAGVRGTKGFSHGEHYWEIEFLEPPCGSSVMVGLGTKKALLHTGNYQFIDLLGMDCESWGLSYKGSVWHGGESRTYTQPFYDKSTVIGVLLNLHTGTLVFYRNGSSLGLAFSGL-DQVGAPLYPLVSSTAPETELFLGLRTCQFTSLQERCLQAIAQTLGQRAAADSLPLPAALQEQL 218          
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Match: A0A210QSW3 (SPRY domain-containing SOCS box protein 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05634 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.348e-45
Identity = 89/211 (42.18%), Postives = 124/211 (58.77%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVI---FRCCSMENFSKLPIPGCLKELL 2265
            W   +KSP + LS +   AYF++DP++ S  TAG+R   GF+ G   W+   LEPP GTSVM+GVGT+KA LH GDY +V+L+G D +SWGLSY+G +WH+G+ ++FC   + +   I C LNL  GTL +  D     VAF G+       L+ M SSTA   E+ +   +C   +LQE C   I    RC S +    LP+P  +K  +
Sbjct:   26 WDQFNKSPDIQLSPDLENAYFYIDPVYNSTGTAGVRGTKGFTEGEHYWEVTFLEPPNGTSVMIGVGTEKAGLHTGDYRFVDLLGIDRESWGLSYRGDLWHDGMCQEFCAPMFHR-AVIGCHLNLYKGTLAYYQDGHQLGVAFTGL-NNLSMPLYPMVSSTATETELGLGKRSCRYLSLQEKCYQAIKNSLRCSSEDEVDNLPLPKTMKTFI 234          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Match: si:dkey-23n7.10 (si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-64])

HSP 1 Score: 137.887 bits (346), Expect = 1.670e-36
Identity = 79/206 (38.35%), Postives = 113/206 (54.85%), Query Frame = 1
Query: 1639 KWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCC-SMENFSKLPIPGCL 2253
            +W +  KSP   LS      YFH+ P+ ES  TAG+R    F+ G   W+   LEP  G+SVMVGVGT  A LH  +  ++NLI  D +SWGLSYKG +WHNG  +++   FY + T I   L+   GTL F  +  +  +AF  +  +   +L+ M SSTA   E+ +   T  +++LQE C+  I  C   + +   LP+P  L
Sbjct:   14 EWDTEGKSPDACLSSCHQSVYFHISPLLESQGTAGVRGT-RFTHGEHYWEIEFLEPLYGSSVMVGVGTLNARLH-AEGQFINLI-MDTESWGLSYKGFLWHNGRSRKYTEPFYDRNTVIGVLLDRTAGTLTFYKNGKNLGLAFSDL-DRVASALYPMVSSTAPETELQLGLRTSRLSSLQEHCIHTITHCLGKLGHTHSLPLPRAL 215          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Match: spsb3b (splA/ryanodine receptor domain and SOCS box containing 3b [Source:ZFIN;Acc:ZDB-GENE-121226-2])

HSP 1 Score: 84.3445 bits (207), Expect = 4.098e-17
Identity = 62/191 (32.46%), Postives = 89/191 (46.60%), Query Frame = 1
Query: 1633 IIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFR 2205
            +  W     SPAV LS +     FH D    S  TA IR +     G   W+  +  P  GT +MVG+GT +  L    + + +L+G D  SWGLSY GL+ H G ++ F   F  + + I   L+  +GTL F  +     VA  G+  K   S + M  STAA   + +     +  +LQ LC   + R
Sbjct:  102 VWAWDEECISPAVFLSCSNRKVSFHPD---YSCGTAAIRGSAELRHGQHFWEIKMTSPVYGTDMMVGIGTAEVNLDQYRHSFSSLLGVDAHSWGLSYTGLLHHKGTKENFSRRF-GQGSIIGLHLDTWNGTLTFYKNRRWIGVAATGLRNK---SFYPMVCSTAAKSSMKVIRSVSAPTSLQYLCCTHLRR 285          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Match: spsb3a (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:103027856])

HSP 1 Score: 82.0333 bits (201), Expect = 3.158e-16
Identity = 68/215 (31.63%), Postives = 100/215 (46.51%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLS-ENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRC--CSMENFSKLPIPGCLKELLVSTF 2277
            W    +S A  LS EN+ V+ FH +    S  TA IR +   S G   W+  +  P  GT +MVG+GT    L    + + +L+G D+ SWGLSY GL+ HNG +  F   F  + + I   L+   G L F  +     VA   +  K    ++ MA STAA   + +     +  +LQ LC   + +      +    LP+P  L+ LL S  
Sbjct:  107 WDEGSRSAATLLSCENRKVS-FHSE---YSCGTAAIRGSKELSEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDEDSWGLSYTGLLHHNGDKMSFSSRF-GQGSIIGVHLDTWHGRLTFFKNRKCIGVAATELQNK---RVYPMACSTAAKSSMKVIRSVSAPTSLQYLCCWRLRKLLPSGADALGVLPLPPGLRHLLHSKL 313          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Match: spsb1 (splA/ryanodine receptor domain and SOCS box containing 1 [Source:NCBI gene;Acc:103042472])

HSP 1 Score: 78.5666 bits (192), Expect = 1.493e-15
Identity = 67/225 (29.78%), Postives = 107/225 (47.56%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEK--QFCPAFYSKYTTI---QCFLNLLD---GTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFSK---LPIPGCLKELLV 2268
            W++ D+S  + + E+  +  FH  P+  + ST  IR  +G++ G+  W+ +      GT  +VGV T +APLH     Y  L+G +++SWG    +  ++H+G  +  +  PAF     T      FL +LD   GTL F  D     VAF+G+    G  L+ + S+     EI I  Y   ++     L +LC   +      E  S+   LP+P  LK  L+
Sbjct:   56 WNNDDRSLNIFVKEDNKLI-FHRHPV--AQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATGEAPLH--SVGYTALVGNNNESWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVVLDMDEGTLSFIVDGQYLGVAFRGL---KGRKLYPVVSAVWGHCEIRI-RYINGLDPEPLPLMDLCRRSVRVALGRERLSEIHGLPLPVSLKNYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Match: spsb4a (SPRY domain-containing SOCS box protein 4-like [Source:NCBI gene;Acc:103021520])

HSP 1 Score: 72.0182 bits (175), Expect = 2.540e-13
Identity = 60/227 (26.43%), Postives = 102/227 (44.93%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQFC-----PAFYSKY------TTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCC---SMENFSKLPIPGCLKELL 2265
            W++ D+S  + + ++  +  FH  P+  + ST  IR  +G++ G+  W+        GT  +VGV T +APLH     Y +L+G D +SWG    +  ++HN   +        P+F           T+   L++ +GTL F  D     VAF+G+    G+ L+ + S+     EI +  Y   ++     L +LC            ++    LP+P  LK  L
Sbjct:   57 WNADDRSLNIFIKDDDKLT-FHRHPV--AQSTDCIRGRVGYTRGLHVWRIHWPSRQRGTHAVVGVATAEAPLH--SVGYTSLVGSDGESWGWDLGRNKLYHNSKNRPASSSPTYPSFLEPEEAFVLPDTLVVVLDMDEGTLSFMVDGQYLGVAFRGL---KGKKLYPIVSAVWGHCEITM-RYINGLDPEPLPLMDLCRRAARLALGRDRLQQIETLPLPQSLKNYL 274          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Sea Lamprey
Match: si:ch1073-228j22.2 (si:ch1073-228j22.2 [Source:ZFIN;Acc:ZDB-GENE-110411-227])

HSP 1 Score: 63.5438 bits (153), Expect = 2.755e-11
Identity = 62/224 (27.68%), Postives = 93/224 (41.52%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQF---------CPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIA---ITSYTCSMNTLQELCLGVIFRCC---SMENFSKLPIPGCLKELL 2265
            +SS D SP++SL E  ++   H  P+ ++   A  R    +  G+  W+        GT   VGV T  APL      YV L+G   +SWG    +   +H  V+            C +F+     +   L++ +GTL F  D     VAF G+    G++L+   S+     EI    I         L ELC   I  C     +E  + LP+P  +K  L
Sbjct:   55 FSSTDLSPSMSLKEGDALT-VHRRPMRDTTDAA--RGRTAYRRGVHTWEITWPTEQRGTHAAVGVATSDAPLEA--TGYVALVGRGRESWGWDLGRCKAYHGAVDSPGRPYPAHLLPCESFHVPERLVMA-LDMEEGTLSFVVDGEYLGVAFSGL---RGKTLYPAVSAVWGNCEIKMRYINGIEPGPLPLDELCRRSIRNCLGNDRLEEINALPLPTLIKRYL 269          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001173.1 (pep scaffold:Pmarinus_7.0:GL481490:14086:14830:1 gene:ENSPMAG00000001050.1 transcript:ENSPMAT00000001173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 7.245e-7
Identity = 42/144 (29.17%), Postives = 65/144 (45.14%), Query Frame = 1
Query: 1753 NIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGV------EKQFCPAFYS---KYTTIQCFLNLLD---GTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAI 2145
            ++GF+ G+  W+        GT  +VGV T  APLH     Y +L+G    SWG    +  ++H G       E +  PA+ +    +     FL +LD   GT+ F  D     VAF+G+    G  L+ + S+     EI +
Sbjct:   67 SVGFTRGLHAWEVTWPARQRGTHAVVGVATADAPLH--SVGYTSLVGSTADSWGWDLGRNKLYHAGKAVGRDGEHRTYPAYLTADESFVVSDSFLVVLDMDEGTVSFVVDGQYLGVAFRGL---KGRKLYPVVSAVWGHCEITM 205          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Nematostella
Match: EDO48444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX3])

HSP 1 Score: 145.206 bits (365), Expect = 5.315e-39
Identity = 81/203 (39.90%), Postives = 118/203 (58.13%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPG 2247
            W    +SP V L  +  VA FH+DP+ ES  TA +  N  F+ G   W+  L +   GTS+M+GV T+ A LH  +Y YVNL+G D +SWGLS++G IWH G + +FC  F+   T I   L++  GT+ F F  G PL VAF G+  + G  L+ +ASSTA+  E+ +    C  +TL + C   I +  + +N ++LP+P 
Sbjct:   47 WDFQSRSPNVYLCYHNKVACFHIDPVVESTGTAAVLGNKAFAHGQHYWEIKLTDV-RGTSMMIGVATQDAMLHTDNYEYVNLVGRDQESWGLSHRGEIWHGGQKWKFCEPFFDS-TVIGVLLDMDKGTISF-FKNGQPLGVAFTGLQDR-GCELYPIASSTASESEVELGYRCCKYSTLIDQCCMEIIKHVNRDNMNRLPLPA 245          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Nematostella
Match: EDO28769 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5J3])

HSP 1 Score: 105.531 bits (262), Expect = 1.637e-26
Identity = 63/151 (41.72%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 1726 SNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTL 2175
            S  TA +  N  F+ G   W+  L +   GTS+M+GV T+ A LH  +Y YVNL+G D +SWGLS++G IWH G + +FC  F+   T I   L++  GT+ F F  G PL VAF G+  + G  L+ +ASSTA+  E+ +    C  +TL
Sbjct:    1 STGTAAVLGNKAFAHGQHYWEIKLTDVR-GTSMMIGVATQDAMLHTDNYEYVNLVGRDQESWGLSHRGEIWHGGQKWKFCEPFFDS-TVIGVLLDMDKGTISF-FKNGQPLGVAFTGLQDR-GCELYPIASSTASESEVELGYRCCKYSTL 147          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Nematostella
Match: EDO48347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX4])

HSP 1 Score: 86.6557 bits (213), Expect = 1.545e-19
Identity = 57/170 (33.53%), Postives = 85/170 (50.00%), Query Frame = 1
Query: 1762 FSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSM-ENFSKLPIPGCLKELLV 2268
            F  G+  W+  +     GT +MVGVGTK   L      + +++G D  SWGLSY G   H+G+   +   F  + TTI   ++   G L F  D+    VA +G+    G+ L+ M SSTAA  ++ +T  T   ++LQ LC   I +  S   N   LP+P  +K+ L 
Sbjct:   16 FDGGVHYWEVKMTSAVYGTDMMVGVGTKDTDLERYRSSFCSILGRDQDSWGLSYFGTFHHDGLTHDYTTKF-DRGTTIGIHVDTWSGRLTFLRDDQPLGVAAEGL---KGKELYPMVSSTAARTKMRLTRSTSLKHSLQYLCCEAIGKALSHPNNVHDLPLPPGVKKHLA 181          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Nematostella
Match: EDO41486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4A9])

HSP 1 Score: 78.1814 bits (191), Expect = 7.620e-16
Identity = 69/240 (28.75%), Postives = 110/240 (45.83%), Query Frame = 1
Query: 1618 EILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYC--YVNLIGYDDQSWGLS-YKGLIWHNGVEKQFCPAFYSKYTT-----------IQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIA---ITSYTCSMNTLQELCLGVIFRCCSMENFSK-----LPIPGCLKELLV 2268
            E  ++   W+  D+S  V + ++     FH  P+  + ST  IR+ +GF+ G   W+        GT  +VGV T KAPLH    C  Y +L+G  +  WG    +  ++H+  EK      Y  +              +  L++ +GTL F+  EG  L VAF+G+    G++++ + S+     EIA   I         LQ+LC   I +    EN SK     LP+P  +K+ L+
Sbjct:   54 EERQAEFAWNPADRSVNVFVKDDDPFT-FHRHPV--AQSTDSIRAKVGFNRGFHVWEIHWSTRQRGTHAVVGVATAKAPLH----CTGYHSLVGNTEDGWGWDIVRNKLYHD--EKGNSTVKYPAHNADIEHNFVVPDRFRVILDMDEGTLAFETLEGKYLGVAFRGL---KGQTVYPVVSAVWGHCEIAMRYIGGLDPEPQPLQDLCRRAIRKSIGKENLSKANINTLPLPVPMKKYLL 281          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Match: spsb3b (splA/ryanodine receptor domain and SOCS box containing 3 [Source:NCBI gene;Acc:101162324])

HSP 1 Score: 87.8113 bits (216), Expect = 7.664e-18
Identity = 68/211 (32.23%), Postives = 96/211 (45.50%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELC---LGVIFRCCSMENFSKLPIPGCLKELL 2265
            W  H KS    LS++     FH D    S  TA IR     S G   W+  +  P  GT +MVG+GT +  L    Y + +L+G+D+ SWGLSY GL+ H G + +F P F  + + I   L+   GTL F  +     VA   +  K     + M  STAA   + +     +  +LQ LC   L     CC  +    L +P  L+  L
Sbjct:  109 WDEHCKSSGAFLSKDSRKVSFHSD---YSCGTAAIRGRKELSEGQHYWEVKMTSPVYGTDMMVGIGTSEVNLDKFKYSFGSLLGHDEDSWGLSYTGLLQHKGDKVKFSPRF-GQGSVIGVHLDTWHGTLSFYQNRQFIGVAATNLQNK---KFYPMVCSTAAKSSMKVIRACYTPTSLQYLCSARLRQTLPCCP-DVVGALELPPGLRTFL 311          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Match: spsb3a (SPRY domain-containing SOCS box protein 3 [Source:NCBI gene;Acc:101158278])

HSP 1 Score: 75.8702 bits (185), Expect = 3.574e-14
Identity = 61/210 (29.05%), Postives = 96/210 (45.71%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCS--MENFSKLPIPGCLKELL 2265
            W +  +S A  LS +     FH +    S  TA IR +   + G   W+  +  P  GT +MVG+GT +  L    + + +L+G D  SWGLSY GL+ H G +  F   F  + + I   L+   GTL F  +     +A   +  K     + MA STAA   + +     +  +L  LC   + +     ++    LP+P  L++LL
Sbjct:  108 WDATSRSTATLLSCDNRKVNFHSE---YSCGTAAIRGSKELAEGQHFWEIKMTSPVYGTDMMVGIGTSEVNLDKYRHTFCSLLGKDADSWGLSYTGLLHHKGDKMNFSTRF-GQGSIIGVHLDTWHGTLTFFKNRKCIGIAATELQNK---RFYPMACSTAAKSSMKVIRSCSAPTSLLYLCCARLRQLAPDCIDILDVLPLPPGLRQLL 310          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Match: spsb1 (SPRY domain-containing SOCS box protein 1 [Source:NCBI gene;Acc:101155685])

HSP 1 Score: 73.1738 bits (178), Expect = 8.673e-14
Identity = 61/225 (27.11%), Postives = 104/225 (46.22%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNG--VEKQFCPAFYSKYTT------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSMENFS---KLPIPGCLKELLV 2268
            W++ D+S  V + ++  +  FH  P+  + ST  IR  +G++ G+  W+ +      GT  +VGV T  APLH     Y  L+G + +SWG    +  ++H+G  +  +  P F     T      +   L++ +GTL +  D     VAF+G+    G  L+ + S+     EI I  Y   ++    +L +LC   +      E      +LP+P  LK  L+
Sbjct:   56 WNNDDRSLNVFVKDDNKLV-FHRHPV--AQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATSDAPLH--SVGYTALVGSNAESWGWDLCRSKLYHDGKNLPGKTYPGFLEPGDTFIIPDSLLVVLDMDEGTLGYIVDGHYLGVAFRGL---KGRKLYPVVSAVWGHCEIRI-RYINGLDPEPLSLMDLCRRSVRVALGRERLGEIHRLPLPASLKNYLL 271          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Match: spsb4a (SPRY domain-containing SOCS box protein 4 [Source:NCBI gene;Acc:101166894])

HSP 1 Score: 73.1738 bits (178), Expect = 1.011e-13
Identity = 63/228 (27.63%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQF--CPAFYSKYTT----------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSME---NFSKLPIPGCLKELL 2265
            W+  D+S  V + E+  +  FH  P+  + ST  IR  +G++ G+  W+        GT  +VGV T +APLH     Y  L+G D +SWG    +  + H+G  +    C   Y  +            +   L++ +GTL F  D     VAF+G+    G+ L+ + S+     E++I  Y   ++     L +LC  V       E   +   LP+P  LK  L
Sbjct:   57 WNPDDRSLNVFVKEDDKLT-FHRHPV--AQSTDCIRGRVGYTRGLHVWRIHWPVRQRGTHAVVGVATAEAPLH--SVGYTALVGSDSESWGWDLGRNRLNHDGKNRPVSSCAPTYPSFLEPDESFVLPDCLTVILDMDEGTLSFMVDGQYLGVAFRGL---KGKRLYPIVSAVWGHCEVSI-RYVNGLDPEPLPLMDLCRRVARLALGRERIHHIDALPLPQTLKNYL 275          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Match: spsb4a (SPRY domain-containing SOCS box protein 4 [Source:NCBI gene;Acc:101166894])

HSP 1 Score: 73.1738 bits (178), Expect = 1.011e-13
Identity = 63/228 (27.63%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQF--CPAFYSKYTT----------IQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMN----TLQELCLGVIFRCCSME---NFSKLPIPGCLKELL 2265
            W+  D+S  V + E+  +  FH  P+  + ST  IR  +G++ G+  W+        GT  +VGV T +APLH     Y  L+G D +SWG    +  + H+G  +    C   Y  +            +   L++ +GTL F  D     VAF+G+    G+ L+ + S+     E++I  Y   ++     L +LC  V       E   +   LP+P  LK  L
Sbjct:   57 WNPDDRSLNVFVKEDDKLT-FHRHPV--AQSTDCIRGRVGYTRGLHVWRIHWPVRQRGTHAVVGVATAEAPLH--SVGYTALVGSDSESWGWDLGRNRLNHDGKNRPVSSCAPTYPSFLEPDESFVLPDCLTVILDMDEGTLSFMVDGQYLGVAFRGL---KGKRLYPIVSAVWGHCEVSI-RYVNGLDPEPLPLMDLCRRVARLALGRERIHHIDALPLPQTLKNYL 275          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Planmine SMEST
Match: SMESG000069126.1 (SMESG000069126.1)

HSP 1 Score: 464.922 bits (1195), Expect = 2.233e-160
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 1
Query: 1615 GEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA 2286
            GEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA
Sbjct:    2 GEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQELCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA 225          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Planmine SMEST
Match: SMESG000018608.1 (SMESG000018608.1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.002e-12
Identity = 43/132 (32.58%), Postives = 69/132 (52.27%), Query Frame = 1
Query: 1642 WSSHDKSPAVSLSENKSVAYFHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWGLSY-KGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLRF 2034
            W   D S  + + ++      H  P+  + ST GIR  IGFS+G  CW+   L  PLGT  +VG+ T++A LH+    Y++L+G D+ SWG +    +++H G  ++ C + + KY        +LD   R 
Sbjct:   18 WDGEDCSKNIYVKKDGFT--LHRKPV--ARSTDGIRGKIGFSSGRHCWEIWWL-GPLGTVAVVGIATRQASLHY-QGGYISLLGKDEHSWGWNLVDNVLYHGGKSEKLCES-HLKYKVGDRLRMILDCDERL 142          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Planmine SMEST
Match: SMESG000053741.1 (SMESG000053741.1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.073e-8
Identity = 51/170 (30.00%), Postives = 73/170 (42.94%), Query Frame = 1
Query: 1702 FHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWG--LSYKGLIWHNG--VEKQFCPAFYSK------------------YTTIQCFLNLLDGTLRFQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAI 2145
             H  P+  + ST  IR  IGF+ G   W+        GT  +VGV TK APLH   YC  +LIG  ++SWG  +  K L+      VE Q  P   ++                    +I   L++ +GTL F  D     VAF G+    G +L+   S+     E+ +
Sbjct:   83 LHRHPV--AQSTDSIRGKIGFNRGFHMWRIDWKLRERGTHAVVGVCTKDAPLHCHGYC--SLIGLTEESWGWDIIRKKLVHKQSVDVEDQTYPVIIAEDICSLGDAIERPNTNIEVQESIFVLLDMEEGTLSFINDGQYLGVAFSGL---KGRTLYPAISAVWGHCEVTM 245          
BLAST of SPRY domain-containing SOCS box protein 3 vs. Planmine SMEST
Match: SMESG000053741.1 (SMESG000053741.1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.090e-8
Identity = 52/171 (30.41%), Postives = 76/171 (44.44%), Query Frame = 1
Query: 1702 FHVDPIFESNSTAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYVNLIGYDDQSWG--LSYKGLIWHNG--VEKQFCPAFYSK------------------YTTIQCFLNLLDGTLRFQFDEGDPL-VAFQGVFPKYGESLFAMASSTAAGMEIAI 2145
             H  P+  + ST  IR  IGF+ G   W+        GT  +VGV TK APLH   YC  +LIG  ++SWG  +  K L+      VE Q  P   ++                    +I   L++ +GTL F  ++G  L VAF G+    G +L+   S+     E+ +
Sbjct:   73 LHRHPV--AQSTDSIRGKIGFNRGFHMWRIDWKLRERGTHAVVGVCTKDAPLHCHGYC--SLIGLTEESWGWDIIRKKLVHKQSVDVEDQTYPVIIAEDICSLGDAIERPNTNIEVQESIFVLLDMEEGTLSF-INDGQYLGVAFSGL---KGRTLYPAISAVWGHCEVTM 235          
The following BLAST results are available for this feature:
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPSB31.327e-1731.90splA/ryanodine receptor domain and SOCS box contai... [more]
SPSB31.327e-1731.90splA/ryanodine receptor domain and SOCS box contai... [more]
SPSB43.466e-1528.13splA/ryanodine receptor domain and SOCS box contai... [more]
SPSB18.743e-1528.44splA/ryanodine receptor domain and SOCS box contai... [more]
SPSB18.743e-1528.44splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spsb-24.964e-1225.53SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-15.379e-1125.11SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-16.018e-1125.11SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-16.018e-1125.11SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
spsb-11.627e-1025.99SPSB (SPry and Socs Box) family [Source:UniProtKB... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SP5558.273e-2332.37gene:FBgn0260470 transcript:FBtr0079004[more]
SP5558.273e-2332.37gene:FBgn0260470 transcript:FBtr0333534[more]
SP5559.290e-2332.37gene:FBgn0260470 transcript:FBtr0333535[more]
SP5559.290e-2332.37gene:FBgn0260470 transcript:FBtr0079005[more]
Fsn1.812e-1131.43gene:FBgn0043010 transcript:FBtr0087762[more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-23n7.105.016e-4842.23si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-6... [more]
si:dkey-23n7.103.037e-2353.41si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-6... [more]
spsb3a2.373e-1832.56splA/ryanodine receptor domain and SOCS box contai... [more]
spsb19.502e-1629.78splA/ryanodine receptor domain and SOCS box contai... [more]
spsb19.502e-1629.78splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ints132.291e-4842.65integrator complex subunit 13 [Source:Xenbase;Acc:... [more]
ints132.616e-4842.65integrator complex subunit 13 [Source:Xenbase;Acc:... [more]
spsb39.740e-1931.90splA/ryanodine receptor domain and SOCS box contai... [more]
SPSB14.199e-1528.44splA/ryanodine receptor domain and SOCS box contai... [more]
spsb39.275e-1328.10splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spsb31.080e-1630.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb31.080e-1630.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb31.379e-1630.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb34.842e-1630.95splA/ryanodine receptor domain and SOCS box contai... [more]
Spsb46.290e-1527.68splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DT9|SPSB3_XENTR5.160e-1831.90SPRY domain-containing SOCS box protein 3 OS=Xenop... [more]
sp|Q5M9B1|SPSB3_XENLA8.477e-1831.43SPRY domain-containing SOCS box protein 3 OS=Xenop... [more]
sp|Q6PJ21|SPSB3_HUMAN6.371e-1731.90SPRY domain-containing SOCS box protein 3 OS=Homo ... [more]
sp|Q3MHZ2|SPSB3_BOVIN2.802e-1631.43SPRY domain-containing SOCS box protein 3 OS=Bos t... [more]
sp|Q571F5|SPSB3_MOUSE7.554e-1630.95SPRY domain-containing SOCS box protein 3 OS=Mus m... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y9741.433e-5045.33Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A4W3JEU65.075e-4944.29Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A401P9501.831e-4745.54Uncharacterized protein OS=Scyliorhinus torazame O... [more]
W5MER47.803e-4643.81Si:dkey-23n7.10 OS=Lepisosteus oculatus OX=7918 PE... [more]
A0A210QSW31.348e-4542.18SPRY domain-containing SOCS box protein 3 OS=Mizuh... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-23n7.101.670e-3638.35si:dkey-23n7.10 [Source:ZFIN;Acc:ZDB-GENE-141222-6... [more]
spsb3b4.098e-1732.46splA/ryanodine receptor domain and SOCS box contai... [more]
spsb3a3.158e-1631.63splA/ryanodine receptor domain and SOCS box contai... [more]
spsb11.493e-1529.78splA/ryanodine receptor domain and SOCS box contai... [more]
spsb4a2.540e-1326.43SPRY domain-containing SOCS box protein 4-like [So... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch1073-228j22.22.755e-1127.68si:ch1073-228j22.2 [Source:ZFIN;Acc:ZDB-GENE-11041... [more]
ENSPMAT00000001173.17.245e-729.17pep scaffold:Pmarinus_7.0:GL481490:14086:14830:1 g... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO484445.315e-3939.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287691.637e-2641.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483471.545e-1933.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414867.620e-1628.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spsb3b7.664e-1832.23splA/ryanodine receptor domain and SOCS box contai... [more]
spsb3a3.574e-1429.05SPRY domain-containing SOCS box protein 3 [Source:... [more]
spsb18.673e-1427.11SPRY domain-containing SOCS box protein 1 [Source:... [more]
spsb4a1.011e-1327.63SPRY domain-containing SOCS box protein 4 [Source:... [more]
spsb4a1.011e-1327.63SPRY domain-containing SOCS box protein 4 [Source:... [more]
back to top
BLAST of SPRY domain-containing SOCS box protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000069126.12.233e-160100.00SMESG000069126.1[more]
SMESG000018608.12.002e-1232.58SMESG000018608.1[more]
SMESG000053741.13.073e-830.00SMESG000053741.1[more]
SMESG000053741.13.090e-830.41SMESG000053741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034119 ID=SMED30034119|Name=SPRY domain-containing SOCS box protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2404bp
CTAAAATGTAGGCAATTTGACTCAAGATCTAAAGAAAATTAATGCGTCTA
TACATTATCTGGTGTTCAATACATATCTATTAATCATGTGGATAAATAAT
GAAGGTTTTTTATTACGATAATAGGTTACTTGTACTCGTTTTCATTGGGG
TCATAAAATTGCAGATCTCGAGTTCAGATCCAAATATACTTAGTATCATC
GAGGACCTACAAGGGAGGAATCTGACCACTACCAACGATTTTCAAAGGTT
TATAGTCATTTACATCGCGGTCGGTGGCTTAAACATTGATCGGCCGGTAA
GTCCACAACTGGTTTTTTTCTTATGTTTATTATTTACGCGATGGGGGAAT
ATGCATCAAAAACAAATTATCTGATTAATTAACTAATTTATTAATTTTTA
GCAAAGATTATCTTCGGGTCCTGATTCGGTTAGAGTCTGTGCCAGGATAG
GTTCGTGAGTTGGATCATGTGTCTAAGGCTCTGAAGGTACATTTAAGTCA
AATGATGAAAATATTAGTATTTACTTGCATGGGGAAATTCGTCGGTACTC
GAGACGTTGAATTCCGGGCGTCCCTGGCGGTTCCTTGAAGATTGATCAGC
TTTGCCAGACATATTAATAGTAAATTGAAATGAACGATTTCTTATCGATG
GCGAGTTTTATACCGGAGTGTGTGTCTGCTAGTGTAGACAGTCGTGACCT
ACACACACTCTCTTTCTAACGGATAGTTATCTCGCTCCTGTTGTCGGTAG
TTGCGTATCGATTTTTTTGTTGTCGTGATATTTCTTAAAATATCACATTT
CTCCTCTATCCAGTGTTCCTATTTATAGAATTGGGATTCGGTTGGATTAC
GAAAACTGGTTACCGACAAAAGTTAAAATCTAACGGCGAGAATCTTTCTC
AATTATAGGGATCTATTTTGTTCCACGGGAGTGTTGGTGACAGCTCTTAT
TATAGTTTCCTTATATATTATTATCTGTTACTAGTTATTGATGATGGGGT
TTGGGTCTTTCTGACTGGTTAAACGGGTGTCTGATGCCTCCTCAGTAGGA
TTTCGGCGTATGTTCGGAACTGGAACTTATAAAACTGGACGATTTATGTC
AGATGGATTTAACTATTGCTTGTTACAAGGCCTCTCGCCAGTGGTATTCG
TGAATACTTCCTATGTGTTGTTTCAAATTAAAATTATTGTGATCTACAGT
TTTCCTTTTATTTGTATCAAGTGGGCTTATTTGATATAATTAGTTCCATC
AATTGCCTCCGAACTTATTCAATTCAACGGGAATCTGCCTGTTATACTTT
ATTTACTTAGTGAATTTATTTTCGTTTGGTAAACCTTCTGTAGCATGGTG
TTCTCCTTTGATGTACATTATTATCTAAAGTTTATACAGCTCGGTAGTTT
CTGTTGACGAATATCATATTTTATAAAATTTATGCAATTTAGAGTTATCT
TTTGCTGGATATTATANNTNATNAAANANNTNNNNAANTTNTNNTNTTTG
NTTTNAANNNANNANTNTATNNNNNANNTTGAANNNTNTCATTTNTGNNN
ANAATNNANCANATGNNTNTTNNNCTTNGNNNNATNTNATNNGNNANANN
TAATNNNANNTNNGGGAGAAATATTAAAATCAATTATTAAATGGTCGTCC
CATGACAAAAGTCCTGCAGTGAGTTTGTCAGAAAATAAATCCGTTGCATA
TTTCCATGTGGATCCAATATTTGAAAGCAACAGCACAGCCGGCATTCGAT
CAAATATTGGATTTAGTACTGGAATGATTTGTTGGAAATTTGCTTTACTT
GAACCGCCTTTGGGTACATCGGTAATGGTTGGTGTCGGTACAAAAAAGGC
ACCGTTGCATTTTGGAGACTATTGCTACGTGAATTTAATTGGTTACGATG
ACCAAAGCTGGGGATTGAGTTATAAGGGATTGATTTGGCATAATGGGGTT
GAAAAACAGTTCTGTCCTGCTTTTTATTCGAAATATACTACAATACAATG
TTTTCTAAATTTGCTGGATGGGACTTTGCGTTTTCAATTTGATGAAGGAG
ATCCACTTGTTGCGTTTCAAGGGGTTTTCCCTAAATATGGTGAGTCTTTG
TTTGCTATGGCCAGTTCGACTGCCGCTGGTATGGAGATCGCTATCACTAG
TTACACTTGCTCAATGAATACATTACAAGAGTTATGCTTGGGTGTCATTT
TCCGATGTTGTAGCATGGAGAATTTTTCAAAATTGCCCATTCCTGGTTGT
TTGAAGGAATTGCTGGTATCAACATTTTGTAATGCATGACAGATTTATGT
GTTTANATTTATTTATATATATTTTTATATACATTTACACTCCATTTTCA
CGTATCTATGAAATCTGGTGATTTTTTTGCTAAATCCAATATTTGAAAGC
AACA
back to top

protein sequence of SMED30034119-orf-1

>SMED30034119-orf-1 ID=SMED30034119-orf-1|Name=SMED30034119-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MQFRVIFCWILXXXKXXXXXXXLXXXXXXXXXXEXXHXXXXXXXXXXXXX
XXXXXXXXXXXGEILKSIIKWSSHDKSPAVSLSENKSVAYFHVDPIFESN
STAGIRSNIGFSTGMICWKFALLEPPLGTSVMVGVGTKKAPLHFGDYCYV
NLIGYDDQSWGLSYKGLIWHNGVEKQFCPAFYSKYTTIQCFLNLLDGTLR
FQFDEGDPLVAFQGVFPKYGESLFAMASSTAAGMEIAITSYTCSMNTLQE
LCLGVIFRCCSMENFSKLPIPGCLKELLVSTFCNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003877SPRY_dom
IPR001496SOCS_box
IPR001870B30.2/SPRY
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular