tlx

Overview
Nametlx (AIX99548.1)
Smed IDSMED30034115
Length (bp)816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tlx (SMED30034115) t-SNE clustered cells

Violin plots show distribution of expression levels for tlx (SMED30034115) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tlx (SMED30034115) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tlx (SMED30034115) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034115

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034115SMESG000017206.1 dd_Smed_v4_13781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034115SMESG000017206.1 dd_Smed_v4_13781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034115SMESG000017206.1 dd_Smed_v4_13781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034115SMESG000017206.1 dd_Smed_v6_13781_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
midlineSMED30034115SMESG000017206.1 KJ934817smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30034115SMESG000017206.1 KJ934817smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30034115SMESG000017206.1 dd_Smed_v4_13781_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tlx vs. Ensembl Human
Match: TLX3 (T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc:HGNC:13532])

HSP 1 Score: 141.739 bits (356), Expect = 5.835e-40
Identity = 88/126 (69.84%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++     +N S  P      +S+L A+ NLQPW
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPW 277          
BLAST of tlx vs. Ensembl Human
Match: TLX2 (T cell leukemia homeobox 2 [Source:HGNC Symbol;Acc:HGNC:5057])

HSP 1 Score: 138.658 bits (348), Expect = 6.124e-39
Identity = 86/140 (61.43%), Postives = 100/140 (71.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSFNYT------SSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R Q++ELERRF RQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAER  A R LL LQ +                  +S+L A+ NLQPWA    ++ +S   S
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLAS 282          
BLAST of tlx vs. Ensembl Human
Match: TLX1 (T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5056])

HSP 1 Score: 137.502 bits (345), Expect = 6.325e-38
Identity = 90/139 (64.75%), Postives = 103/139 (74.10%), Query Frame = 2
Query:  299 WIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWA 694
            W+E  R+    R  GHPYQNRTPPK+KKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R LL LQ E  Q +       +P   + SS L A+ NLQPW+
Sbjct:  176 WMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHNSS-LFALQNLQPWS 313          
BLAST of tlx vs. Ensembl Human
Match: TLX1 (T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5056])

HSP 1 Score: 126.331 bits (316), Expect = 1.736e-34
Identity = 60/81 (74.07%), Postives = 66/81 (81.48%), Query Frame = 2
Query:  299 WIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            W+E  R+    R  GHPYQNRTPPK+KKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKW
Sbjct:  176 WMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKW 256          
BLAST of tlx vs. Ensembl Human
Match: BARHL2 (BarH like homeobox 2 [Source:HGNC Symbol;Acc:HGNC:954])

HSP 1 Score: 77.0258 bits (188), Expect = 1.755e-15
Identity = 38/64 (59.38%), Postives = 49/64 (76.56%), Query Frame = 2
Query:  362 TPPKR-KKPR---TSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            +PP R KKPR   T+F+  Q+ +LER F RQKYL+  +R DLA  L++TD+QVKTW+QNRRTKW
Sbjct:  224 SPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKW 287          
BLAST of tlx vs. Ensembl Celegans
Match: ceh-9 (Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Prot;Acc:P56407])

HSP 1 Score: 81.2629 bits (199), Expect = 7.076e-19
Identity = 37/65 (56.92%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  347 PYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            P +     KRKK RT+F+ +Q+ ELE++F  +KYL+SS+R +LAK LD+T++QVK WFQNRRTKW
Sbjct:   61 PIEKCQKTKRKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKW 125          
BLAST of tlx vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 72.4034 bits (176), Expect = 4.008e-16
Identity = 31/57 (54.39%), Postives = 45/57 (78.95%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++K+ R +F   QI +LER+F + KYLA ++R  LA++L+M++SQVK WFQNRRTKW
Sbjct:   18 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKW 74          
BLAST of tlx vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 73.9442 bits (180), Expect = 1.648e-15
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 2
Query:  335 RVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            R+G P   +   K +K RT F  +Q+ ELE  F +QKYL+  +R DLA  + +TD+QVKTW+QNRRTKW
Sbjct:   85 RMGSPGSCK---KSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKW 150          
BLAST of tlx vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 73.9442 bits (180), Expect = 1.648e-15
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 2
Query:  335 RVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            R+G P   +   K +K RT F  +Q+ ELE  F +QKYL+  +R DLA  + +TD+QVKTW+QNRRTKW
Sbjct:   85 RMGSPGSCK---KSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKW 150          
BLAST of tlx vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 74.3294 bits (181), Expect = 1.897e-15
Identity = 31/57 (54.39%), Postives = 45/57 (78.95%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++K+ R +F   QI +LER+F + KYLA ++R  LA++L+M++SQVK WFQNRRTKW
Sbjct:  168 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKW 224          
BLAST of tlx vs. Ensembl Fly
Match: C15 (gene:FBgn0004863 transcript:FBtr0084111)

HSP 1 Score: 139.813 bits (351), Expect = 4.697e-39
Identity = 84/129 (65.12%), Postives = 100/129 (77.52%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-INQSNNP-------SFNYTSSTLSAISNLQPWA 694
            RR+GHPYQNRTPPKRKKPRTSF R Q+ ELE+RFH+QKYLAS+ER  LA+ L MTD+QVKTWFQNRRTKWRRQT+EEREAERQAA+R +L+LQ E I++   P             + L+A+  LQPWA
Sbjct:  203 RRIGHPYQNRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQAEAISKGFAPPSAPLGSQGGVNGAPLAALHGLQPWA 331          
BLAST of tlx vs. Ensembl Fly
Match: B-H1 (gene:FBgn0011758 transcript:FBtr0074430)

HSP 1 Score: 76.6406 bits (187), Expect = 1.698e-15
Identity = 33/57 (57.89%), Postives = 43/57 (75.44%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K++K RT+F   Q+  LE+ F RQKYL+  ER +LA  LD++D QVKTW+QNRRTKW
Sbjct:  298 KQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKW 354          
BLAST of tlx vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0306742)

HSP 1 Score: 74.3294 bits (181), Expect = 1.215e-14
Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++KK RT+F  +QI ELE+ F  +KYL++SER ++AK L +T++QVK WFQNRRTKW
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKW 448          
BLAST of tlx vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0347151)

HSP 1 Score: 74.3294 bits (181), Expect = 1.215e-14
Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++KK RT+F  +QI ELE+ F  +KYL++SER ++AK L +T++QVK WFQNRRTKW
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKW 448          
BLAST of tlx vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0082942)

HSP 1 Score: 74.3294 bits (181), Expect = 1.215e-14
Identity = 33/57 (57.89%), Postives = 46/57 (80.70%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++KK RT+F  +QI ELE+ F  +KYL++SER ++AK L +T++QVK WFQNRRTKW
Sbjct:  392 RKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKW 448          
BLAST of tlx vs. Ensembl Zebrafish
Match: CABZ01067175.1 (T-cell leukemia homeobox protein 3-like [Source:NCBI gene;Acc:100008066])

HSP 1 Score: 142.895 bits (359), Expect = 5.217e-41
Identity = 88/128 (68.75%), Postives = 101/128 (78.91%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQ-------SNNPSFNYTSSTLSAISNLQPWA 694
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREA RQ A+R LL LQ +  Q       S++P     +S+L A+ NLQPWA
Sbjct:  115 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAGRQQANRMLLQLQADALQKSISESVSSDP-LCLHNSSLYALQNLQPWA 241          
BLAST of tlx vs. Ensembl Zebrafish
Match: tlx2 (T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-020208-1])

HSP 1 Score: 142.895 bits (359), Expect = 1.644e-40
Identity = 89/140 (63.57%), Postives = 104/140 (74.29%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN------NPSFNYTSSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R +L LQ E  Q               +S+L A+ NLQPWA    ++ ++S  S
Sbjct:  168 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMLQLQQEAFQKTLSQPLQQDPLCLHNSSLYALQNLQPWAEDNKVTSVTSVAS 307          
BLAST of tlx vs. Ensembl Zebrafish
Match: tlx3b (T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-021021-1])

HSP 1 Score: 142.124 bits (357), Expect = 3.646e-40
Identity = 92/145 (63.45%), Postives = 108/145 (74.48%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPGG 745
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R ++ LQ++  Q +       +P   + SS L A+ NLQPWA        S E+S  GG
Sbjct:  160 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMIQLQHDAFQKSLTDSVPTDPLCIHNSS-LFALQNLQPWA--------SEESSKLGG 295          
BLAST of tlx vs. Ensembl Zebrafish
Match: tlx3b (T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-021021-1])

HSP 1 Score: 142.124 bits (357), Expect = 3.646e-40
Identity = 92/145 (63.45%), Postives = 108/145 (74.48%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPGG 745
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R ++ LQ++  Q +       +P   + SS L A+ NLQPWA        S E+S  GG
Sbjct:  160 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMIQLQHDAFQKSLTDSVPTDPLCIHNSS-LFALQNLQPWA--------SEESSKLGG 295          
BLAST of tlx vs. Ensembl Zebrafish
Match: tlx2 (T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-020208-1])

HSP 1 Score: 140.969 bits (354), Expect = 1.024e-39
Identity = 87/127 (68.50%), Postives = 98/127 (77.17%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN------NPSFNYTSSTLSAISNLQPWA 694
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R +L LQ E  Q               +S+L A+ NLQPWA
Sbjct:  168 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMLQLQQEAFQKTLSQPLQQDPLCLHNSSLYALQNLQPWA 294          
BLAST of tlx vs. Ensembl Xenopus
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:Xenbase;Acc:XB-GENE-6049995])

HSP 1 Score: 143.28 bits (360), Expect = 2.141e-41
Identity = 88/128 (68.75%), Postives = 99/128 (77.34%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWA 694
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L M+DSQVKTWFQNRRTKWRRQT+E+REAERQ  SR +L LQ E  Q         +P   + SS L A+ NLQPWA
Sbjct:   92 RRIGHPYQNRTPPKRKKPRTSFSRLQICELEKRFHRQKYLASAERASLAKALRMSDSQVKTWFQNRRTKWRRQTAEDREAERQQTSRMMLQLQQEAYQKTVSQTLPRDPLCAHNSS-LCALQNLQPWA 218          
BLAST of tlx vs. Ensembl Xenopus
Match: ENSXETT00000011915.1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:100494864])

HSP 1 Score: 142.895 bits (359), Expect = 2.616e-40
Identity = 93/140 (66.43%), Postives = 108/140 (77.14%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPK+KKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R LL LQ E     INQ   P      +S+L A+ NLQPW+    +S+++S TS
Sbjct:  168 RRIGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKTINQPLQPDPICLHNSSLYALQNLQPWS--DDMSKITSVTS 305          
BLAST of tlx vs. Ensembl Xenopus
Match: jup (junction plakoglobin [Source:Xenbase;Acc:XB-GENE-489397])

HSP 1 Score: 139.813 bits (351), Expect = 3.302e-39
Identity = 86/126 (68.25%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R +L LQ++     ++ S  P      +S+L A+ NLQPW
Sbjct:  153 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMLQLQHDAFQKSLSDSIQPDPLCLHNSSLFALQNLQPW 278          
BLAST of tlx vs. Ensembl Xenopus
Match: BARHL2 (BarH like homeobox 2 [Source:NCBI gene;Acc:100493839])

HSP 1 Score: 77.411 bits (189), Expect = 1.089e-15
Identity = 38/64 (59.38%), Postives = 49/64 (76.56%), Query Frame = 2
Query:  362 TPPKR-KKPR---TSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            +PP R KKPR   T+F+  Q+ +LER F RQKYL+  +R DLA  L++TD+QVKTW+QNRRTKW
Sbjct:  203 SPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKW 266          
BLAST of tlx vs. Ensembl Xenopus
Match: BARHL2 (BarH like homeobox 2 [Source:NCBI gene;Acc:100493839])

HSP 1 Score: 77.0258 bits (188), Expect = 1.149e-15
Identity = 38/64 (59.38%), Postives = 49/64 (76.56%), Query Frame = 2
Query:  362 TPPKR-KKPR---TSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            +PP R KKPR   T+F+  Q+ +LER F RQKYL+  +R DLA  L++TD+QVKTW+QNRRTKW
Sbjct:  196 SPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKW 259          
BLAST of tlx vs. Ensembl Mouse
Match: Tlx3 (T cell leukemia, homeobox 3 [Source:MGI Symbol;Acc:MGI:1351209])

HSP 1 Score: 141.739 bits (356), Expect = 3.526e-40
Identity = 88/126 (69.84%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++     +N S  P      +S+L A+ NLQPW
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPW 277          
BLAST of tlx vs. Ensembl Mouse
Match: Tlx2 (T cell leukemia, homeobox 2 [Source:MGI Symbol;Acc:MGI:1350935])

HSP 1 Score: 139.428 bits (350), Expect = 2.293e-39
Identity = 86/140 (61.43%), Postives = 100/140 (71.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSFNYT------SSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R Q++ELERRF RQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAER  A R LL LQ +                  +S+L A+ NLQPWA    ++ +S   S
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLAS 282          
BLAST of tlx vs. Ensembl Mouse
Match: Tlx1 (T cell leukemia, homeobox 1 [Source:MGI Symbol;Acc:MGI:98769])

HSP 1 Score: 137.117 bits (344), Expect = 5.779e-38
Identity = 90/139 (64.75%), Postives = 103/139 (74.10%), Query Frame = 2
Query:  299 WIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWA 694
            W+E  R+    R  GHPYQNRTPPK+KKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R LL LQ E  Q +       +P   + SS L A+ NLQPW+
Sbjct:  179 WMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHNSS-LFALQNLQPWS 316          
BLAST of tlx vs. Ensembl Mouse
Match: Tlx2 (T cell leukemia, homeobox 2 [Source:MGI Symbol;Acc:MGI:1350935])

HSP 1 Score: 129.028 bits (323), Expect = 3.566e-36
Identity = 58/70 (82.86%), Postives = 64/70 (91.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            RR+GHPYQNRTPPKRKKPRTSF+R Q++ELERRF RQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKW
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKW 212          
BLAST of tlx vs. Ensembl Mouse
Match: Barhl2 (BarH like homeobox 2 [Source:MGI Symbol;Acc:MGI:1859314])

HSP 1 Score: 77.411 bits (189), Expect = 9.001e-16
Identity = 34/57 (59.65%), Postives = 45/57 (78.95%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K +K RT+F+  Q+ +LER F RQKYL+  +R DLA  L++TD+QVKTW+QNRRTKW
Sbjct:  228 KPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKW 284          
BLAST of tlx vs. UniProt/SwissProt
Match: sp|O93367|TLX3_CHICK (T-cell leukemia homeobox protein 3 OS=Gallus gallus OX=9031 GN=TLX3 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.955e-40
Identity = 88/126 (69.84%), Postives = 102/126 (80.95%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++     +N+S  P      +S+L A+ NLQPW
Sbjct:  158 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNESIQPDPLCLHNSSLFALQNLQPW 283          
BLAST of tlx vs. UniProt/SwissProt
Match: sp|O55144|TLX3_MOUSE (T-cell leukemia homeobox protein 3 OS=Mus musculus OX=10090 GN=Tlx3 PE=2 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 2.466e-39
Identity = 88/126 (69.84%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++     +N S  P      +S+L A+ NLQPW
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPW 277          
BLAST of tlx vs. UniProt/SwissProt
Match: sp|O43711|TLX3_HUMAN (T-cell leukemia homeobox protein 3 OS=Homo sapiens OX=9606 GN=TLX3 PE=1 SV=3)

HSP 1 Score: 141.739 bits (356), Expect = 2.802e-39
Identity = 88/126 (69.84%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++     +N S  P      +S+L A+ NLQPW
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPW 277          
BLAST of tlx vs. UniProt/SwissProt
Match: sp|Q61663|TLX2_MOUSE (T-cell leukemia homeobox protein 2 OS=Mus musculus OX=10090 GN=Tlx2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.604e-38
Identity = 86/140 (61.43%), Postives = 100/140 (71.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSFNYT------SSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R Q++ELERRF RQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAER  A R LL LQ +                  +S+L A+ NLQPWA    ++ +S   S
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLAS 282          
BLAST of tlx vs. UniProt/SwissProt
Match: sp|O43763|TLX2_HUMAN (T-cell leukemia homeobox protein 2 OS=Homo sapiens OX=9606 GN=TLX2 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.941e-38
Identity = 86/140 (61.43%), Postives = 100/140 (71.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSFNYT------SSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R Q++ELERRF RQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAER  A R LL LQ +                  +S+L A+ NLQPWA    ++ +S   S
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLAS 282          
BLAST of tlx vs. TrEMBL
Match: A0A0A1CQY5 (Tlx (Fragment) OS=Schmidtea mediterranea OX=79327 GN=tlx PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.077e-71
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query:  146 SASFSIDGILSTXXXXXXXXXXXXXXXXXXXXXXXLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            SASFSIDGILSTKKELSESIITSKSEESTKTHSNSLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW
Sbjct:    1 SASFSIDGILSTKKELSESIITSKSEESTKTHSNSLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 132          
BLAST of tlx vs. TrEMBL
Match: K1RAP6 (T-cell leukemia homeobox protein 3 OS=Crassostrea gigas OX=29159 GN=CGI_10020599 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.668e-41
Identity = 94/137 (68.61%), Postives = 115/137 (83.94%), Query Frame = 2
Query:  299 WIEILRQDRYP--RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQS----NNPSFNYTSSTLSAISNLQPW 691
            W++ +R+DR+   RR+GHPYQNRTPPKRKKPRTSF+R QIMELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQAA+R +L+LQNE N++     +P    ++S+L A+ NLQPW
Sbjct:  122 WLD-MRRDRFGVTRRIGHPYQNRTPPKRKKPRTSFSRLQIMELEKRFHRQKYLASAERSTLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRLMLSLQNEANKTIYDVRDP-LCMSNSSLHALQNLQPW 256          
BLAST of tlx vs. TrEMBL
Match: A0A1S3GYP0 (T-cell leukemia homeobox protein 3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106150476 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 7.828e-41
Identity = 94/145 (64.83%), Postives = 116/145 (80.00%), Query Frame = 2
Query:  275 FPPSLPRHWIEILRQDRYP--RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQS---NNPSFNYTSSTLSAISNLQPWA 694
             PPSL   W+E  R+DR    RR+GHPYQNRTPPKRKKPRTSF+R QI+ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQAA+R++++LQ E +++          ++++L A+ NLQPWA
Sbjct:  129 LPPSLQFPWMEA-RKDRLTITRRIGHPYQNRTPPKRKKPRTSFSRLQIIELEKRFHRQKYLASAERSALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRFMMSLQAEASKTIYDTRDPLVLSNASLHALQNLQPWA 272          
BLAST of tlx vs. TrEMBL
Match: A0A345F2S4 (Tlx homeodomain protein (Fragment) OS=Euperipatoides rowelli OX=49087 GN=Tlx PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.349e-40
Identity = 96/152 (63.16%), Postives = 115/152 (75.66%), Query Frame = 2
Query:  263 LSTIFPPSLPRHWIEILR---QDRYP--RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQS---NNPSFNYTSSTLSAISNLQPWA 694
            L T FP      W+E  R   +DR    RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQAA+R++++L  E N+S   +  S    +++L A+ NLQPWA
Sbjct:   87 LQTSFP------WMEATRRLVKDRLTATRRIGHPYQNRTPPKRKKPRTSFSRMQICELEKRFHRQKYLASAERASLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRFMMSLHAEANKSIYDSRDSLCLNNASLHALQNLQPWA 232          
BLAST of tlx vs. TrEMBL
Match: X5JAI5 (Clawless OS=Euperipatoides kanangrensis OX=488523 GN=clawless PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.782e-40
Identity = 96/152 (63.16%), Postives = 115/152 (75.66%), Query Frame = 2
Query:  263 LSTIFPPSLPRHWIEILR---QDRYP--RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQS---NNPSFNYTSSTLSAISNLQPWA 694
            L T FP      W+E  R   +DR    RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQAA+R++++L  E N+S   +  S    +++L A+ NLQPWA
Sbjct:   93 LQTSFP------WMEATRRLVKDRLTATRRIGHPYQNRTPPKRKKPRTSFSRMQICELEKRFHRQKYLASAERASLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQAANRFMMSLHAEANKSIYDSRDSICLNNASLHALQNLQPWA 238          
BLAST of tlx vs. Ensembl Cavefish
Match: ENSAMXT00000055288.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000111.1:341656:348959:-1 gene:ENSAMXG00000038858.1 transcript:ENSAMXT00000055288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 1.582e-41
Identity = 90/127 (70.87%), Postives = 103/127 (81.10%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQ---SNNPSFN---YTSSTLSAISNLQPWA 694
            RRVGHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R LL LQ ++ Q   S + S +     +S+L A+ NLQPWA
Sbjct:  129 RRVGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRMLLQLQADVLQRSISESVSVDPMCVNNSSLYALQNLQPWA 255          
BLAST of tlx vs. Ensembl Cavefish
Match: tlx2 (T cell leukemia homeobox 2 [Source:NCBI gene;Acc:103046147])

HSP 1 Score: 143.665 bits (361), Expect = 9.165e-41
Identity = 90/140 (64.29%), Postives = 107/140 (76.43%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPWAIPQLISEMSSETS 733
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R +L LQ E     ++Q   P      +S+L A+ NLQPWA    ++ ++S  S
Sbjct:  166 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMLQLQQEAFQKTLSQPLQPDPLCLHNSSLYALQNLQPWAEDNKVTSVTSVAS 305          
BLAST of tlx vs. Ensembl Cavefish
Match: tlx3b (T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-021021-1])

HSP 1 Score: 142.51 bits (358), Expect = 1.043e-40
Identity = 89/138 (64.49%), Postives = 107/138 (77.54%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSN-------NPSFNYTSSTLSAISNLQPWAIPQLISEMSS 724
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ ASR +L LQ++  Q +       +P   + SS L A+ NLQPWA  +  +++ +
Sbjct:  143 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDALQKSLSDSVPADPLCIHNSS-LFALQNLQPWACGEEGTKLGA 279          
BLAST of tlx vs. Ensembl Cavefish
Match: tlx1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:103034137])

HSP 1 Score: 141.354 bits (355), Expect = 4.715e-40
Identity = 91/138 (65.94%), Postives = 106/138 (76.81%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPWAI-PQLISEMSS 724
            RR+GHPYQNRTPPK+KKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R L+ LQ E     +NQ  +P      +S+L A+ NLQPW   P  I+ +SS
Sbjct:  160 RRIGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLLMQLQQEAFQKTLNQPVSPDPICLHNSSLFALHNLQPWTENPSKINSVSS 297          
BLAST of tlx vs. Ensembl Cavefish
Match: HMX2 (H6 family homeobox 2 [Source:HGNC Symbol;Acc:HGNC:5018])

HSP 1 Score: 75.8702 bits (185), Expect = 1.841e-16
Identity = 34/56 (60.71%), Postives = 43/56 (76.79%), Query Frame = 2
Query:  374 RKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            RKK RT F+R Q+ +LE  FH ++YL+SSER  LA  L +T++QVKTWFQNRR KW
Sbjct:   55 RKKTRTVFSRTQVFQLETAFHTKRYLSSSERAGLASSLHLTETQVKTWFQNRRNKW 110          
BLAST of tlx vs. Ensembl Sea Lamprey
Match: tlx1 (T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-021021-2])

HSP 1 Score: 127.872 bits (320), Expect = 1.085e-35
Identity = 63/84 (75.00%), Postives = 68/84 (80.95%), Query Frame = 2
Query:  299 WIEILR---QDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            W+E  R   +DR    VGHPYQNRTPPKRKKPRTSF R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKW
Sbjct:  204 WMESSRRFAKDRL--TVGHPYQNRTPPKRKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKW 285          
BLAST of tlx vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 72.4034 bits (176), Expect = 1.715e-16
Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K +K RT+F+  Q+ +LER F RQKYL+  +R +LA  L ++D+QVKTW+QNRRTKW
Sbjct:    4 KPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKW 60          
BLAST of tlx vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 73.1738 bits (178), Expect = 1.775e-16
Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K +K RT+F+  Q+ +LER F RQKYL+  +R +LA  L ++D+QVKTW+QNRRTKW
Sbjct:    4 KPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKW 60          
BLAST of tlx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 8.362e-16
Identity = 31/57 (54.39%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K ++PRT+F+ QQ++ELER F RQ+YL+  +R  +A  L +T++QVK WFQNRR KW
Sbjct:    2 KCRRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKW 58          
BLAST of tlx vs. Ensembl Sea Lamprey
Match: hhex (pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-1 gene:ENSPMAG00000009445.1 transcript:ENSPMAT00000010429.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hhex)

HSP 1 Score: 73.559 bits (179), Expect = 9.857e-16
Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 2
Query:  347 PYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            P+  R   KRK  +  F+ +Q +ELER+F RQKYL+  ER  LAK L +++ QVKTWFQNRR KW
Sbjct:  134 PFLPRPAHKRKGGQVRFSSEQTVELERKFERQKYLSPGERKGLAKLLQLSERQVKTWFQNRRAKW 198          
BLAST of tlx vs. Ensembl Nematostella
Match: EDO34127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ94])

HSP 1 Score: 77.7962 bits (190), Expect = 8.491e-19
Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 2
Query:  374 RKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTK 538
            +KKPRT+F   QI ELE+RF  QKYL S ER +LA  L +TD+QVKTWFQNRR K
Sbjct:    1 KKKPRTAFTESQISELEKRFQSQKYLGSKERSELAGTLGLTDTQVKTWFQNRRMK 55          
BLAST of tlx vs. Ensembl Nematostella
Match: ANTH.HBXC.NV (NK-like 20; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q0N4G2])

HSP 1 Score: 73.1738 bits (178), Expect = 3.930e-17
Identity = 32/56 (57.14%), Postives = 45/56 (80.36%), Query Frame = 2
Query:  374 RKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            +KK RT+F  +QI ELE++F  +KYL ++ER D+A  L++T++QVK WFQNRRTKW
Sbjct:    1 KKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKIWFQNRRTKW 56          
BLAST of tlx vs. Ensembl Nematostella
Match: NK-3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7L1])

HSP 1 Score: 77.7962 bits (190), Expect = 4.889e-17
Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 2
Query:  353 QNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTK 538
            Q ++ P+RK+ R +F+ QQ+ ELERRF  QKYL+  ER DLA  L +T++QVK WFQNRR K
Sbjct:  123 QQKSKPRRKRSRAAFSHQQVFELERRFSHQKYLSGPERADLAAALKLTETQVKIWFQNRRYK 184          
BLAST of tlx vs. Ensembl Nematostella
Match: EDO32495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX2])

HSP 1 Score: 68.9366 bits (167), Expect = 1.334e-15
Identity = 30/56 (53.57%), Postives = 42/56 (75.00%), Query Frame = 2
Query:  374 RKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            +K+PRT+F  +QI +LE  F + KYL+ S R +LA  L +T++Q+K WFQNRRTKW
Sbjct:    1 KKRPRTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKIWFQNRRTKW 56          
BLAST of tlx vs. Ensembl Nematostella
Match: EDO48767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI78])

HSP 1 Score: 68.5514 bits (166), Expect = 2.643e-15
Identity = 31/57 (54.39%), Postives = 42/57 (73.68%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++KK RT F+R Q+ +LE  F  ++YL+SSER  LA  L +T++QVK WFQNRR KW
Sbjct:    1 RKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKIWFQNRRNKW 57          
BLAST of tlx vs. Ensembl Medaka
Match: tlx1 (T cell leukemia homeobox 1 [Source:NCBI gene;Acc:101163994])

HSP 1 Score: 142.895 bits (359), Expect = 1.252e-40
Identity = 89/126 (70.63%), Postives = 100/126 (79.37%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNE-----INQSNNPS-FNYTSSTLSAISNLQPW 691
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R L+ LQ E     INQ   P      +S+L A+ NLQPW
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILMQLQQEAFQKTINQPVTPDPLCLQNSSLFALQNLQPW 277          
BLAST of tlx vs. Ensembl Medaka
Match: ENSORLT00000004940.2 (T cell leukemia homeobox 3 [Source:NCBI gene;Acc:101161249])

HSP 1 Score: 141.354 bits (355), Expect = 3.923e-40
Identity = 88/128 (68.75%), Postives = 100/128 (78.12%), Query Frame = 2
Query:  332 RRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQS-------NNPSFNYTSSTLSAISNLQPWA 694
            RR+GHPYQNRTPPKRKKPRTSF+R QI ELE+RFHRQKYLAS+ER  LAK L MTD+QVKTWFQNRRTKWRRQT+EEREAERQ A+R +L LQ    Q        ++P   + SS L A+ NLQPWA
Sbjct:  152 RRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLILQLQQSALQKSLSESAVSDPLCAHNSS-LYALQNLQPWA 278          
BLAST of tlx vs. Ensembl Medaka
Match: barhl2 (BarH like homeobox 2 [Source:NCBI gene;Acc:101174414])

HSP 1 Score: 76.6406 bits (187), Expect = 1.001e-15
Identity = 34/57 (59.65%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K +K RT+F   Q+ +LER F RQKYL+  +R DLA  L++TD+QVKTW+QNRRTKW
Sbjct:  205 KPRKARTAFTDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKW 261          
BLAST of tlx vs. Ensembl Medaka
Match: ENSORLT00000038356.1 (barH-like 1 homeobox protein [Source:NCBI gene;Acc:100049373])

HSP 1 Score: 75.485 bits (184), Expect = 2.361e-15
Identity = 33/57 (57.89%), Postives = 44/57 (77.19%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            K +K RT+F   Q+ +LER F RQKYL+  +R +LA  L++TD+QVKTW+QNRRTKW
Sbjct:  172 KPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKW 228          
BLAST of tlx vs. Ensembl Medaka
Match: nkx6.1 (NK6 homeobox 1 [Source:NCBI gene;Acc:101156548])

HSP 1 Score: 73.9442 bits (180), Expect = 5.212e-15
Identity = 35/57 (61.40%), Postives = 40/57 (70.18%), Query Frame = 2
Query:  371 KRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            KRK  R +F+ QQI  LE+ F + KYLA  ER  LA  L MT+SQVK WFQNRRTKW
Sbjct:  163 KRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKW 219          
BLAST of tlx vs. Planmine SMEST
Match: SMESG000017206.1 (SMESG000017206.1)

HSP 1 Score: 344.739 bits (883), Expect = 3.929e-121
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 2
Query:  143 MSASFSIDGILSTXXXXXXXXXXXXXXXXXXXXXXXLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPGGHIDDSHSEK 772
            MSASFSIDGILSTKKELSESIITSKSEESTKTHSNSLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWRRQTSEEREAERQAASRYLLTLQNEINQSNNPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPGGHIDDSHSEK
Sbjct:    1 MSASFSIDGILSTKKELSESIITSKSEESTKTHSNSLKHLLSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWRRQTSEEREAERQAASRYLLTLQNEINQSNNPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPGGHIDDSHSEK 210          
BLAST of tlx vs. Planmine SMEST
Match: SMESG000021901.1 (SMESG000021901.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.261e-16
Identity = 35/62 (56.45%), Postives = 49/62 (79.03%), Query Frame = 2
Query:  356 NRTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            N    K+KK RT+F+ +QI ELE++F  +KYL+S+ER +LA  L++T++QVK WFQNRRTKW
Sbjct:  141 NSKQDKKKKSRTTFSGRQICELEKQFELKKYLSSAERAELASSLNVTETQVKIWFQNRRTKW 202          
BLAST of tlx vs. Planmine SMEST
Match: SMESG000030375.1 (SMESG000030375.1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.284e-15
Identity = 41/96 (42.71%), Postives = 60/96 (62.50%), Query Frame = 2
Query:  263 LSTIFPPSLPRHWIEILRQDRYPRRVGHPYQNRTPPKRKKPR---TSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            L+ + P + P   ++++R   +   +G   Q+    K KKPR   T+F   Q+ ELER F RQKYL+  +R +LA  L ++D+QVKTW+QNRRTKW
Sbjct:   98 LNHVDPVNSPEKEMKMVRLKYF---LGSDSQSHDRSKSKKPRKARTAFTDLQLNELERNFDRQKYLSVQDRMELANRLRLSDTQVKTWYQNRRTKW 190          
BLAST of tlx vs. Planmine SMEST
Match: SMESG000022963.1 (SMESG000022963.1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.264e-14
Identity = 43/103 (41.75%), Postives = 70/103 (67.96%), Query Frame = 2
Query:  377 KKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWXXXXXXXXXXXXXXXXXYLLTLQNEINQSNNPSF-NYTSSTLSAISNL 682
            +K RT+F  +Q+ ELE+ F + KYL+  +R +LA  L++TD+QVKTW+QNRRTKW+RQTS   +   + ++  +  L+  I+  NN  F N+ S+  +++SN+
Sbjct:   67 RKARTAFTEKQLCELEKSFDKHKYLSVQDRLELANYLELTDTQVKTWYQNRRTKWKRQTSTGVDLLTEGSN--VTDLRRSIHYPNNSKFWNWVSNNSASLSNI 167          
BLAST of tlx vs. Planmine SMEST
Match: SMESG000074896.1 (SMESG000074896.1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.208e-14
Identity = 32/61 (52.46%), Postives = 45/61 (73.77%), Query Frame = 2
Query:  359 RTPPKRKKPRTSFNRQQIMELERRFHRQKYLASSERCDLAKDLDMTDSQVKTWFQNRRTKW 541
            ++  K +K RT+F   Q+ ELE+ F +QKYL+  +R +LA  L +TD+QVKTW+QNRRTKW
Sbjct:   84 QSGKKPRKARTAFTDHQLNELEKNFEQQKYLSVQDRMELAAKLRLTDTQVKTWYQNRRTKW 144          
The following BLAST results are available for this feature:
BLAST of tlx vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLX35.835e-4069.84T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc... [more]
TLX26.124e-3961.43T cell leukemia homeobox 2 [Source:HGNC Symbol;Acc... [more]
TLX16.325e-3864.75T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc... [more]
TLX11.736e-3474.07T cell leukemia homeobox 1 [Source:HGNC Symbol;Acc... [more]
BARHL21.755e-1559.38BarH like homeobox 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of tlx vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-97.076e-1956.92Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Pr... [more]
cog-14.008e-1654.39COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
ceh-301.648e-1550.72Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
ceh-301.648e-1550.72Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
cog-11.897e-1554.39COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
back to top
BLAST of tlx vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C154.697e-3965.12gene:FBgn0004863 transcript:FBtr0084111[more]
B-H11.698e-1557.89gene:FBgn0011758 transcript:FBtr0074430[more]
NK7.11.215e-1457.89gene:FBgn0024321 transcript:FBtr0306742[more]
NK7.11.215e-1457.89gene:FBgn0024321 transcript:FBtr0347151[more]
NK7.11.215e-1457.89gene:FBgn0024321 transcript:FBtr0082942[more]
back to top
BLAST of tlx vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01067175.15.217e-4168.75T-cell leukemia homeobox protein 3-like [Source:NC... [more]
tlx21.644e-4063.57T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tlx3b3.646e-4063.45T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-G... [more]
tlx3b3.646e-4063.45T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-G... [more]
tlx21.024e-3968.50T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of tlx vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soga12.141e-4168.75suppressor of glucose, autophagy associated 1 [Sou... [more]
ENSXETT00000011915.12.616e-4066.43T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
jup3.302e-3968.25junction plakoglobin [Source:Xenbase;Acc:XB-GENE-4... [more]
BARHL21.089e-1559.38BarH like homeobox 2 [Source:NCBI gene;Acc:1004938... [more]
BARHL21.149e-1559.38BarH like homeobox 2 [Source:NCBI gene;Acc:1004938... [more]
back to top
BLAST of tlx vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tlx33.526e-4069.84T cell leukemia, homeobox 3 [Source:MGI Symbol;Acc... [more]
Tlx22.293e-3961.43T cell leukemia, homeobox 2 [Source:MGI Symbol;Acc... [more]
Tlx15.779e-3864.75T cell leukemia, homeobox 1 [Source:MGI Symbol;Acc... [more]
Tlx23.566e-3682.86T cell leukemia, homeobox 2 [Source:MGI Symbol;Acc... [more]
Barhl29.001e-1659.65BarH like homeobox 2 [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of tlx vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93367|TLX3_CHICK7.955e-4069.84T-cell leukemia homeobox protein 3 OS=Gallus gallu... [more]
sp|O55144|TLX3_MOUSE2.466e-3969.84T-cell leukemia homeobox protein 3 OS=Mus musculus... [more]
sp|O43711|TLX3_HUMAN2.802e-3969.84T-cell leukemia homeobox protein 3 OS=Homo sapiens... [more]
sp|Q61663|TLX2_MOUSE1.604e-3861.43T-cell leukemia homeobox protein 2 OS=Mus musculus... [more]
sp|O43763|TLX2_HUMAN2.941e-3861.43T-cell leukemia homeobox protein 2 OS=Homo sapiens... [more]
back to top
BLAST of tlx vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A1CQY52.077e-71100.00Tlx (Fragment) OS=Schmidtea mediterranea OX=79327 ... [more]
K1RAP61.668e-4168.61T-cell leukemia homeobox protein 3 OS=Crassostrea ... [more]
A0A1S3GYP07.828e-4164.83T-cell leukemia homeobox protein 3 isoform X1 OS=L... [more]
A0A345F2S41.349e-4063.16Tlx homeodomain protein (Fragment) OS=Euperipatoid... [more]
X5JAI51.782e-4063.16Clawless OS=Euperipatoides kanangrensis OX=488523 ... [more]
back to top
BLAST of tlx vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055288.11.582e-4170.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tlx29.165e-4164.29T cell leukemia homeobox 2 [Source:NCBI gene;Acc:1... [more]
tlx3b1.043e-4064.49T cell leukemia homeobox 3b [Source:ZFIN;Acc:ZDB-G... [more]
tlx14.715e-4065.94T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
HMX21.841e-1660.71H6 family homeobox 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of tlx vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlx11.085e-3575.00T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GE... [more]
barhl21.715e-1656.14BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl21.775e-1656.14BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
ENSPMAT00000001141.18.362e-1654.39pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
hhex9.857e-1653.85pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-... [more]
back to top
BLAST of tlx vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tlx vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO341278.491e-1965.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTH.HBXC.NV3.930e-1757.14NK-like 20; Predicted protein [Source:UniProtKB/T... [more]
NK-34.889e-1756.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324951.334e-1553.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487672.643e-1554.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tlx vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlx11.252e-4070.63T cell leukemia homeobox 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000004940.23.923e-4068.75T cell leukemia homeobox 3 [Source:NCBI gene;Acc:1... [more]
barhl21.001e-1559.65BarH like homeobox 2 [Source:NCBI gene;Acc:1011744... [more]
ENSORLT00000038356.12.361e-1557.89barH-like 1 homeobox protein [Source:NCBI gene;Acc... [more]
nkx6.15.212e-1561.40NK6 homeobox 1 [Source:NCBI gene;Acc:101156548][more]
back to top
BLAST of tlx vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017206.13.929e-121100.00SMESG000017206.1[more]
SMESG000021901.11.261e-1656.45SMESG000021901.1[more]
SMESG000030375.17.284e-1542.71SMESG000030375.1[more]
SMESG000022963.11.264e-1441.75SMESG000022963.1[more]
SMESG000074896.12.208e-1452.46SMESG000074896.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034115
GenBankAIX99548.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034115 ID=SMED30034115|Name=tlx|organism=Schmidtea mediterranea sexual|type=transcript|length=816bp
CCCGGGATGAAAATTATCAGCAATTATTGGCCAATCGAAACCGTTTCAAT
GTGCTTGTTCTTGATCCTGTCATTTGATTTGATCGCTTCTCTCGATTTAT
TATGAATTCCTTTTCTGGAATTCTTACACAATCCCAGCAAATATGTCAGC
ATCGTTTTCCATTGATGGAATATTGTCGACGAAAAAAGAGCTTTCCGAAT
CCATTATTACCTCGAAATCAGAAGAATCAACGAAGACTCATTCGAATTCT
TTGAAACATTTATTATCCACAATTTTCCCTCCTTCTCTTCCAAGGCATTG
GATAGAAATATTGCGACAGGATCGTTATCCCCGACGAGTTGGTCATCCAT
ATCAGAATAGAACCCCTCCAAAAAGAAAAAAGCCTCGAACATCCTTTAAT
CGGCAACAGATCATGGAACTTGAGAGACGGTTTCATCGTCAGAAGTATCT
CGCATCATCAGAACGATGCGATCTAGCGAAAGATCTCGATATGACAGACT
CTCAAGTGAAGACTTGGTTTCAAAACCGGAGAACAAAATGGAGGCGACAA
ACCAGCGAAGAAAGAGAAGCAGAAAGACAAGCAGCCAGTCGGTATTTATT
GACACTTCAAAACGAAATCAACCAATCTAACAATCCTTCTTTTAATTATA
CCAGCTCTACTCTTTCCGCCATATCCAACCTCCAACCTTGGGCAATACCA
CAACTCATATCCGAAATGTCTTCTGAAACGTCTTCTCCAGGGGGTCATAT
TGACGATTCTCATTCGGAGAAATGATAATAAATGATTTATTAACACAAAT
TGTCAATAATAAATGA
back to top

protein sequence of SMED30034115-orf-1

>SMED30034115-orf-1 ID=SMED30034115-orf-1|Name=SMED30034115-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MSASFSIDGILSTKKELSESIITSKSEESTKTHSNSLKHLLSTIFPPSLP
RHWIEILRQDRYPRRVGHPYQNRTPPKRKKPRTSFNRQQIMELERRFHRQ
KYLASSERCDLAKDLDMTDSQVKTWFQNRRTKWRRQTSEEREAERQAASR
YLLTLQNEINQSNNPSFNYTSSTLSAISNLQPWAIPQLISEMSSETSSPG
GHIDDSHSEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000030midline
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042247TLX1/2/3
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 115..125
score: 46.74
coord: 125..134
score: 73.73
coord: 100..111
score: 34.88
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 78..140
e-value: 3.8E-24
score: 96.2
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 79..135
e-value: 9.4E-21
score: 73.4
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 76..136
score: 20.714
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 79..136
e-value: 5.12268E-19
score: 75.3576
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 62..154
e-value: 1.1E-29
score: 103.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 191..210
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..85
NoneNo IPR availablePANTHERPTHR45921:SF6C15coord: 53..186
IPR042247T-cell leukemia homeobox protein 1/2/3PANTHERPTHR45921FAMILY NOT NAMEDcoord: 53..186
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 111..134
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 67..136