Dynein intermediate chain 3, ciliary

Overview
NameDynein intermediate chain 3, ciliary
Smed IDSMED30034110
Uniprot Best hitDynein intermediate chain 3, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1 (E=0)
Length (bp)2074
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein intermediate chain 3, ciliary (SMED30034110) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein intermediate chain 3, ciliary (SMED30034110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein intermediate chain 3, ciliary (SMED30034110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein intermediate chain 3, ciliary (SMED30034110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034110SMESG000075110.1 SmedASXL_009202SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034110SMESG000075110.1 dd_Smed_v6_2644_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30034110SMESG000075110.1 dd_Smed_v4_2644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 380/572 (66.43%), Postives = 452/572 (79.02%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L  +MEHCIKQNNA+DIY+ YF   + +E  EE PSAKTINVFRD  E+KR ATH+SW PDG  KLAVAY   +FQ +P   S+DSYIWD+ NPNKP+L LKP SPLV +E+NPKDSH L+GGCYNGQ+A WD RKGS   E+S +E+SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RKM+EPTE++ILD TKK+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   +PGH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ LTD  WSPVRP VFFTT+MDGTLD+WD +F+Q +PTL ++VCDE+L CLRVQ+ G LIACGS  GTTT+LE+S G  ++ +NEKN+ S++FERETRREKILEARHRE++LK K    G+  G      +E  A   E LV KAEE+FF  I  E K +E   I
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREKILEARHREMRLKEK----GKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAELKKKEADAI 568          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 380/572 (66.43%), Postives = 452/572 (79.02%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L  +MEHCIKQNNA+DIY+ YF   + +E  EE PSAKTINVFRD  E+KR ATH+SW PDG  KLAVAY   +FQ +P   S+DSYIWD+ NPNKP+L LKP SPLV +E+NPKDSH L+GGCYNGQ+A WD RKGS   E+S +E+SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RKM+EPTE++ILD TKK+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   +PGH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ LTD  WSPVRP VFFTT+MDGTLD+WD +F+Q +PTL ++VCDE+L CLRVQ+ G LIACGS  GTTT+LE+S G  ++ +NEKN+ S++FERETRREKILEARHRE++LK K    G+  G      +E  A   E LV KAEE+FF  I  E K +E   I
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREKILEARHREMRLKEK----GKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAELKKKEADAI 568          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 380/572 (66.43%), Postives = 452/572 (79.02%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L  +MEHCIKQNNA+DIY+ YF   + +E  EE PSAKTINVFRD  E+KR ATH+SW PDG  KLAVAY   +FQ +P   S+DSYIWD+ NPNKP+L LKP SPLV +E+NPKDSH L+GGCYNGQ+A WD RKGS   E+S +E+SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RKM+EPTE++ILD TKK+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   +PGH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ LTD  WSPVRP VFFTT+MDGTLD+WD +F+Q +PTL ++VCDE+L CLRVQ+ G LIACGS  GTTT+LE+S G  ++ +NEKN+ S++FERETRREKILEARHRE++LK K    G+  G      +E  A   E LV KAEE+FF  I  E K +E   I
Sbjct:   58 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREKILEARHREMRLKEK----GKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAELKKKEADAI 625          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 370/572 (64.69%), Postives = 441/572 (77.10%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L  +MEHCIKQNNA+DIY+ YF   + +E  EE PSAKTINVFRD  E+KR ATH+SW PDG  KLAVAY   +FQ +P   S+DSYIWD+ NPNKP+L LKP SPLV +E+NPKDSH L+GGCYNGQ+A WD RKGS   E+S +E+SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RKM+EPTE++ILD TKK+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   +PGH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ LTD  WSPVRP VFFTT+MDGTLD+WD +F+Q +PTL +            ++ G LIACGS  GTTT+LE+S G  ++ +NEKN+ S++FERETRREKILEARHRE++LK K    G+  G      +E  A   E LV KAEE+FF  I  E K +E   I
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSL------------KDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREKILEARHREMRLKEK----GKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAELKKKEADAI 556          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 176.792 bits (447), Expect = 3.355e-51
Identity = 80/114 (70.18%), Postives = 91/114 (79.82%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLS 442
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L 
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLG 114          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Celegans
Match: dyci-1 (DYnein Chain, light Intermediate [Source:UniProtKB/TrEMBL;Acc:O45087])

HSP 1 Score: 107.457 bits (267), Expect = 5.566e-24
Identity = 88/359 (24.51%), Postives = 161/359 (44.85%), Query Frame = 2
Query:  578 VKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPN-KPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ--PTEVSPVEN-SHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPT---EIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPA-DKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSSIMWT-KYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDES----LNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIF 1597
             KR  T +++    P  LAV+Y   +  + PP       +W+  +     + ++   S +  + +    +H L+ GC +GQ+ +WD R  S+  P   SP+   +H      +  + +K      S S DG++  W+V  + +P    E+M    TK+    KA  A  + +       F+ GT+ G I++ +R G  PA  K    Y GH G +  ++ +       F   F++   DWT ++WS   +D+++ ++ + H   + D  WSPV PAVF +   DG + VW++    + P  R++   E     +N L     G+ +  G   G   + ++ E  + +   E N  + + 
Sbjct:  282 AKRLVTGMAFSEHYPDLLAVSYGPCDIPNEPPGVIV---VWNTKSKRMTAEFIVYCQSEIQSVAFARFHAHLLLAGCESGQICVWDNRLTSRKLPINRSPLTTQAHTYTVSCLAVVGTKNAHNFVSLSRDGRICSWNVDNLTQPVDGKELM----TKEG---KAASATRMSFPIGEMQTFVVGTDTGEILAASRNGADPAVIKTDVCYKGHSGTLTGIEFHRASGVVDFSHLFISSSHDWTVKLWS--TKDANLKFSFESHPDLVLDVAWSPVHPAVFASIDADGNIFVWNLNEDVEGPVARLRAGAEGESVYMNRLIWSPDGKHVFVGDDEGRVHMYDVRESLYVLKSEEWNRFARVL 628          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0332765)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 276/564 (48.94%), Postives = 373/564 (66.13%), Query Frame = 2
Query:  113 YVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKK--QDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMR 1798
            Y++ K+R  FG + +F+D+   +  + + +P L +++I KNPVDR  Q   + S    NTER   ++ GI H EGGWPKD+N  + +Q +RY++K+EKDE Y   + NL+  MEH I QNNA++IY+NYFE +D     EP  ++T+NV+RD N +K    H+SW PDG  K+AV++C+  FQ    N   +SYIW+V NPN+P L L+P  P VC+EYN KD  +L+ G YNGQ+A WD R G  P  +S  E  HRDP   V+W  SK+GTE FS  +DGQV WWD RK+ EP + +++DP K   QDL ++ G   LEYE+TIPT+FMAGTE G + SCNRKGKTP +KI      HLGPVYA+ RNP F KNFLTVGDW ARIWSED R+SSI+WTK   S LTDG WS  + + FF T+MDG LD WD++ +Q EP L ++VCDE L C+R  E G+ ++CGS  G T ++E+S+     +KN+K L++ +FERE RREKILEA+ RE KLK+K    G+  G +     +      E    +A  ++F A+EQER+ R
Sbjct:    3 YIFKKERRSFGARVHFEDKDEVVFTENS-NPELVKSYILKNPVDRVTQYAGQTSLSVANTERATYKSTGITHNEGGWPKDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFERENRREKILEAKSRESKLKVKA-NHGQDQGDTMMVNGKINMAPFEAACEQAASEYFAAVEQERQRR 564          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0301326)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 276/564 (48.94%), Postives = 373/564 (66.13%), Query Frame = 2
Query:  113 YVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKK--QDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMR 1798
            Y++ K+R  FG + +F+D+   +  + + +P L +++I KNPVDR  Q   + S    NTER   ++ GI H EGGWPKD+N  + +Q +RY++K+EKDE Y   + NL+  MEH I QNNA++IY+NYFE +D     EP  ++T+NV+RD N +K    H+SW PDG  K+AV++C+  FQ    N   +SYIW+V NPN+P L L+P  P VC+EYN KD  +L+ G YNGQ+A WD R G  P  +S  E  HRDP   V+W  SK+GTE FS  +DGQV WWD RK+ EP + +++DP K   QDL ++ G   LEYE+TIPT+FMAGTE G + SCNRKGKTP +KI      HLGPVYA+ RNP F KNFLTVGDW ARIWSED R+SSI+WTK   S LTDG WS  + + FF T+MDG LD WD++ +Q EP L ++VCDE L C+R  E G+ ++CGS  G T ++E+S+     +KN+K L++ +FERE RREKILEA+ RE KLK+K    G+  G +     +      E    +A  ++F A+EQER+ R
Sbjct:    3 YIFKKERRSFGARVHFEDKDEVVFTENS-NPELVKSYILKNPVDRVTQYAGQTSLSVANTERATYKSTGITHNEGGWPKDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPLPEPCKSRTVNVYRDPNPIKVPVKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMISEREVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHLGPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMDGVLDTWDLLQQQNEPVLTVKVCDEPLYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKNDKPLLTAMFERENRREKILEAKSRESKLKVKA-NHGQDQGDTMMVNGKINMAPFEAACEQAASEYFAAVEQERQRR 564          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Match: CG1571 (gene:FBgn0029993 transcript:FBtr0071106)

HSP 1 Score: 342.428 bits (877), Expect = 4.944e-108
Identity = 185/535 (34.58%), Postives = 288/535 (53.83%), Query Frame = 2
Query:  113 YVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPP---SAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDS--------YIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDP--TKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDS-SIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPT----LRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMK 1663
            ++Y+++R  FGRQC FQDR  EL V + P       +I  NP ++  Q  ++M+   + TE    +  G+ H EGGWPK+VN  + +Q  R+RKKVE+++++   + ++        +QNN L+IY N+F  +  E   +      A+  NVF D+    R    I W P+   +    Y N   +       TD         Y+WDV NP KP +       +   +  PKD + ++GG   GQ+ LW   KG  P    P+E SHR+    + W+ SK+ TE +S S DG + +WD R +  P + ++L+P   ++Q    + G   LE+E TIP +F+ G++ G +   NRKG TP + + A Y   +GPV ++ RNPFF KNFL  GDW ARIWSE+++DS S M+ + +   L  G WS  R ++F T  ++G +D WD++   ++P      ++ + D     L  + +G L+A G  +G T I+ L E     +  EK L++ +FERE  R K+LEAR+ E++LK K
Sbjct:    6 FIYSRERRRFGRQCRFQDR-NELMVSVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPELGHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPIRNCPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVTGDWRARIWSEEVKDSPSTMYFRKNAQILC-GAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRSVDFKVAIAD-----LVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLEARYDEVRLKRK 533          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Match: CG10859 (gene:FBgn0032520 transcript:FBtr0080522)

HSP 1 Score: 296.204 bits (757), Expect = 7.649e-91
Identity = 168/540 (31.11%), Postives = 272/540 (50.37%), Query Frame = 2
Query:  113 YVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGW-PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF--------EGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCN--------TEFQSSPPNTSTDS----YIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMIL--DPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMK 1663
            ++ +++R  FGRQC F DR  E+ + + P   L   +I +NP++   Q  ++ +   V T     ++ G+NH EGGW  K+VN  + +  +RYRKKVE+D+++   +  L          NNA++IY+++F         GI ++ +     A+  +VF D+    R      W  + P +  + Y N        T+  ++ P+   D+    YIW++ +  +P         +   +   +D   ++GG   GQ+  W       P  + P+E  HR+    + W+ SK  TE +S S DG + +WD R +  P   ++   DP   Q+ + A G   LE+E TIP +F+  T+ G +   NRKG TP D I A Y    GP+  + RNPFF KNFL VGDW  RIWSE++++    +     + L  G WS  R ++F      G L+ WD++   K P L I+    ++  L  +  G ++     +G   +L L EG  S +  EK+L+ ++FERE +R K+LEAR  E+KLK +
Sbjct:    8 FILSRERRRFGRQCLFTDR-NEMILSVQPSGRLRLKYILRNPINERTQLSEQYAASSVLTHNVTLDSHGLNHYEGGWNVKEVNIMDEESTMRYRKKVERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGRGISMKIA-----ARGTHVFHDLWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNTLPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEPDPQTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILTIKY-KYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQRCKLLEAREEEIKLKKR 540          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Match: CG10859 (gene:FBgn0032520 transcript:FBtr0342635)

HSP 1 Score: 296.204 bits (757), Expect = 7.649e-91
Identity = 168/540 (31.11%), Postives = 272/540 (50.37%), Query Frame = 2
Query:  113 YVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGW-PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF--------EGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCN--------TEFQSSPPNTSTDS----YIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMIL--DPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMK 1663
            ++ +++R  FGRQC F DR  E+ + + P   L   +I +NP++   Q  ++ +   V T     ++ G+NH EGGW  K+VN  + +  +RYRKKVE+D+++   +  L          NNA++IY+++F         GI ++ +     A+  +VF D+    R      W  + P +  + Y N        T+  ++ P+   D+    YIW++ +  +P         +   +   +D   ++GG   GQ+  W       P  + P+E  HR+    + W+ SK  TE +S S DG + +WD R +  P   ++   DP   Q+ + A G   LE+E TIP +F+  T+ G +   NRKG TP D I A Y    GP+  + RNPFF KNFL VGDW  RIWSE++++    +     + L  G WS  R ++F      G L+ WD++   K P L I+    ++  L  +  G ++     +G   +L L EG  S +  EK+L+ ++FERE +R K+LEAR  E+KLK +
Sbjct:    8 FILSRERRRFGRQCLFTDR-NEMILSVQPSGRLRLKYILRNPINERTQLSEQYAASSVLTHNVTLDSHGLNHYEGGWNVKEVNIMDEESTMRYRKKVERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGRGISMKIA-----ARGTHVFHDLWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNTLPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEPDPQTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILTIKY-KYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQRCKLLEAREEEIKLKKR 540          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 386/584 (66.10%), Postives = 461/584 (78.94%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP---PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMK-----------KEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEIVYVYTKKRSEFGRQCNF DRPAELHVDI PD SLA NF  ++P +  IQC  EMSEHEVNTER+E+E+RGINH EGGWPKD+N  + +  IRYRKKVEKDE Y NTI  ++ +MEHCI+QNNA DIY+++ E  D E  EE    PSAKTINVFRD NEVKRTAT +SW PDG  KLAVAY + EFQ +P + + DSYIWD+ NPNKP++ LKPV PLVC+EYNPKDSH LIGG YNGQ+A WD RKGSQP E+SP+E SHRDP +K IW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE +++DPTKK +++ + GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GPVYALQRNPFFPKNFLTVGDWTARIWSEDI++SSIMWTKYH++ L DG WSPVRP+VFFT KMDGTLDVWDI+FKQ +PTL ++VCDE+L  ++VQ+ GR +ACGS  GTTT+LE+S G  S+ KNEK LVS +FERET+REKILEARHRE++LK +           KE DGE+                E LV +AE++FFH IE ER M+E+ E
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFSDRPAELHVDILPDSSLAANFTVRDPCNVTIQCADEMSEHEVNTERFESESRGINHVEGGWPKDLNPDDMEATIRYRKKVEKDEHYQNTIMQIAGLMEHCIRQNNATDIYEDFLEDEDEEDVEESEEQPSAKTINVFRDPNEVKRTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFSHRDPVYKAIWLQSKTGTDIFSASTDGQVLWWDIRKMSEPTERLVMDPTKKGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLCLKVCDEALYSIKVQDNGRFLACGSQLGTTTLLEISSGLCSLQKNEKALVSEMFERETKREKILEARHREMRLKERSRSEQSREDEMKETDGEE--------------SVEELVARAEKEFFHIIENER-MKERNE 569          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 386/584 (66.10%), Postives = 461/584 (78.94%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP---PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMK-----------KEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEIVYVYTKKRSEFGRQCNF DRPAELHVDI PD SLA NF  ++P +  IQC  EMSEHEVNTER+E+E+RGINH EGGWPKD+N  + +  IRYRKKVEKDE Y NTI  ++ +MEHCI+QNNA DIY+++ E  D E  EE    PSAKTINVFRD NEVKRTAT +SW PDG  KLAVAY + EFQ +P + + DSYIWD+ NPNKP++ LKPV PLVC+EYNPKDSH LIGG YNGQ+A WD RKGSQP E+SP+E SHRDP +K IW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE +++DPTKK +++ + GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GPVYALQRNPFFPKNFLTVGDWTARIWSEDI++SSIMWTKYH++ L DG WSPVRP+VFFT KMDGTLDVWDI+FKQ +PTL ++VCDE+L  ++VQ+ GR +ACGS  GTTT+LE+S G  S+ KNEK LVS +FERET+REKILEARHRE++LK +           KE DGE+                E LV +AE++FFH IE ER M+E+ E
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFSDRPAELHVDILPDSSLAANFTVRDPCNVTIQCADEMSEHEVNTERFESESRGINHVEGGWPKDLNPDDMEATIRYRKKVEKDEHYQNTIMQIAGLMEHCIRQNNATDIYEDFLEDEDEEDVEESEEQPSAKTINVFRDPNEVKRTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFSHRDPVYKAIWLQSKTGTDIFSASTDGQVLWWDIRKMSEPTERLVMDPTKKGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLCLKVCDEALYSIKVQDNGRFLACGSQLGTTTLLEISSGLCSLQKNEKALVSEMFERETKREKILEARHREMRLKERSRSEQSREDEMKETDGEE--------------SVEELVARAEKEFFHIIENER-MKERNE 569          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 261/378 (69.05%), Postives = 315/378 (83.33%), Query Frame = 2
Query:  539 SAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEG 1672
            S  + N   D NEVKRTAT +SW PDG  KLAVAY + EFQ +P + + DSYIWD+ NPNKP++ LKPV PLVC+EYNPKDSH LIGG YNGQ+A WD RKGSQP E+SP+E SHRDP +K IW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE +++DPTKK +++ + GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GPVYALQRNPFFPKNFLTVGDWTARIWSEDI++SSIMWTKYH++ L DG WSPVRP+VFFT KMDGTLDVWDI+FKQ +PTL ++VCDE+L  ++VQ+ GR +ACGS  GTTT+LE+S G  S+ KNEK LVS +FERET+REKILEARHRE++LK +K G
Sbjct:    8 SCSSWNTALDPNEVKRTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNKPEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFSHRDPVYKAIWLQSKTGTDIFSASTDGQVLWWDIRKMSEPTERLVMDPTKKGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCNRKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIKESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDILFKQNDPTLCLKVCDEALYSIKVQDNGRFLACGSQLGTTTLLEISSGLCSLQKNEKALVSEMFERETKREKILEARHREMRLKERKIG 385          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Match: dnai2a (dynein, axonemal, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-070410-46])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 287/567 (50.62%), Postives = 384/567 (67.72%), Query Frame = 2
Query:   95 YKMEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEAS-EEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERK 1792
            +KME+ Y   +++ E GR C F ++ A +H DI PDPSLA  +I++     G Q  +  S+HEV     E  + G+NH EGGWP+ +++   +  +RYRKKV+KDE+Y  T+     VME+   +    +    YF+   +    E+  SA+ INV RD  + KR AT +SW P    KLAVAY   EFQ  P N S+DSYIW++ N  +P++ LK VSPLVC+EYN K+   LIGG YNGQ+  WD R GSQP ++S +E+SH+DP +KVIW+Q+K GTE FSASTDGQV +WD+R M+EPT+ +ILDP K ++L  A GA+++E+++T+P KF+ GTEQG ++ CNRK +T  + I   Y GHLGPVYA+QRNPFFPK FLTV DWTARIWSEDIR SSIM TKYH S L DG WSPVRPAVFFT KMDGTLDVWDI+ KQK+P L ++VCDE+L  +RV+    L+ CGS  GT T+L++S    ++  NEK LVS +FERET+REKILEA ++E + +MK+    E+         E    + + L+ + E +FF AI  E+K
Sbjct:   11 FKMEMTY---QQKIESGRWCKFSEK-AVVHDDIPPDPSLALEYIDRGTCHVGTQFSKFWSQHEVTPFHTEQVSHGMNHVEGGWPETISANNDELTLRYRKKVQKDESYQQTVIETVSVMEN--YKQKVFEKSQVYFKDNRVVVKREDMASARIINVLRDPKKEKRAATSLSWHPVDNHKLAVAYSCVEFQRGPKNMSSDSYIWNIENNKQPEMTLKSVSPLVCLEYNLKNISILIGGSYNGQIGYWDTRSGSQPVQISAIEHSHKDPVYKVIWLQTKIGTEAFSASTDGQVLFWDIRNMSEPTKQLILDPAKSKNLNNAFGAFSMEFDNTMP-KFLVGTEQGLVVLCNRKLETTDEPIVCTYSGHLGPVYAVQRNPFFPKYFLTVADWTARIWSEDIRLSSIMSTKYHTSHLMDGCWSPVRPAVFFTVKMDGTLDVWDILLKQKDPVLSLKVCDETLYSIRVKNDSPLMCCGSQLGTVTLLKMSPNLCTLQSNEKGLVSEMFERETKREKILEAFYKE-RNQMKQSCPKEE---------EDGRAELQELLAETETEFFEAINVEKK 560          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Match: dnai2a (dynein, axonemal, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-070410-46])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 286/565 (50.62%), Postives = 382/565 (67.61%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEAS-EEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERK 1792
            ME+ Y   +++ E GR C F ++ A +H DI PDPSLA  +I++     G Q  +  S+HEV     E  + G+NH EGGWP+ +++   +  +RYRKKV+KDE+Y  T+     VME+   +    +    YF+   +    E+  SA+ INV RD  + KR AT +SW P    KLAVAY   EFQ  P N S+DSYIW++ N  +P++ LK VSPLVC+EYN K+   LIGG YNGQ+  WD R GSQP ++S +E+SH+DP +KVIW+Q+K GTE FSASTDGQV +WD+R M+EPT+ +ILDP K ++L  A GA+++E+++T+P KF+ GTEQG ++ CNRK +T  + I   Y GHLGPVYA+QRNPFFPK FLTV DWTARIWSEDIR SSIM TKYH S L DG WSPVRPAVFFT KMDGTLDVWDI+ KQK+P L ++VCDE+L  +RV+    L+ CGS  GT T+L++S    ++  NEK LVS +FERET+REKILEA ++E + +MK+    E+         E    + + L+ + E +FF AI  E+K
Sbjct:    1 MEMTY---QQKIESGRWCKFSEK-AVVHDDIPPDPSLALEYIDRGTCHVGTQFSKFWSQHEVTPFHTEQVSHGMNHVEGGWPETISANNDELTLRYRKKVQKDESYQQTVIETVSVMEN--YKQKVFEKSQVYFKDNRVVVKREDMASARIINVLRDPKKEKRAATSLSWHPVDNHKLAVAYSCVEFQRGPKNMSSDSYIWNIENNKQPEMTLKSVSPLVCLEYNLKNISILIGGSYNGQIGYWDTRSGSQPVQISAIEHSHKDPVYKVIWLQTKIGTEAFSASTDGQVLFWDIRNMSEPTKQLILDPAKSKNLNNAFGAFSMEFDNTMP-KFLVGTEQGLVVLCNRKLETTDEPIVCTYSGHLGPVYAVQRNPFFPKYFLTVADWTARIWSEDIRLSSIMSTKYHTSHLMDGCWSPVRPAVFFTVKMDGTLDVWDILLKQKDPVLSLKVCDETLYSIRVKNDSPLMCCGSQLGTVTLLKMSPNLCTLQSNEKGLVSEMFERETKREKILEAFYKE-RNQMKQSCPKEE---------EDGRAELQELLAETETEFFEAINVEKK 548          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 375/576 (65.10%), Postives = 452/576 (78.47%), Query Frame = 2
Query:   86 FTDYKMEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            FT   MEIVYVYT+KRSEFGRQCNF DRPAELHVDI PDPS A NFIE+NP D  IQC  EMSEHEVNTERYE E RGINH EGGWPKD+N QE +Q IR+RKKVEKD+ Y  TI  L  VMEHCIKQNNA++IY+ YFE  + +E  +E PSA T+NVFRD NE+KRTATH+SW PDG  KLAVAY   +FQ +P + S +SYIWD+  PNKP+L LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKG  P E + +E+SHRDP +KVIW+QSKTGTECFSASTDGQ+ WWD+RK++EPTE +ILD +KK++L+ A GA +LE+E T+PTKFM GTEQG I+SCNRK KTP +KI   Y GH GP+Y++QRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH+S LTD  WSP RP VF TTKMDGTLDVWD ++KQ  P+L ++V  E L  +R+Q+ GR +ACGS  G TT++ELS+G +++ +NE+NL S +FERET+REKILEARHRE++LK +      K  P     EE  AE    ++  AE+DFF  IE E K +E++E
Sbjct:   28 FTPDTMEIVYVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERETKREKILEARHREMRLKERS-----KAEPGEEVKEEKPAEDMNEIIANAEKDFFEIIEAELKRKEQQE 598          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 373/571 (65.32%), Postives = 450/571 (78.81%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEIVYVYT+KRSEFGRQCNF DRPAELHVDI PDPS A NFIE+NP D  IQC  EMSEHEVNTERYE E RGINH EGGWPKD+N QE +Q IR+RKKVEKD+ Y  TI  L  VMEHCIKQNNA++IY+ YFE  + +E  +E PSA T+NVFRD NE+KRTATH+SW PDG  KLAVAY   +FQ +P + S +SYIWD+  PNKP+L LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKG  P E + +E+SHRDP +KVIW+QSKTGTECFSASTDGQ+ WWD+RK++EPTE +ILD +KK++L+ A GA +LE+E T+PTKFM GTEQG I+SCNRK KTP +KI   Y GH GP+Y++QRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH+S LTD  WSP RP VF TTKMDGTLDVWD ++KQ  P+L ++V  E L  +R+Q+ GR +ACGS  G TT++ELS+G +++ +NE+NL S +FERET+REKILEARHRE++LK +      K  P     EE  AE    ++  AE+DFF  IE E K +E++E
Sbjct:    7 MEIVYVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERETKREKILEARHREMRLKERS-----KAEPGEEVKEEKPAEDMNEIIANAEKDFFEIIEAELKRKEQQE 572          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 373/572 (65.21%), Postives = 451/572 (78.85%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVYT+KRSEFGRQCNF DRPAELHVDI PDPS A NFIE+NP D  IQC  EMSEHEVNTERYE E RGINH EGGWPKD+N QE +Q IR+RKKVEKD+ Y  TI  L  VMEHCIKQNNA++IY+ YFE  + +E  +E PSA T+NVFRD NE+KRTATH+SW PDG  KLAVAY   +FQ +P + S +SYIWD+  PNKP+L LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKG  P E + +E+SHRDP +KVIW+QSKTGTECFSASTDGQ+ WWD+RK++EPTE +ILD +KK++L+ A GA +LE+E T+PTKFM GTEQG I+SCNRK KTP +KI   Y GH GP+Y++QRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH+S LTD  WSP RP VF TTKMDGTLDVWD ++KQ  P+L ++V  E L  +R+Q+ GR +ACGS  G TT++ELS+G +++ +NE+NL S +FERET+REKILEARHRE++LK +      K  P     EE  AE    ++  AE+DFF  IE E K +E++E+
Sbjct:    1 MEIVYVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERETKREKILEARHREMRLKERS-----KAEPGEEVKEEKPAEDMNEIIANAEKDFFEIIEAELKRKEQQEL 567          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 373/571 (65.32%), Postives = 450/571 (78.81%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEIVYVYT+KRSEFGRQCNF DRPAELHVDI PDPS A NFIE+NP D  IQC  EMSEHEVNTERYE E RGINH EGGWPKD+N QE +Q IR+RKKVEKD+ Y  TI  L  VMEHCIKQNNA++IY+ YFE  + +E  +E PSA T+NVFRD NE+KRTATH+SW PDG  KLAVAY   +FQ +P + S +SYIWD+  PNKP+L LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKG  P E + +E+SHRDP +KVIW+QSKTGTECFSASTDGQ+ WWD+RK++EPTE +ILD +KK++L+ A GA +LE+E T+PTKFM GTEQG I+SCNRK KTP +KI   Y GH GP+Y++QRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH+S LTD  WSP RP VF TTKMDGTLDVWD ++KQ  P+L ++V  E L  +R+Q+ GR +ACGS  G TT++ELS+G +++ +NE+NL S +FERET+REKILEARHRE++LK +      K  P     EE  AE    ++  AE+DFF  IE E K +E++E
Sbjct:    1 MEIVYVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERETKREKILEARHREMRLKERS-----KAEPGEEVKEEKPAEDMNEIIANAEKDFFEIIEAELKRKEQQE 566          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 373/571 (65.32%), Postives = 450/571 (78.81%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEIVYVYT+KRSEFGRQCNF DRPAELHVDI PDPS A NFIE+NP D  IQC  EMSEHEVNTERYE E RGINH EGGWPKD+N QE +Q IR+RKKVEKD+ Y  TI  L  VMEHCIKQNNA++IY+ YFE  + +E  +E PSA T+NVFRD NE+KRTATH+SW PDG  KLAVAY   +FQ +P + S +SYIWD+  PNKP+L LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKG  P E + +E+SHRDP +KVIW+QSKTGTECFSASTDGQ+ WWD+RK++EPTE +ILD +KK++L+ A GA +LE+E T+PTKFM GTEQG I+SCNRK KTP +KI   Y GH GP+Y++QRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH+S LTD  WSP RP VF TTKMDGTLDVWD ++KQ  P+L ++V  E L  +R+Q+ GR +ACGS  G TT++ELS+G +++ +NE+NL S +FERET+REKILEARHRE++LK +      K  P     EE  AE    ++  AE+DFF  IE E K +E++E
Sbjct:    1 MEIVYVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEMEARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHYIATISQLGSVMEHCIKQNNAINIYEEYFEDTEELEGMDETPSANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDCRESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERETKREKILEARHREMRLKERS-----KAEPGEEVKEEKPAEDMNEIIANAEKDFFEIIEAELKRKEQQE 566          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 369/568 (64.96%), Postives = 447/568 (78.70%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMRE 1801
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LA  ++E+NPVD GIQC   MSEHE NTER+E E+ G+NH EGGWPKDVN QE +Q IR+RKKVEKDE Y N +  L  +MEHCIKQNNA+DIY+ YF+  +     E  PSAKTINVFRD  E+KRTATH+SW PDG  KLAVAY   +FQ +P + + DSYIWD+ NPN+P++ LKP+SPLV +EYNPKDSH L+GGCYNGQ+A WD RKGS   E+S +E SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RK++EP E++I+D ++K+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   + GH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ L+DG WSPVRPAVFFTTKMDGTLD+WD+VFKQ +P L ++VCD+ L CLRVQ+ G LIACGS  GTTT+LE+S    ++ +NEKN+ S+IFERETRREKILEARHRE++LK K    G+  G      EE  A   + LV KAEE+FF  I  E K +E
Sbjct:    1 MEIVYVYLKKRSEFGKQCNFSDRQAELNIDILPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEMESCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDNGCLIACGSELGTTTLLEVSSSLSTLQRNEKNIASSIFERETRREKILEARHREMRLKEK----GKVEGKEDDQKEEEAALDLDELVGKAEEEFFEVIFSELKRKE 564          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 369/568 (64.96%), Postives = 447/568 (78.70%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMRE 1801
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LA  ++E+NPVD GIQC   MSEHE NTER+E E+ G+NH EGGWPKDVN QE +Q IR+RKKVEKDE Y N +  L  +MEHCIKQNNA+DIY+ YF+  +     E  PSAKTINVFRD  E+KRTATH+SW PDG  KLAVAY   +FQ +P + + DSYIWD+ NPN+P++ LKP+SPLV +EYNPKDSH L+GGCYNGQ+A WD RKGS   E+S +E SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RK++EP E++I+D ++K+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   + GH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ L+DG WSPVRPAVFFTTKMDGTLD+WD+VFKQ +P L ++VCD+ L CLRVQ+ G LIACGS  GTTT+LE+S    ++ +NEKN+ S+IFERETRREKILEARHRE++LK K    G+  G      EE  A   + LV KAEE+FF  I  E K +E
Sbjct:    1 MEIVYVYLKKRSEFGKQCNFSDRQAELNIDILPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEMESCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDNGCLIACGSELGTTTLLEVSSSLSTLQRNEKNIASSIFERETRREKILEARHREMRLKEK----GKVEGKEDDQKEEEAALDLDELVGKAEEEFFEVIFSELKRKE 564          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Match: Dnaic2 (dynein, axonemal, intermediate chain 2 [Source:MGI Symbol;Acc:MGI:2685574])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 360/575 (62.61%), Postives = 440/575 (76.52%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQ 1822
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LA  ++E+NPVD GIQC   MSEHE NTER+E E+ G+NH EGGWPKDVN QE +Q IR+RKKVEKDE Y N +  L  +MEHCIKQNNA+DIY+ YF+  +     E  PSAKTINVFRD  E+KRTATH+SW PDG  KLAVAY   +FQ +P + + DSYIWD+ NPN+P++ LKP+SPLV +EYNPKDSH L+GGCYNGQ+A WD RKGS   E+S +E SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RK++EP E++I+D ++K+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   + GH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ L+DG WSPVRPAVFFTTKMDGTLD+WD+VFKQ +P L +            ++ G LIACGS  GTTT+LE+S    ++ +NEKN+ S+IFERETRREKILEARHRE++LK K    G+  G      EE  A   + LV KAEE+FF  I  E K +E   + ++
Sbjct:    1 MEIVYVYLKKRSEFGKQCNFSDRQAELNIDILPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEMESCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSL------------KDNGCLIACGSELGTTTLLEVSSSLSTLQRNEKNIASSIFERETRREKILEARHREMRLKEK----GKVEGKEDDQKEEEAALDLDELVGKAEEEFFEVIFSELKRKEAEALKKK 559          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Match: Dync1i2 (dynein cytoplasmic 1 intermediate chain 2 [Source:MGI Symbol;Acc:MGI:107750])

HSP 1 Score: 117.472 bits (293), Expect = 5.021e-27
Identity = 98/417 (23.50%), Postives = 191/417 (45.80%), Query Frame = 2
Query:  344 PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASE-EPPSAKTINVFRDMNEVK----RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVENS-HRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSSIMWT-KYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV-CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            P ++  +E  Q++         E + +   + + ++E  + +   ++I+ +Y  G D+E  E E  +   +++ R   + +    R  + + W    P  L  +Y N E   +P      + +W++      P+ V    S ++   +     + ++GG Y+GQ+ LWD R   + P + +P+  + H  P + V  + ++      S STDG++  W +  ++ P + M L    KQ   KA    ++ +       F+ G+E+GS+ +  R G      I+ ++ GH GP+  +  +       F   F+T   DWT ++W+   +++  +++ + +   + D MWSP  PA+F      G LD+W++    + PT  I V  + +LN +R    GR IA G   G   I ++ E
Sbjct:  179 PHELTEEEKQQILH-------SEEFLSFFDHSTRIVERALSEQ--INIFFDY-SGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNE--EAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMEL--VHKQS--KAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAG--ISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWT--TKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGE 575          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Match: Dync1i2 (dynein cytoplasmic 1 intermediate chain 2 [Source:MGI Symbol;Acc:MGI:107750])

HSP 1 Score: 117.472 bits (293), Expect = 5.021e-27
Identity = 98/417 (23.50%), Postives = 191/417 (45.80%), Query Frame = 2
Query:  344 PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASE-EPPSAKTINVFRDMNEVK----RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVENS-HRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSSIMWT-KYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV-CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            P ++  +E  Q++         E + +   + + ++E  + +   ++I+ +Y  G D+E  E E  +   +++ R   + +    R  + + W    P  L  +Y N E   +P      + +W++      P+ V    S ++   +     + ++GG Y+GQ+ LWD R   + P + +P+  + H  P + V  + ++      S STDG++  W +  ++ P + M L    KQ   KA    ++ +       F+ G+E+GS+ +  R G      I+ ++ GH GP+  +  +       F   F+T   DWT ++W+   +++  +++ + +   + D MWSP  PA+F      G LD+W++    + PT  I V  + +LN +R    GR IA G   G   I ++ E
Sbjct:  179 PHELTEEEKQQILH-------SEEFLSFFDHSTRIVERALSEQ--INIFFDY-SGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNE--EAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMEL--VHKQS--KAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAG--ISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWT--TKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGE 575          
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Match: sp|Q16960|DYI3_HELCR (Dynein intermediate chain 3, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 415/606 (68.48%), Postives = 492/606 (81.19%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA 1918
            MEIVYVYTKKRSEFGRQCNF DRPAELHVDI PD SL  NFIEKNPVDRGIQCVQEMSEHE+NTER+ET++RGINH EGGWPKD+N QE +QV+R+RKKVEKDE+Y  TIQNL+  MEH IKQNNA+DIY++YF  ++IE  EE PSAKTINVFRD NE+KR ATH+SW+PDGP KLAVAY + EFQ +   TS DSYIWD+ NPNKP+ VLKPVSPLVC+EYNPKD H LIGGCYNGQ+A WD RKGSQ  E+SPVE+SH DP +K IW+QSKTGTECFSASTDGQV WWD+RK+ EPTE +I+DP+KK  +E AQG  +LEYE TIPTKFM GTEQG+I+SCNRK KTP +KI AIY  H+GPVY+LQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYH+S LTDG WSPVRPAVFFTTKMDG+LDVWD +FKQK+PTL +QV D++L+ LRVQ+QGRLIA GS+SGTTT+LELS G  +M +NEK LV+ +FERET+REKILE+R REL+L  K++G   +        EE   ++EE+LV  AE++FF  ++ ++    K+   +Q   +  D   +    +N  SEK +T+  EKE 
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFSDRPAELHVDILPDESLLSNFIEKNPVDRGIQCVQEMSEHEINTERFETDSRGINHMEGGWPKDINPQEVEQVLRFRKKVEKDESYVTTIQNLASSMEHTIKQNNAIDIYEDYFADLEIEEVEETPSAKTINVFRDPNEIKRPATHLSWYPDGPKKLAVAYSSLEFQKTSAETSMDSYIWDIENPNKPEFVLKPVSPLVCLEYNPKDVHVLIGGCYNGQVAFWDTRKGSQAVEMSPVEHSHHDPVYKTIWLQSKTGTECFSASTDGQVLWWDMRKLGEPTEKLIMDPSKKGKMENAQGVISLEYEPTIPTKFMVGTEQGTIISCNRKAKTPPEKIVAIYKEHIGPVYSLQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDYLFKQKDPTLSLQVSDDALHSLRVQDQGRLIATGSNSGTTTLLELSSGLCTMQRNEKALVTAMFERETKREKILESRQRELRL--KRQGASAQ---GQDDDEEGGPDEEEDLVAAAEKEFFQIVQADK----KKFAAQQAKLSEQDNKIIEEAEENNGSEKKDTENGEKEG 597          
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Match: sp|Q9GZS0|DNAI2_HUMAN (Dynein intermediate chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAI2 PE=1 SV=2)

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 380/572 (66.43%), Postives = 452/572 (79.02%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGID-IEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREI 1813
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LAE F+E+NPVD GIQC   MSEHE N+ER+E ETRG+NH EGGWPKDVN  E +Q IR+RKKVEKDE Y N I  L  +MEHCIKQNNA+DIY+ YF   + +E  EE PSAKTINVFRD  E+KR ATH+SW PDG  KLAVAY   +FQ +P   S+DSYIWD+ NPNKP+L LKP SPLV +E+NPKDSH L+GGCYNGQ+A WD RKGS   E+S +E+SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RKM+EPTE++ILD TKK+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   +PGH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ LTD  WSPVRP VFFTT+MDGTLD+WD +F+Q +PTL ++VCDE+L CLRVQ+ G LIACGS  GTTT+LE+S G  ++ +NEKN+ S++FERETRREKILEARHRE++LK K    G+  G      +E  A   E LV KAEE+FF  I  E K +E   I
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREKILEARHREMRLKEK----GKAEGRDEEQTDEELAVDLEALVSKAEEEFFDIIFAELKKKEADAI 568          
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Match: sp|Q66HC9|DNAI2_RAT (Dynein intermediate chain 2, axonemal OS=Rattus norvegicus OX=10116 GN=Dnai2 PE=2 SV=1)

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 369/568 (64.96%), Postives = 446/568 (78.52%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMRE 1801
            MEIVYVY KKRSEFG+QCNF DR AEL++DI+P+P LA  ++E+NPVD GIQC   MSEHE NTER+E E  G+NH EGGWPKDVN QE +Q IR+RKKVEKDE Y N +  L  +MEHCIKQNNA+DIY+ YF+  +     E  PSAKTINVFRD  E+KRTATH+SW PDG  KLAVAY   +FQ SP   S DSYIWD+ NPN+P++ LKP SPL+ +EYNPKDSH L+GGCYNGQ+A WD RKGS   E+S +E SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RK++EPTE++I+D T+K+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KTPA+KI   + GH GP+YALQRNPF+PKNFLTVGDW ARIWSE+ R+SSIMWT+YH++ L+DG WSPVRPAVFFTTKMDGTLD+WD+VFKQ +P L ++VCD+ L CLRVQ+ G LIACGS  GTTT+LE+S    ++ +NE+N+ S+IFERETRREKILEARHRE++LK K    G+  G      EE  A   + LV KAEE+FF  I  E K +E
Sbjct:    1 MEIVYVYVKKRSEFGKQCNFSDRQAELNIDISPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEMENCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNKKLAVAYSCLQFQRSPMGMSHDSYIWDLENPNRPEIALKPSSPLITLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPTEVVIMDITRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTPAEKIVCTFSGHHGPIYALQRNPFYPKNFLTVGDWAARIWSEESRESSIMWTRYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDTGCLIACGSELGTTTLLEVSSSLSTLQRNERNIASSIFERETRREKILEARHREMRLKEK----GKAEGRDDDQKEEETALDLDELVNKAEEEFFEVIFAELKRKE 564          
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Match: sp|A2AC93|DNAI2_MOUSE (Dynein intermediate chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnai2 PE=1 SV=2)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 369/568 (64.96%), Postives = 447/568 (78.70%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMRE 1801
            MEIVYVY KKRSEFG+QCNF DR AEL++DI P+P LA  ++E+NPVD GIQC   MSEHE NTER+E E+ G+NH EGGWPKDVN QE +Q IR+RKKVEKDE Y N +  L  +MEHCIKQNNA+DIY+ YF+  +     E  PSAKTINVFRD  E+KRTATH+SW PDG  KLAVAY   +FQ +P + + DSYIWD+ NPN+P++ LKP+SPLV +EYNPKDSH L+GGCYNGQ+A WD RKGS   E+S +E SHRDP +  IW+QSKTGTECFSASTDGQV WWD+RK++EP E++I+D ++K+ LE A GA +LE+EST+PTKFM GTEQG ++SCNRK KT A+KI   + GH GP+YALQRNPF+PKNFLTVGDWTARIWSED R+SSIMWTKYH++ L+DG WSPVRPAVFFTTKMDGTLD+WD+VFKQ +P L ++VCD+ L CLRVQ+ G LIACGS  GTTT+LE+S    ++ +NEKN+ S+IFERETRREKILEARHRE++LK K    G+  G      EE  A   + LV KAEE+FF  I  E K +E
Sbjct:    1 MEIVYVYLKKRSEFGKQCNFSDRQAELNIDILPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEMESCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNRKLAVAYSCLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVAELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPIEVVIMDISRKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTQAEKIVCTFYGHHGPIYALQRNPFYPKNFLTVGDWTARIWSEDSRESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRVQDNGCLIACGSELGTTTLLEVSSSLSTLQRNEKNIASSIFERETRREKILEARHREMRLKEK----GKVEGKEDDQKEEEAALDLDELVGKAEEEFFEVIFSELKRKE 564          
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Match: sp|P27766|DYI3_CHLRE (Dynein, 70 kDa intermediate chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA6 PE=1 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 258/526 (49.05%), Postives = 337/526 (64.07%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPT-KLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTI-PTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIR-DSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKE 1669
            MEI + Y K R +FGR   F D  +E+  DI P+    + +I +NPV    QCV EMSEHE NT       + ++H EGGWPKDV+  EA+  IRYRKKVEKDE Y  T+  L   +E  IKQNNA+DIY  YF  + ++ + E P  KT+ VF+D N +KR+A++++W PDG   K+ VAY   +FQ  P      SYIWDV NPN P+  + P S + C ++N KD++ +  G YNGQLA +D RKG+ P E +P++ SHRDP +   W+QSKTGTEC + STDG V WWD+RKM E  E M   P K+++ E   G   LEY++   PT FM GTEQG I SCNRK K P D++  +  GH GP+Y L+RNPF  K FL++GDWTAR+W ED    + I+ TKYH + LT G WSP RP VFFT KMDG +DVWD+ +K  EPTL +QV D +L    VQE G  +A G+  G T++L+LS G    S  EK  ++ +FERET REK LE   +E K+K +KE
Sbjct:    1 MEIYHQYIKLRKQFGRFPKFGDEGSEMLADIRPNEDHGKEYIPRNPVTTVTQCVPEMSEHEANTNAVILVNKAMSHVEGGWPKDVDYTEAEHTIRYRKKVEKDEDYIRTVVQLGSSVEDLIKQNNAVDIYQEYFTNVTMDHTSEAPHVKTVTVFKDPNNIKRSASYVNWHPDGSVPKVVVAYSILQFQQQPAGMPLSSYIWDVNNPNTPEYEMVPTSQICCAKFNLKDNNLVGAGQYNGQLAYFDVRKGNGPVEATPIDISHRDPIYDFAWLQSKTGTECMTVSTDGNVLWWDLRKMNECVENM---PLKEKNSETTVGGVCLEYDTNAGPTNFMVGTEQGQIFSCNRKAKNPVDRVKYVLSGHHGPIYGLRRNPFNSKYFLSIGDWTARVWVEDTAVKTPILTTKYHPTYLTGGTWSPSRPGVFFTIKMDGAMDVWDLYYKHNEPTLTVQVSDLALTAFAVQESGGTVAVGTSDGCTSVLQLSTGLSEASPAEKANINAMFERETTREKNLEKAIKEAKVKARKE 523          
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|20407143 (tr|A0A419QF92|A0A419QF92_CLOSI Dynein intermediate chain 3 OS=Clonorchis sinensis OX=79923 GN=CSKR_2537s PE=4 SV=1)

HSP 1 Score: 917.146 bits (2369), Expect = 0.000e+0
Identity = 429/609 (70.44%), Postives = 504/609 (82.76%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNL---SVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA 1918
            MEI YVYTKKR+EFGRQCNF DR AELHVDI+PDP LA N+I  NPV R IQC +EMSEHEVNTERY +E+RGINH EGGWPKD+N+QE DQV+RYRKK+EKDE Y+ T+Q L   S VMEHCIKQNNAL+IY+NYF+ +D  ASEEPPSAKT+N+ RD+NE+KR+  HISWFPDGP+KLA+AYCNTEFQ+S PNTS +SY+WD+ NPN+P+LVLKP SPLVCIEYNPKDSHTLI GCYNGQLA WDRRKGSQP EV+PVE SHRDPAWKVIWIQSKTGTECFS  TDGQV WWDVRK +EPTE++ LDPTKKQD   AQGAYALEYESTIPTKFMAGTEQG+I+SCNRKGKTPA+KI A+YPGH+GPVYALQRNPFFPKNFL++GDWTARIWSEDIRDS+IMWT YH   L+DG WSPVRPAVFF++++DG LDVWD++FKQK+ TL IQVCDE L+CL+VQEQGRLIA GSHSG  TILELS+GF +  KNEK L++++FERET REKILEAR+RE+KLK  K   GE    +  G E  + ++    + K EEDFF  IE +RK RE+RE      AA   ++ +A+T   +D +  +  +  KE+
Sbjct:    1 MEITYVYTKKRAEFGRQCNFSDRNAELHVDISPDPELANNYIAMNPVQRSIQCSKEMSEHEVNTERYHSESRGINHLEGGWPKDINAQEPDQVLRYRKKIEKDEQYSATVQKLGMVSEVMEHCIKQNNALNIYENYFDDLDDRASEEPPSAKTLNILRDLNELKRSVAHISWFPDGPSKLAIAYCNTEFQASSPNTSLESYLWDIGNPNRPELVLKPASPLVCIEYNPKDSHTLISGCYNGQLAFWDRRKGSQPVEVTPVEQSHRDPAWKVIWIQSKTGTECFSTGTDGQVMWWDVRKFSEPTEVLYLDPTKKQDFSCAQGAYALEYESTIPTKFMAGTEQGTIISCNRKGKTPAEKIVAVYPGHIGPVYALQRNPFFPKNFLSIGDWTARIWSEDIRDSAIMWTAYHEHRLSDGAWSPVRPAVFFSSRLDGVLDVWDVIFKQKDATLSIQVCDEPLHCLKVQEQGRLIATGSHSGVCTILELSDGFVTQPKNEKTLMTSMFERETHREKILEARNREIKLKKTKATLGED---AERGEEALDPKEMAERIKKVEEDFFETIEAKRKEREQRE-----KAAEESKANLATTEGEVDLDDDDEFEGTKES 601          
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|21452626 (tr|A0A1S8WXJ4|A0A1S8WXJ4_9TREM WD domain, G-beta repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04975 PE=4 SV=1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 420/574 (73.17%), Postives = 487/574 (84.84%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFR----DMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKRE 1810
            MEI YVYTKKR+EFGRQCNF DR AELHVDI+PDP LA N+I  NPV R IQC +EMSEHEVNTERY +E+RGINH EGGWPKD+N+QE DQV+RYRKK+EKDE Y+ T+Q L +VMEHCIKQNNAL+IY+NYF+ ++  ASEEPPSAKT+N+ R    DMNE+KR+  HISWFPDGP+KLA+AYCNTEFQ+S PNTS +SY+WD+ NPN+P+LVLKP SPLVCIEYNPKDSHTLI GCYNGQLA WDRRKGSQP EV+PVE SHRDPAWKVIWIQSKTGTECFS  TDGQV WWDVRK +EPTE++ LDPTKKQ+   AQGAYALEYESTIPTKFMAGTEQG+I+SCNRKGKTPA+KI A+YPGH+GPVYALQRNPFFPKNFL++GDWTARIWSEDIRDS+IMWT YH   L+DG WSPVRPAVFFT+++DG LDVWD++FKQK+ TL IQVCDE L+CL+VQEQGRLIA GSHSG  TILELS+GF +  KNEK L++++FERET REKILEAR+RE+KLK  K   GE    +    E  + ++    + K EEDFF  IE +RK RE+RE
Sbjct:    1 MEITYVYTKKRAEFGRQCNFSDRNAELHVDISPDPELANNYIAMNPVHRSIQCSKEMSEHEVNTERYHSESRGINHLEGGWPKDINAQEPDQVLRYRKKIEKDEQYSATVQKLGMVMEHCIKQNNALNIYENYFDDLEDRASEEPPSAKTLNILRYGVTDMNEIKRSVAHISWFPDGPSKLAIAYCNTEFQASSPNTSLESYLWDIGNPNRPELVLKPASPLVCIEYNPKDSHTLISGCYNGQLAFWDRRKGSQPVEVTPVEQSHRDPAWKVIWIQSKTGTECFSTGTDGQVMWWDVRKFSEPTEVLYLDPTKKQEFSCAQGAYALEYESTIPTKFMAGTEQGTIISCNRKGKTPAEKIVAVYPGHIGPVYALQRNPFFPKNFLSIGDWTARIWSEDIRDSAIMWTAYHEHRLSDGAWSPVRPAVFFTSRLDGVLDVWDVIFKQKDATLSIQVCDEPLHCLKVQEQGRLIATGSHSGVCTILELSDGFATQPKNEKTLMTSMFERETHREKILEARNREIKLKKTKANLGED---AERTEEVLDPKEMAERIKKVEEDFFETIEAKRKEREQRE 571          
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|16178542 (tr|A0A4S2LWG0|A0A4S2LWG0_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004380 PE=4 SV=1)

HSP 1 Score: 915.22 bits (2364), Expect = 0.000e+0
Identity = 420/597 (70.35%), Postives = 494/597 (82.75%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKG 1891
            MEI YVYTKKR+EFGRQCNF DR AELHVDI+PDP LA N++  NPV R IQC  EMSEHEVNTERY +E+RGINH EGGWPKD+N+QE DQV+RYRKK+EKDE Y+ T+Q L +VMEHCIKQNNAL+IY+NYF+ +D  ASEEPPSAKT+N+ RDMNE+KR+  HISWFPDGP+KLA+AYCNTEFQ+S PNTS +SY+WD+ NPN+P+LVLKP SPLVCIEYNPKDSHTLI GCYNGQLA WDRRKGSQP EV+PVE SHRDPAWKVIWIQSKTGTECFS  TDGQV WWDVRK +EPTE++ LDPTKKQ+   AQGAYALEYESTIPTKFMAGTEQG+I+SCNRKGKTPA+KI A+YPGH+GPVYALQRNPFFPKNFL++GDWTAR+WSEDIRDS+IMWT YH   L+DG WSPVRPAVFF++++DG LDVWD++FKQK+ TL IQVCDE L+CL+VQEQGRLIA GSHSG  TILELS+GF +  KNEK L++++FERET REKILEAR+RE+KLK  K      V  +    E  + ++    + K E+DFF  IE +RK RE RE   + + A    +     +D+ D  +G
Sbjct:    1 MEITYVYTKKRAEFGRQCNFSDRNAELHVDISPDPELANNYVAMNPVQRSIQCSTEMSEHEVNTERYHSESRGINHLEGGWPKDINAQEPDQVLRYRKKIEKDEQYSATVQKLGMVMEHCIKQNNALNIYENYFDDLDDTASEEPPSAKTLNILRDMNELKRSVAHISWFPDGPSKLAIAYCNTEFQASSPNTSLESYLWDIGNPNRPELVLKPASPLVCIEYNPKDSHTLISGCYNGQLAFWDRRKGSQPVEVTPVEQSHRDPAWKVIWIQSKTGTECFSTGTDGQVMWWDVRKFSEPTEVLYLDPTKKQEFSCAQGAYALEYESTIPTKFMAGTEQGTIISCNRKGKTPAEKIVAVYPGHIGPVYALQRNPFFPKNFLSIGDWTARVWSEDIRDSAIMWTAYHEHRLSDGAWSPVRPAVFFSSRLDGVLDVWDVIFKQKDATLSIQVCDEPLHCLKVQEQGRLIATGSHSGVCTILELSDGFATQPKNEKTLMTSMFERETHREKILEARNREIKLKKTK---ANLVEDAERTEEALDPKEMAERIRKVEQDFFETIEAKRKERELREKATEESKANLATTEGEVDLDDDDEFEG 594          
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|20351631 (tr|A0A1S3K0K8|A0A1S3K0K8_LINUN dynein intermediate chain 3, ciliary OS=Lingula unguis OX=7574 GN=LOC106177749 PE=4 SV=1)

HSP 1 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 423/588 (71.94%), Postives = 485/588 (82.48%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLK-MKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREID-RQRAAAGADESTVA 1858
            MEIVYVYTKKR+EFGRQCNF DR AELH+DI PDP  +EN+IE+NPVD  +QC  EMSEHE+NTER+ETE RGINHTEGGWPKDVN QE +QV+RYRKKVEKDE Y NTIQ LS VMEHCIKQNNA+DIY+ YF+ ID++  +E P+AKTINVFRD  + KRT+THISWFPDGP KLA+AYCN EFQ S P+TS DSYIWDV NPNKP+  LKPVSPLVC+EYNPKD+H L+GGCYNGQ+A WD RKGSQP E SP+E+SHRDPA+K IW+QSKTGTECFS S+DGQV WWD RKM EP E + LDPTKKQD  KAQGA  LEYE T+PTKFM GTE G++MSCNRK KTPA+KI AIYPGH GPVY+LQRNPFFPKNFLTVGDWTARIWSEDIR+SSIMWTKYH+S LTDG WSP RPAVFFTTKMDGTLD+WD +FKQ +PTL IQVCDE+L+ +RVQEQGRL+A GSHSGTTT+LELS G   + +NEK LV+ IFERETRREKIL+ARHRE+KLK  +K   GE         EE    +EE+LV KAE +FF  IE E+K +EK+E   +Q+ A  ADE   +
Sbjct:    1 MEIVYVYTKKRAEFGRQCNFSDREAELHIDILPDPKESENYIERNPVDISVQCAAEMSEHEINTERFETEVRGINHTEGGWPKDVNPQEVEQVLRYRKKVEKDEMYINTIQQLSTVMEHCIKQNNAIDIYEEYFDDIDVDDMDETPTAKTINVFRDPCDPKRTSTHISWFPDGPRKLAIAYCNLEFQGSSPDTSMDSYIWDVENPNKPEFTLKPVSPLVCVEYNPKDAHVLVGGCYNGQIAYWDTRKGSQPVETSPIEHSHRDPAYKTIWLQSKTGTECFSTSSDGQVLWWDTRKMGEPFEKLYLDPTKKQDFSKAQGAMCLEYEPTLPTKFMVGTEIGTVMSCNRKAKTPAEKIVAIYPGHHGPVYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYHMSYLTDGCWSPTRPAVFFTTKMDGTLDIWDTIFKQNDPTLSIQVCDEALHSVRVQEQGRLVATGSHSGTTTLLELSNGLVQLQRNEKVLVNAIFERETRREKILDARHREMKLKERQKSSQGEH-----KQEEEEGGYEEEDLVSKAEREFFETIEYEQKQKEKKEAALKQQQAEKADEGKAS 583          
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Match: gnl|BL_ORD_ID|23863354 (tr|V4B996|V4B996_LOTGI WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_110559 PE=4 SV=1)

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 410/564 (72.70%), Postives = 474/564 (84.04%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERK 1792
            MEIVYVYTKKRSEFGRQCNF DRPAELHVDI PD SL+++F+E+NPVD  IQCVQEMSEHEVNTER+ET +RGINHTEGGWPKDVN QE +QV RYRKKVEKDE Y  TIQ L  +MEHCIKQNNA+DIY+ YFE +D++  +E PSAKTINVFRD NE+KRTATHISWFPDGP KLAVAYCN EFQ S P+TS DSYIWDV NPNKP++ LKPVSPLVC+EYNPKDSH L+GGCYNGQ+A WD RKGSQP E++P+E SHRDPA+K IWIQSKTG+ECFS STDGQV WWD+RK+ EPTE + LD  KKQD  KAQGAY+LEYE TIPTKFM GTEQG++MSCNRK KTP +KI A+YPGH+GPVY+LQRNP+FPKNFL+VGDWTARIWSEDIR+SSIMWTK + S LTDG WSP RPAVFF TKMDGTLDVWDI+FKQ +PTL +QVCD  L+ LRVQEQ +L+ACGS  GTTT+LELSEG + + +NEKNLV+ + ERETRREKILE RHRE+KLK + +   E  G     A++   E EE+L+ KA+++F   I  E+K
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFSDRPAELHVDIVPDASLSQDFVERNPVDTAIQCVQEMSEHEVNTERFETSSRGINHTEGGWPKDVNPQEVEQVTRYRKKVEKDEMYIATIQQLGNIMEHCIKQNNAIDIYEEYFEDVDVDHIDETPSAKTINVFRDPNEIKRTATHISWFPDGPRKLAVAYCNLEFQGSSPDTSMDSYIWDVENPNKPEMTLKPVSPLVCLEYNPKDSHILLGGCYNGQIAYWDTRKGSQPVEMTPIEQSHRDPAYKAIWIQSKTGSECFSTSTDGQVLWWDIRKLGEPTEKLYLD--KKQDFSKAQGAYSLEYEPTIPTKFMVGTEQGTVMSCNRKAKTPLEKIVALYPGHIGPVYSLQRNPYFPKNFLSVGDWTARIWSEDIRESSIMWTKQYSSYLTDGCWSPTRPAVFFITKMDGTLDVWDILFKQNDPTLSLQVCDGPLHSLRVQEQAKLVACGSQDGTTTLLELSEGLYQLQRNEKNLVTAMLERETRREKILEGRHREMKLKERTKSSQE--GKEKEEAQDDLQETEEDLIAKAKKEFDDIIATEKK 560          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 388/579 (67.01%), Postives = 454/579 (78.41%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEP-PSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKR---EIDRQR 1825
            MEIVYVY KKRSEFGRQCNF DRPAELHVDI PDPSLA NFI+++P D  IQC QEMSEHEVNTER+E ETRGINH EGGWPKDVN QE +Q IRYRKKVEKDE Y NTI  L   MEHCI+QNNA+DIY  YFE  +     E  PSAKTINVFRD NEVKRTAT +SW PDG  KLAVAY + EFQ    + S DSYIWD+   NKP++ LKPVSPLVC+EYNPKDSH L+GG YNGQ+A WD RKGSQP E+S +E+SHRDP +KVIW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE ++LDP+KK  L++A GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GP+Y+LQRNPFFPKNFLTVGDWTARIWSEDIR+SSIMWTKY  + L+DG WSPVRP+VFFT KMDGTLDVWD +FKQ +PTL I+VCDE+L  +RVQ+ GR + CGS  GTTT+LE+S G  ++ +NEK L + +FERET+REKILEARHREL+LK +   +  K        E    E  E LV +AE +F+  +E E K REK    EID+ R
Sbjct:    1 MEIVYVYVKKRSEFGRQCNFSDRPAELHVDILPDPSLAANFIDRDPCDVPIQCTQEMSEHEVNTERFEYETRGINHMEGGWPKDVNPQEMEQTIRYRKKVEKDENYVNTILQLGSHMEHCIRQNNAIDIYQEYFEEEEGVEETEEQPSAKTINVFRDPNEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHSHRDPVYKVIWLQSKTGTDFFSASTDGQVLWWDIRKMSEPTERLVLDPSKKGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTLSIKVCDEALYSMRVQDNGRFLGCGSELGTTTLLEISSGLCTLQRNEKALATAMFERETKREKILEARHRELRLKERSRSEQSK---EDETKETEGEESAEELVARAEREFYEMVEAEMKKREKDEKIEIDQVR 576          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 362/588 (61.56%), Postives = 431/588 (73.30%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGI-------NHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNL---SVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKR---EIDRQR 1825
            MEIVYVY KKRSEFGRQCNF DRPAELHVDI PDPSLA NFI+++P D  IQC QEMSEHEV+         G+                DVN QE +Q IRYRKKVEKDE Y NTI  L   SV ++H   +           E   +E +EE PSAKTINVFRD NEVKRTAT +SW PDG  KLAVAY + EFQ    + S DSYIWD+   NKP++ LKPVSPLVC+EYNPKDSH L+GG YNGQ+A WD RKGSQP E+S +E+SHRDP +KVIW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE ++LDP+KK  L++A GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GP+Y+LQRNPFFPKNFLTVGDWTARIWSEDIR+SSIMWTKY  + L+DG WSPVRP+VFFT KMDGTLDVWD +FKQ +PTL I+VCDE+L  +RVQ+ GR + CGS  GTTT+LE+S G  ++ +NEK L + +FERET+REKILEARHREL+LK +   +  K        E    E  E LV +AE +F+  +E E K REK    EID+ R
Sbjct:    1 MEIVYVYVKKRSEFGRQCNFSDRPAELHVDILPDPSLAANFIDRDPCDVPIQCTQEMSEHEVSLLSTIHVPYGLKMLIKPGTMAPPVLSADVNPQEMEQTIRYRKKVEKDENYVNTILQLGSVSVTVKHYKLEYFE--------EEEGVEETEEQPSAKTINVFRDPNEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHSHRDPVYKVIWLQSKTGTDFFSASTDGQVLWWDIRKMSEPTERLVLDPSKKGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTLSIKVCDEALYSMRVQDNGRFLGCGSELGTTTLLEISSGLCTLQRNEKALATAMFERETKREKILEARHRELRLKERSRSEQSK---EDETKETEGEESAEELVARAEREFYEMVEAEMKKREKDEKIEIDQVR 577          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 351/585 (60.00%), Postives = 420/585 (71.79%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGI-------NHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKR---EIDRQR 1825
            MEIVYVY KKRSEFGRQCNF DRPAELHVDI PDPSLA NFI+++P D  IQC QEMSEHEV+         G+                DVN QE +Q IRYRKKVEKDE Y NTI  L  V    +K         + F  I             +++FRD NEVKRTAT +SW PDG  KLAVAY + EFQ    + S DSYIWD+   NKP++ LKPVSPLVC+EYNPKDSH L+GG YNGQ+A WD RKGSQP E+S +E+SHRDP +KVIW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE ++LDP+KK  L++A GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GP+Y+LQRNPFFPKNFLTVGDWTARIWSEDIR+SSIMWTKY  + L+DG WSPVRP+VFFT KMDGTLDVWD +FKQ +PTL I+VCDE+L  +RVQ+ GR + CGS  GTTT+LE+S G  ++ +NEK L + +FERET+REKILEARHREL+LK +   +  K        E    E  E LV +AE +F+  +E E K REK    EID+ R
Sbjct:    1 MEIVYVYVKKRSEFGRQCNFSDRPAELHVDILPDPSLAANFIDRDPCDVPIQCTQEMSEHEVSLLSTIHVPYGLKMLIKPGTMAPPVLSADVNPQEMEQTIRYRKKVEKDENYVNTILQLGSV-SVTVKSVKFDRKVSSIFSWI-------------LSLFRDPNEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHSHRDPVYKVIWLQSKTGTDFFSASTDGQVLWWDIRKMSEPTERLVLDPSKKGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTLSIKVCDEALYSMRVQDNGRFLGCGSELGTTTLLEISSGLCTLQRNEKALATAMFERETKREKILEARHRELRLKERSRSEQSK---EDETKETEGEESAEELVARAEREFYEMVEAEMKKREKDEKIEIDQVR 568          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 254/375 (67.73%), Postives = 308/375 (82.13%), Query Frame = 2
Query:  566 DMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVG 1690
            D NEVKRTAT +SW PDG  KLAVAY + EFQ    + S DSYIWD+   NKP++ LKPVSPLVC+EYNPKDSH L+GG YNGQ+A WD RKGSQP E+S +E+SHRDP +KVIW+QSKTGT+ FSASTDGQV WWD+RKM+EPTE ++LDP+KK  L++A GA +LE+E+T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GP+Y+LQRNPFFPKNFLTVGDWTARIWSEDIR+SSIMWTKY  + L+DG WSPVRP+VFFT KMDGTLDVWD +FKQ +PTL I+VCDE+L  +RVQ+ GR + CGS  GTTT+LE+S G  ++ +NEK L + +FERET+REKILEARHREL+LK +     E++G
Sbjct:    5 DPNEVKRTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNKPEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHSHRDPVYKVIWLQSKTGTDFFSASTDGQVLWWDIRKMSEPTERLVLDPSKKGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDIRESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFLFKQNDPTLSIKVCDEALYSMRVQDNGRFLGCGSELGTTTLLEISSGLCTLQRNEKALATAMFERETKREKILEARHRELRLKERSR--SERIG 377          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Match: WDR63 (WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:30711])

HSP 1 Score: 152.14 bits (383), Expect = 4.283e-38
Identity = 149/604 (24.67%), Postives = 255/604 (42.22%), Query Frame = 2
Query:   86 FTDYKMEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAP--DPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGW----PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIY----DNYFEGIDIEASEEPPSAKTINVFRDMNEVK-RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYI-------WDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWD------RRKGSQPTE-------------VSPVENSHRDPAWKVIWIQS--KTGTECFSASTDGQ---VFWWDVR--KMAEPTEIMILDPTKKQDLEKAQGA------YALEYESTI---------------PTKFMAG---TEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLR---VQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEK 1684
              D + ++ Y  ++ R E G   +F D   E  V+ +P  D S +   +E+     G+Q V   S     T           H    W    P+ ++ +E + ++  +          N + ++++ +E  I+QN  ++++     +  E + +   +     K    F D+N  K +T ++I+W P     +AVA           ++ST   +       W   +P  P L+L+    + C E+ P D + + GGC NGQ+ LWD      R +G++  E             VS +EN H+ P   + W+    +   E  S+S   +   V +WD+R  ++   ++I     T+++ L+   G         L ++  I                  F+ G        +   N  G+  + K    +  H G V  + R+PFF    L+VG W   IW E + +  I+ + Y     T G WS  RPAVFF  K DG L++WD++ K  EP+    +    + C++   +  + +L+A   H GT  ILE+       S  E N VS  FE+E  R    E R +E++ K K+E D E+
Sbjct:  154 LMDTRPKLCYKVSRLRRETGAPLHFSDYSTEC-VECSPYQDSSFSTRRMERA---SGVQAVPVTSSSSSQT--------VWKHKRNMWTQYQPRVLDEEEKENILLSKN-------LKNFLNSVTLRVEVAIQQNIIMNMFVDDWRDLAEEVPVLGGKANTQLKKYQSFTDLNHSKNKTISYINWHPAVSGVIAVAVRERLSYEERIDSSTKLLLNPALILFWSFSDPINPQLMLECPDDVFCFEFCPSDPNIIAGGCMNGQVVLWDISAHMERLQGARLFEDEVTDTPVVRYCAVSGIENGHKAPVTDIQWLPDTFEVSLELISSSVPVKTVCVMFWDLRAPRVVSQSQIDRKQKTEEKILDNPHGVPNTFKHLNLTWKPLIRVQTHIHTHTHTHKQTQTFLDGEIVYTDWKLEKDNESGRLFSPKPTHCFRVHDGLVNTVLRSPFFKDIILSVGLWNFAIWKEGVTNGPILQSPYSQKNCTLGFWSLTRPAVFFIGKEDGNLEIWDLLEKTHEPSQTHTITTAPITCIKPWVISVKQQLLAVSEHLGTLHILEVPRRLLHPSSKELN-VSMYFEKEVERLIYFEKR-QEMRAKEKREMDAEE 736          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 429.869 bits (1104), Expect = 9.607e-147
Identity = 215/336 (63.99%), Postives = 257/336 (76.49%), Query Frame = 2
Query:  818 LALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQ-VFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQ 1822
            +A WD RKG QP E + +E+SHRDP +KVIW QSKTGTE FS STDGQ V WWDVR+M EP E + LDP KK DL+ A GA  LE+E T+PTKFM GTEQG ++SCNRK KTPA+KI   Y GH GPVYALQR+PFFPKNFLT+GDWTARIWSE+IRDSSIMWTKYH+S LTDG WSPVRPAVFFTTKMDG+LDVWD++FKQ   TL +QV DE L+ LR+Q+ GR +ACGS +GT T+LELS G  S+ +NEK L++ +FERET+REKILEARHRE++LK +  G  E+ G    G E    E   +LV +AE DF+ AIE+ER     +E  R 
Sbjct:    1 VAYWDTRKGCQPVETTAIEHSHRDPVYKVIWQQSKTGTEFFSCSTDGQHVLWWDVRRMTEPMERLALDPAKKGDLDNAMGATCLEFEPTMPTKFMVGTEQGMVVSCNRKAKTPAEKIVGTYSGHHGPVYALQRHPFFPKNFLTIGDWTARIWSEEIRDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDLLFKQNNATLTLQVSDEPLHSLRIQDNGRFLACGSQNGTATLLELSSGLSSLQRNEKALITAMFERETKREKILEARHREMRLKER--GRSEQ-GRDDEGRESQAEESRHDLVARAERDFYQAIEEERSRHAAKESRRH 333          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 119.013 bits (297), Expect = 2.515e-28
Identity = 97/402 (24.13%), Postives = 181/402 (45.02%), Query Frame = 2
Query:  389 RKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNE----VKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVENS-HRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSSIMWT-KYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV--CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            +++V   + + N     S +ME  + ++   DI+ +Y    + E   E  +   +++ R   +     +R  T + W    P  L   Y N E   SP      + +W+       P+ V    S ++   +     + ++GG Y+GQ+ LWD R     P + +P+  + H  P + V  + ++      S STDG++  W +  +++P + M L    KQ   K+     + +       F+ G+E+GS+ +  R G      I+ ++ GH GPV  +  +       F   FLT   DWT ++W+   +++  +++ + +   + D MWSPV P++F +    G LD+W++    + P   + +  C  +LN +R    GR +A G   G   I E+ E
Sbjct:  176 KEQVLHSDDFLNFFDRTSRIMERALAEHQ--DIFFDYSGRDNEEIDGEVLAGAKLSLNRQFYDERWSKRRVITSLDWSAQYPELLVATYNNNE--DSPHEPDGVALVWNTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWDNRSNRMTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISVSTDGRMCSWSLDMLSQPQDSMEL--VHKQ--SKSIAVTCMTFPVGDVNNFVVGSEEGSVYTACRHGSKAG--ISEVFEGHQGPVTGIHSHSAAGPIDFSHLFLTSSFDWTIKLWT--TKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNLNSDTEVPAASVTIDGC-PALNRVRWTHSGRELAVGDSEGHLWIYEIGE 564          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004773.1 (pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 gene:ENSPMAG00000004320.1 transcript:ENSPMAT00000004773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 3.523e-24
Identity = 101/437 (23.11%), Postives = 178/437 (40.73%), Query Frame = 2
Query:  446 VMEHCIKQNNALDIYDN--YFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRK--GSQPTEVSPVENS-HRDPAWKVIWIQSKTGTEC--FSASTDGQVFWWDVRKMAEPTEIMILDPTKKQ-------------DLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTV-GDWTARIWSEDIRDSSIMWTKYHL-SALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDE---SLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGE 1681
            ++E  + QN   DI  +  YFE    E  E+  +   +  F+     + T T + W P       V + + EFQ           ++ + NP+ P+ V    S ++ ++ +    H +  G Y+G +A+++      +QP+  S   +  H DP W+V W +         FS S+DG+V  W + K     E++ +D  K                LE      + ++   I   F+ GTE G+I+ C+   K  + +    Y  H   V A++ NPF  + F +   DW+ +IW    + + +    + L +A+ D  W+P    VF     DG + V+D+   + E      V  +    L  +       ++  G   G  + L+LS     + K +K        +E  R    E    E  L + +E DG+
Sbjct:  104 IIERMVNQNTFDDIAQDFRYFEDASDEYREQDGTLLPLWRFQCEQARRLTVTALCWNPCYHDLFVVGFGSYEFQKQGRGALV---VFTLKNPSFPEFVFATESGVMGVDVHDARPHLVAAGLYDGTVAVYNLAAPVDAQPSHRSSARSGKHTDPVWQVKWQRDDLDNNLNFFSVSSDGRVASWTLIK----NELLCMDVVKLSVEEGQAAPLGEDPALETLSSGTSFDFHRQIDHMFLVGTEDGTILKCS---KAYSSQFLDTYDAHHMAVEAVRWNPFHTRVFASCSADWSLKIWEHTAKWAPVF--TFDLGAAVGDVAWAPYSSTVFAAVTADGKVHVFDVNVNKYEALCTQSVSTKKHTKLTHVAFNPSQPVLIVGDDRGVVSSLKLSPNLRRVPKEKKG-------QEAARGPEAETAKLERLLALIREPDGK 521          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 89.3521 bits (220), Expect = 5.876e-19
Identity = 84/321 (26.17%), Postives = 142/321 (44.24%), Query Frame = 2
Query:  695 IWDV----MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENS--HRDPAWKVIWIQSKTGTECF---SASTDGQVFWWDV----RKMAEPTEIMILD---PTKKQDLEKAQG-------AYALEYESTIPTKFMAGTEQGSIMSC--------NRKGKTPAD-KIAAIYP--GHLGPVYALQRNPFFPKNF-LTVG-DWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCD--ESLNCLRVQ-EQGRLIACGSHSGTTTILEL 1540
            +W+V    + P+ PD  L     L+C+ ++P     + GG  +G++ +WD  +   P       N+  H+ P  +V W+ S   +      SA  DG V  W V    RK+     +++L    P+     +K Q        A++L  +S++    +AG E G ++ C         RK + P + K  A++P   H GPVYA+  +PF  +   +  G D   R++S  + D  ++  +   S +    WSP RP V   +  +G L ++D+  K   P   IQ       ++CL    +Q  L+A G  SG   +  L
Sbjct:  170 LWNVCRRGLIPDMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDTSQEEDPLLAHSGVNATTHQQPVTQVQWVHSPGQSRVLLLMSAGLDGCVMTWRVELSTRKITPNNRVVLLAKHLPSTSTLSKKVQSELPLGITAFSLSEDSSM---CVAGLEGGQVVRCLLEPLEQPTRKDQPPLNRKSPALFPFVKHQGPVYAVNFSPFNRRGVSVQAGTDGQVRVFSALLHD-PVLVVRAATSYVLAAAWSPARPLVLAASTAEGELLLFDLAIKDSGPVHCIQASPSLSPVSCLAFNPKQPGLLAVGLQSGAARVWTL 486          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000105.1 (pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 gene:ENSPMAG00000000091.1 transcript:ENSPMAT00000000105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.984e-12
Identity = 61/249 (24.50%), Postives = 104/249 (41.77%), Query Frame = 2
Query:  881 HRDPAWKVIWIQSKTGT-------ECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQG------------------AYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTV-GDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRV---QEQGRLIACGSHSGTTTILEL 1540
            H    W+V W++ + G           S S DG+V  W VRK  +  ++M L  T +    +  G                     +++       ++AGTE+G I  C+    + +++    Y  H GPVY +  +PF P+ FL+   DW+ R+W  D+  S ++  +    A+ D  WSP  P +      +  L VWD+     +P L +      ++  RV   +  G  +  G   G  T+ +L
Sbjct:    2 HMGAVWQVQWVRLEQGGGGEDRGETLTSISADGRVTRWAVRKGLDCQDLMRLKRTGEGRTRRTAGVEGQRERKNEALIWRLACGTCVDFHPQDSNVYLAGTEEGFIHRCS---CSYSEQHLQSYSAHQGPVYRVLWSPFEPEVFLSCSSDWSVRLWRVDL-TSPVLTLQCGSQAVLDVAWSPHSPTLLAALTAE-ALHVWDLSSSTLDPVL-VSPGRRGVHMTRVAFSRAPGHCLLVGDSDGHVTLYQL 244          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Yeast
Match: SIF2 (WD40 repeat-containing subunit of Set3C histone deacetylase complex; complex represses early/middle sporulation genes; antagonizes telomeric silencing; binds specifically to the Sir4p N-terminus [Source:SGD;Acc:S000000307])

HSP 1 Score: 53.5286 bits (127), Expect = 7.321e-8
Identity = 60/273 (21.98%), Postives = 106/273 (38.83%), Query Frame = 2
Query:  737 KPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDL----EKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDES-LNCLRVQEQGRLIACGSHSGTTTILEL 1540
            K  + + C+ ++  D ++++ G  NG+L LW++        +  V N HR P   V W  +K GT   S   +     W+V       +   L  T    +        G+  ++ E     KF+    +G+I       KTP  K+     GH GP+  L+ N           D T RIW     +S   +   H  ++    W  V      +  MDG++ +W +   ++   L + + D   +   R+ + G+  A     G   + +L
Sbjct:  218 KTTNQVTCLAWS-HDGNSIVTGVENGELRLWNKTGA-----LLNVLNFHRAPIVSVKW--NKDGTHIISMDVENVTILWNVIS-GTVMQHFELKETGGSSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLI----GHHGPISVLEFNDTNKLLLSASDDGTLRIWHGGNGNSQNCFYG-HSQSIVSASW--VGDDKVISCSMDGSVRLWSL---KQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDL 471          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 391/606 (64.52%), Postives = 467/606 (77.06%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA 1918
            MEIVYVYTKKRSEFGRQCNF DR AELHVDIAPD  + +++IEKNP D GIQCVQEMSEHEVNTER+ET+ RGINH EGGWPKDVN  E +Q IRYRKKVEKDE Y NTIQ L  VMEHCIKQNNA+DIY++YF  ++ + S E PSAKTINVFRD N +KRTAT ISW+PDG  KLAVAY   EFQ S  +   DSYIWD+ NP KPD+VLKPVSPL+C+EYNPKD H LIGGCYNGQL  WD RKGS P E++P+E SHRDP +K I++QSK+GT+CFS STDGQV WWD+RK+ EPTE ++L P KK    +  G  +LE+E T+PTKFM GTEQGS++SCNRK KTPADKI A Y GH GPVY++QRNPFFPKNFLT+GDW ARIWSED+R+SSIMWTK  +S LTDG WSP RP VFFTTKMDGTLDVWD +FKQ  PTL IQVCD SLN LRVQ+ GRL+ACGSH GT T+LELSEG  +M +NEK  ++  FERET+REKILE RHRE++LK + +   +K        E+ E + EE+++ KAE+DFF  +E E+K R + E    +  A  ++   A   D +  E+ + D  +++A
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFSDRQAELHVDIAPDEKMLQDYIEKNPCDTGIQCVQEMSEHEVNTERFETDVRGINHVEGGWPKDVNPAEVEQTIRYRKKVEKDEIYMNTIQQLGNVMEHCIKQNNAIDIYEDYFPDLEEDQSCETPSAKTINVFRDENNIKRTATSISWYPDGTQKLAVAYSVLEFQKST-DICMDSYIWDIDNPTKPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWDTRKGSHPVEMTPIEKSHRDPIYKTIFLQSKSGTDCFSTSTDGQVLWWDIRKLGEPTESLLLCPNKKD--PRPLGGVSLEFEPTMPTKFMVGTEQGSVLSCNRKAKTPADKIVASYAGHYGPVYSVQRNPFFPKNFLTIGDWQARIWSEDLRESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWDCMFKQNCPTLSIQVCDMSLNSLRVQDHGRLVACGSHDGTVTLLELSEGLHTMQRNEKASINATFERETKREKILETRHREMRLKERSKSSQDKD-----HEEKPEEDDEEDMIEKAEKDFFSIVEAEKKARLETE---AKKMAALNDVKQALAQDGVTHEEYKDDSGDQDA 595          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Match: EDO29743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2S2])

HSP 1 Score: 130.183 bits (326), Expect = 8.170e-32
Identity = 101/381 (26.51%), Postives = 171/381 (44.88%), Query Frame = 2
Query:  389 RKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDI-YDNYFEGIDIEASEEPPSAKTINVFRDMNEV----KRTATHISWFPDGPTKLAVAYCNTEF--------QSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRK-------GKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCL 1471
            ++K+ K   + N +  ++   E  ++QN  +++ YD+Y    D E +    S   +  ++   ++    ++T T I W P     + V+ C             S    T++   IW   +P  P ++L+    +   ++NP D + + GGC NGQ  +  R+ G+   E  P         + +   QSKT  +  + S D           A+ T +  L     +   K QG   LE    + TKF+ GTE+G ++  + +       GK    +   ++  H GP+  LQ +PFF    LTVG WT  IW E +    ++ +  H+  LT G WSP RP VFF  K DG +DVWD++ +  EP+L   +   ++  +
Sbjct:  184 KEKINKSLMFKNFVNKVTPRFELALQQNEIMNVFYDDYESMADDETTFGAKSDNYLKEYQSFTDLLYSKEKTITSIEWHPSIKGIIGVS-CGERLLFDERIDQSSRILMTASLVLIWSFSDPIHPLVLLQAPDEIHSFKFNPSDPNIIAGGCINGQTTV-QRQTGT--GEFGP-------KVFSIFEKQSKTKGKPSNESAD-----------ADNTGVSRLPSNVAKG--KDQGK-PLE---NVSTKFLVGTEEGDLVYLDWRPEKDTDSGKIMTPRPEHVWAAHDGPINTLQVSPFFKDIILTVGGWTFAIWKEGVNSDPLLLSSSHIVKLTKGHWSPSRPGVFFIAKADGMVDVWDLLDRSHEPSLTQNITAATITTI 536          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 117.087 bits (292), Expect = 2.977e-27
Identity = 95/353 (26.91%), Postives = 163/353 (46.18%), Query Frame = 2
Query:  446 VMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFR-DMNEVKRTA-THISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWD-RRKGSQPTEVSPVENS-HRDPAWKVIWIQSKTGTEC--FSASTDGQVFWWDVRKM-AEPTEIMILD-PTKKQDLEKAQ-----GAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTV-GDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESL 1462
            ++E  + QN   DI  ++    D       P    + +++    + KR A T + W P      +VA+ + +F       +     + + NP+ P+  +K  S ++C++ +P+  H L  G Y+G +A++    K ++P   S  +   H DP W+V W +         FS S+DG+V  W + K     T+I+ L+ P K +  E  Q        + ++  TI   F+ GTE+G I  C+   KT        +  H   VY+++ NPF PK F++   DWT +IW  D      M+T    S++ D  W+P    VF     DG + V+D+   + EP     +C++S+
Sbjct:  253 IVERMVNQNTYDDIAQDFKYWEDPSDEFREPDGTLLPLWKFSWEKSKRLAVTSLCWNPIYNDLFSVAHGSYDFLKQDGGGAMS--FFSLKNPSYPEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEKMNKPLHQSTAKTGKHTDPVWQVKWQKDDLDNNLNFFSVSSDGRVVQWTIVKSELSHTDIINLELPEKSEGPEGTQIKSLGCGTSFDFHKTINYLFLVGTEEGKIHKCS---KTYTSTYLDTFDAHHMSVYSVRWNPFHPKTFISCSADWTVKIW--DHTHLEPMFTFDLNSSVGDVQWAPYASTVFAACTADGKIHVYDLNVNKYEP-----LCEQSV 593          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 114.39 bits (285), Expect = 7.552e-27
Identity = 95/374 (25.40%), Postives = 170/374 (45.45%), Query Frame = 2
Query:  479 LDIYDNY--FEGIDIEASEEPPSAKTINVFRDMNEVK----RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVE-NSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSSIMWTKYHLSA--LTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV-CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            LDI  +Y   EG D+E   +  +A+ + + RD  + +    RT T + W    P  L  +Y N E   +P      + IW++      P+ +    S ++   +     + +IGG Y+GQ+ LWD R   + P + +P+   +H  P + V  + ++      S STDG++  W +  +++P + M L    KQ   K+     + + +     F+ G+E+G++ +  R G      I+ ++ GH GPV  +  +       F   FLT   DWT ++WS     S   +  +  +   + D  WSP+ PA+F T    G LD+W++    + P          +LN ++  + G+ I+ G   G   I ++ E
Sbjct:   94 LDITIDYSGAEGDDLEGGSQ--AARELTLSRDFYDERWSRHRTVTCLDWSNQYPELLVASYNNNE--DAPHEPDGVALIWNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWDNRSSKRTPVQRTPLSATAHTHPVYCVNVVGTQNAHNLISVSTDGKMCSWSLDMLSQPQDSMELQ--YKQ--SKSVAVTCMSFLAGDVNNFVVGSEEGTVYTACRHGSKAG--ISDVFEGHYGPVTGIDTHSASGPIDFSHLFLTSSFDWTLKLWS---HKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRLDLWNLNSDTEVPIASTATESLTALNNVQWTQSGQQISVGDDDGRVYIYDVGE 454          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 107.071 bits (266), Expect = 1.647e-24
Identity = 103/409 (25.18%), Postives = 177/409 (43.28%), Query Frame = 2
Query:  500 FEGIDIEASEEPPSAKTINVFRDMNEV---KRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV----MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSP--VENSHRDPAWKVIWI----QSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDP-------------TKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTP-----------ADKIAAIYPGHLGPVYALQRNPFFPKNFLTVG-DWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDES-LNCLRVQEQGR-LIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERE 1606
            F+G D++  EE  SA T    R +N+    +   T +SW   G + +A AY   + +    + S+    W++    +N NK D  +   S L+ + ++PK    + GG +NG++ LWD     +    S     +SHR+P  K++W+          +  SAS DG+V  W V  + E  ++ ++               T K   +   G   L +     T F+ G+E G I  C+   + P              +   +  H+GPV+++  +P+    FLT G D T R+++  ++   ++  +     L    WSPVRP VF     DG L ++D+      P   I V D+  ++ L      R L+A G   G   I  LS+   +    E  ++++I E +
Sbjct:   93 FDGYDVDW-EEKSSAVTCQ-HRLINQASGNQLQITSLSWNSTG-SVIAAAYGRLDHEDWCTHKSSLC-TWNLDRRGINVNKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDLSCEDEMLVASSGMGNDSHREPVNKIMWLLDPDSKGKKYQILSASGDGKVLLWQVPPI-ESQDLRLVGGYILQTGAVPRSLRTSKAKGDMEMGVTTLSFSHEDKTLFVLGSEAGGIFKCSVNSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTM-LQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPVTTIDVSDKKPVHTLEYNIHRRQLVATGDSEGVIKIWRLSDELTTQGPRETEILTDIAETQ 495          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 316/569 (55.54%), Postives = 403/569 (70.83%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEA-SEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREK 1804
            MEIV V  K+RSEF R   F D   +  VD++PD S +E  I K   D+ +Q  QEMSEHE NT   E  + G+NH EGGWPKD++ +  +Q IR+RKK  K+EAY ++I  L  VME CI+QNNA+D Y+ YFE  + E  +   P AKT+NV RD ++VKRT T +SW PD   KLA AY +  FQ +    STDSYIWDV  P+ P++VLKP SPLVC+EYNP+ S+TL+GGCYNGQ+A WD R+G Q    S VE+SH+DP +KVIW+QSKTGT+ FSASTDGQV WWDVRK++EPTE +ILD +K+ +L +A G  +LE+E T+PTKFM GTE+G I+SCNRK KTPA+KI   Y GH G VYA+QRNPF PKNFLTVGDW ARIWSEDI++SSI+ TK  +S L D  WSPVRP+VFFT KM+G LD+WDI+F Q +PTL ++VCD  L  +RV+E GRL+ACGS  G  T+LE+S G     KNEK+LV+ +FERET+REKIL  R RE++LK +   +  +         E   E  + L+ +AE+DF+  +E E K R K
Sbjct:    1 MEIVNVLMKRRSEFNRLRGFVDSDFKKLVDMSPDQSTSEQPIHK---DQSVQAGQEMSEHETNTVGLEFISHGMNHVEGGWPKDIDHENMEQTIRFRKKAGKNEAYISSILQLGSVMELCIRQNNAIDKYEQYFEDEEEEEENHNAPYAKTMNVLRDPHQVKRTVTSLSWSPDRGRKLAAAYSSVVFQQTS-QLSTDSYIWDVEKPSIPEMVLKPPSPLVCLEYNPRVSYTLMGGCYNGQVAYWDTRRGCQTVAYSSVEHSHKDPVYKVIWLQSKTGTDAFSASTDGQVLWWDVRKLSEPTERLILDLSKEGNLGRALGGISLEFEITMPTKFMVGTEEGLIISCNRKAKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVGDWCARIWSEDIKESSIINTKNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDPTLSVKVCDGGLYSIRVEENGRLVACGSEKGEATLLEISSGLSVPQKNEKSLVAAMFERETKREKILMGRQREIRLKERCRSEQSR---EEEVVREDGEESPQELLARAEKDFYSMVEVELKRRRK 562          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 291/569 (51.14%), Postives = 375/569 (65.91%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF-EGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREK 1804
            MEIV V  K+RSEF R   F D   +  VD++PD S +E  I K   D+ +Q  QEMSEHE NT   E  + G+NH EGGWPKD++ +  +Q IR+RKK  K+EAY ++I  L  VME CI+QNNA+D Y+ YF +  + E +   P AKT+NV RD ++VKRT T +SW PD   KLA AY +  FQ +    STDSYIWD         + + +   VC+ Y                   WD R+G Q    S VE+SH+DP +KVIW+QSKTGT+ FSASTDGQV WWDVRK++EPTE +ILD +K+ +L +A G  +LE+E T+PTKFM GTE+G I+SCNRK KTPA+KI   Y GH G VYA+QRNPF PKNFLTVGDW ARIWSEDI++SSI+ TK  +S L D  WSPVRP+VFFT KM+G LD+WDI+F Q +PTL ++VCD  L  +RV+E GRL+ACGS  G  T+LE+S G     KNEK+LV+ +FERET+REKIL  R RE++LK +   +  +         E   E  + L+ +AE+DF+  +E E K R K
Sbjct:    1 MEIVNVLMKRRSEFNRLRGFVDSDFKKLVDMSPDQSTSEQPIHK---DQSVQAGQEMSEHETNTVGLEFISHGMNHVEGGWPKDIDHENMEQTIRFRKKAGKNEAYISSILQLGSVMELCIRQNNAIDKYEQYFEDEEEEEENHNAPYAKTMNVLRDPHQVKRTVTSLSWSPDRGRKLAAAYSSVVFQQT-SQLSTDSYIWDGC------CIFQKMK--VCVSY-------------------WDTRRGCQTVAYSSVEHSHKDPVYKVIWLQSKTGTDAFSASTDGQVLWWDVRKLSEPTERLILDLSKEGNLGRALGGISLEFEITMPTKFMVGTEEGLIISCNRKAKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVGDWCARIWSEDIKESSIINTKNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDPTLSVKVCDGGLYSIRVEENGRLVACGSEKGEATLLEISSGLSVPQKNEKSLVAAMFERETKREKILMGRQREIRLKERCRSEQSR---EEEVVREDGEESPQELLARAEKDFYSMVEVELKRRRK 535          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Match: dnai2b (dynein axonemal intermediate 2b [Source:NCBI gene;Acc:100500717])

HSP 1 Score: 417.542 bits (1072), Expect = 5.448e-139
Identity = 203/459 (44.23%), Postives = 288/459 (62.75%), Query Frame = 2
Query:  254 QCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGI-DIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKIL 1627
            Q   E+SE +VNT++ E  + GINH EGGWPK+++ Q  +   R+RK+ E++++Y N+I  L  + EH  +QNNA++IY+ YFE   D+  S EPP  KT+ VF D   ++R A  +SW    P K A A+ + +F         DSY+WD+   + P +VLKP S L+C+EYNP D   L+GGCYNG++  WD R+   P   SP ++SH+DP  KV W+Q K   E  S STDGQV WWD+RKM+EPTE +ILD   ++      GA +L     + TK M GT+ G ++SC++ GKTPA+KI +IY  + GPVYA+Q+NPFFP NFLT GD  A +WS+ I  S IM  +  +  LT   WSP RP+VFFT  MDG LD+WDI+FKQ    L ++VC+  L  + V ++G L+ CGS +G   +L++  G  +   NE +LV+ + E   +++  L
Sbjct:   11 QTCPEISEQQVNTDQTELRSCGINHVEGGWPKEIDLQNLEHTSRFRKRKEREDSYINSITQLGSITEHSFRQNNAVEIYEKYFEDEEDMNESHEPPLTKTMTVFSDPTHLQRAARGLSWSTSEPMKFAAAFASNKFPLLS-EMCKDSYVWDIEKSSSPLMVLKPSSSLLCLEYNPNDPACLVGGCYNGRIVYWDTRESCWPVGSSPEDHSHKDPVSKVSWLQLKGKKEAISTSTDGQVLWWDIRKMSEPTERLILDLGGERTC--PVGAISLGLNHIMNTKIMLGTQHGLVISCDKNGKTPAEKIVSIYKTNKGPVYAVQKNPFFPGNFLTAGDKHACLWSDIITRSPIMAFRNGMQNLTGACWSPFRPSVFFTLNMDGVLDIWDILFKQTSSALSVKVCNSVLCSISVPDKGPLMTCGSTNGEVMLLKVWPGLLTPRNNEISLVTALIENGEKQQGPL 466          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:101160367])

HSP 1 Score: 130.183 bits (326), Expect = 3.446e-31
Identity = 109/416 (26.20%), Postives = 191/416 (45.91%), Query Frame = 2
Query:  344 PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF-EGIDIEASEEPPSAKTINVFRDMNE---VKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVENS-HRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSI-MSCNRKGKTPADKIAAIYPGHLGPVYALQ----RNPF-FPKNFLTVG-DWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV-CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            P ++  +E  Q++         E +TN   + + ++E  + ++  +DI+ +Y  +G+D + SE    AK     + M+E     R  T + W P  P  L  +Y N E   +P      + +W++      P+ V    S ++   +     + ++GG Y+GQ+ LWD R   + P + +P+  + H  P + V  + ++      S STDG++  W +  +++P + M L    KQ   KA    ++ +       F+ G+E GS+ MSC    K     I+ ++ GH GP+  +       P  F   F+T   DWT ++WS    +  +   + +   + D MWSP  PA+F      G LD+W++    + PT  + V  + +LN LR    GR IA G   G   + E+ E
Sbjct:  173 PHELTEEEKLQILH-------SEEFTNFFDHSTRIIERALSEH--VDIFFDYVGQGLDEKESEIQAGAKLSLNRQFMDERWSKHRVVTCLDWSPQYPELLVASYNNNE--EAPHEPDGVALVWNMKYKKTTPEFVFHCQSAVMSAAFAKFHPNVVVGGTYSGQIVLWDSRINKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSQPQDSMEL--VFKQS--KAVAVTSMSFPLGDVNNFVVGSEDGSVYMSCRHGSKA---GISEMFEGHHGPITGIHCHTAAGPLDFSHLFVTSSFDWTVKLWSTK-NNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGHLDLWNLNNDTEVPTASVVVDGNPALNKLRWGHSGREIAVGDSDGRVLVYEVGE 569          
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Match: dync1i2a (dynein cytoplasmic 1 intermediate chain 2 [Source:NCBI gene;Acc:101160367])

HSP 1 Score: 129.413 bits (324), Expect = 5.945e-31
Identity = 109/417 (26.14%), Postives = 195/417 (46.76%), Query Frame = 2
Query:  344 PKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF-EGIDIEASEEPPSAKTINVFRDMNE---VKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVENS-HRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSI-MSCNRKGKTPADKIAAIYPGHLGPVYALQ----RNPF-FPKNFLTVG-DWTARIWSEDIRDSSIMWT-KYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQV-CDESLNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            P ++  +E  Q++         E +TN   + + ++E  + ++  +DI+ +Y  +G+D + SE    AK     + M+E     R  T + W P  P  L  +Y N E   +P      + +W++      P+ V    S ++   +     + ++GG Y+GQ+ LWD R   + P + +P+  + H  P + V  + ++      S STDG++  W +  +++P + M L    KQ   KA    ++ +       F+ G+E GS+ MSC    K     I+ ++ GH GP+  +       P  F   F+T   DWT ++WS   +++  +++ + +   + D MWSP  PA+F      G LD+W++    + PT  + V  + +LN LR    GR IA G   G   + E+ E
Sbjct:  203 PHELTEEEKLQILH-------SEEFTNFFDHSTRIIERALSEH--VDIFFDYVGQGLDEKESEIQAGAKLSLNRQFMDERWSKHRVVTCLDWSPQYPELLVASYNNNE--EAPHEPDGVALVWNMKYKKTTPEFVFHCQSAVMSAAFAKFHPNVVVGGTYSGQIVLWDSRINKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSQPQDSMEL--VFKQ--SKAVAVTSMSFPLGDVNNFVVGSEDGSVYMSCRHGSKA---GISEMFEGHHGPITGIHCHTAAGPLDFSHLFVTSSFDWTVKLWS--TKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGHLDLWNLNNDTEVPTASVVVDGNPALNKLRWGHSGREIAVGDSDGRVLVYEVGE 599          
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Match: SMESG000075110.1 (SMESG000075110.1)

HSP 1 Score: 1240.71 bits (3209), Expect = 0.000e+0
Identity = 606/606 (100.00%), Postives = 606/606 (100.00%), Query Frame = 2
Query:  101 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSXXXXXXXXXXXXXNLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA 1918
            MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSAGGAEEAEAEQEENLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA
Sbjct:    1 MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRGIQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERETRREKILEARHRELKLKMKKEGDGEKVGPSAGGAEEAEAEQEENLVVKAEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETDKNEKEA 606          
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Match: SMESG000024276.1 (SMESG000024276.1)

HSP 1 Score: 127.102 bits (318), Expect = 2.284e-30
Identity = 121/439 (27.56%), Postives = 197/439 (44.87%), Query Frame = 2
Query:  332 EGGWPKDVNSQEADQVI-RYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF-EGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAY-CNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLV--CI-EYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVEN-SHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSS---IMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCD-ESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSN 1591
            E  + K+VN  +++ +    R  +   E +       + +ME  + +  A+DI  +Y  E  +I+   +    K    F D     R  T + W P  P  L  AY CN E    P        IW++    + P+ VL   SPLV  C+  Y+P     ++GG Y+GQ+ LWD R   + P + +P+   SH  P   +  + ++      S S+DG++  W +  +  P+E    + + KQ   K+     +++ S     F+ G+E G +    R G      ++  + GHLGP+  L  +       F   FLT   DWT ++WS   RDS    +   + +   + D  WSPV PAVF +    G LDVW +    + P  R QV    +LN     + G  IA G  SG  +I++++E  +  S +  N +S+
Sbjct:  154 EDEFEKEVNRIKSNMLTDEERSNIILSENFKTFFDRSARIMERAVCEE-AVDILTDYVGEETEIKQDRKTLVKKNREFFDDHWSKHRVVTCLDWSPMYPELLLGAYHCNDEAPHEPDGVC---LIWNLKYKKDSPEYVLHCQSPLVSACMPNYHPS---LVVGGTYSGQIVLWDIRTNKRTPIQRTPLNAASHTHPVCALTVLGTQNAHNLISVSSDGKMCAWSLEMLNAPSETR--EFSGKQ--AKSIAVTCMDFLSNDVNNFLVGSEDGMVYPGIRHGVKAG--LSEGFEGHLGPISGLSSHKVPGAVDFSHLFLTSSFDWTVKLWSG--RDSGSRPLHSFEDNGDYVYDVAWSPVHPAVFASVDGQGLLDVWKLTADTEVPFSRTQVNPLTALNKCSWHKTGAHIAVGDDSGHISIMDVNEQLFQPSSSSWNELSH 577          
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Match: SMESG000024276.1 (SMESG000024276.1)

HSP 1 Score: 127.102 bits (318), Expect = 2.286e-30
Identity = 121/439 (27.56%), Postives = 197/439 (44.87%), Query Frame = 2
Query:  332 EGGWPKDVNSQEADQVI-RYRKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYF-EGIDIEASEEPPSAKTINVFRDMNEVKRTATHISWFPDGPTKLAVAY-CNTEFQSSPPNTSTDSYIWDV-MNPNKPDLVLKPVSPLV--CI-EYNPKDSHTLIGGCYNGQLALWDRRKGSQ-PTEVSPVEN-SHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPF-----FPKNFLTVG-DWTARIWSEDIRDSS---IMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCD-ESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSN 1591
            E  + K+VN  +++ +    R  +   E +       + +ME  + +  A+DI  +Y  E  +I+   +    K    F D     R  T + W P  P  L  AY CN E    P        IW++    + P+ VL   SPLV  C+  Y+P     ++GG Y+GQ+ LWD R   + P + +P+   SH  P   +  + ++      S S+DG++  W +  +  P+E    + + KQ   K+     +++ S     F+ G+E G +    R G      ++  + GHLGP+  L  +       F   FLT   DWT ++WS   RDS    +   + +   + D  WSPV PAVF +    G LDVW +    + P  R QV    +LN     + G  IA G  SG  +I++++E  +  S +  N +S+
Sbjct:  161 EDEFEKEVNRIKSNMLTDEERSNIILSENFKTFFDRSARIMERAVCEE-AVDILTDYVGEETEIKQDRKTLVKKNREFFDDHWSKHRVVTCLDWSPMYPELLLGAYHCNDEAPHEPDGVC---LIWNLKYKKDSPEYVLHCQSPLVSACMPNYHPS---LVVGGTYSGQIVLWDIRTNKRTPIQRTPLNAASHTHPVCALTVLGTQNAHNLISVSSDGKMCAWSLEMLNAPSETR--EFSGKQ--AKSIAVTCMDFLSNDVNNFLVGSEDGMVYPGIRHGVKAG--LSEGFEGHLGPISGLSSHKVPGAVDFSHLFLTSSFDWTVKLWSG--RDSGSRPLHSFEDNGDYVYDVAWSPVHPAVFASVDGQGLLDVWKLTADTEVPFSRTQVNPLTALNKCSWHKTGAHIAVGDDSGHISIMDVNEQLFQPSSSSWNELSH 584          
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Match: SMESG000042025.1 (SMESG000042025.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.276e-27
Identity = 128/519 (24.66%), Postives = 193/519 (37.19%), Query Frame = 2
Query:  449 MEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVKRTA-THISWFPDGPTKLAVAYC-NTEFQSSPPNTS----TDSYI--WDVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRR---------KGSQ-------------------PT----EVSPVENSHRDPAWKVIWI---------------QSKTGTECFSASTDGQVFWWDVR--------------KMAEPTEI--------MILDPTKKQDLEKA--QGAYALEYESTIPTKFMAGTEQG--SIMSC------------NRKGKTPADKIAA----IYPG---------------------------------HLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDES-LNCLRVQE--QGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFERE 1606
            ++H    N  +D Y     G  +  ++     K    F D+   K  A T I W P     +A +    T F     N S    T SYI  W  ++P +P ++L+  S L C ++NP D H + GGC +GQ+ LWD           KG                     PT     +S  E+SH  P   + W+                +    +  +A+ D ++ +WD+R              ++A P  +        M   PT +  L K    G +A       PTKF     QG   ++ C             + G   A  + A    IY G                                 H GPV A+ R PF     L VG W   +W E +    I+ +      LTDG WSP R +VF  T+ DG +++WDI+ K  EPTL   +   S L  + +    + +L+A G  +G   + E+   F   S++E N     F++E
Sbjct:  380 VQHNEIANYFIDDYSTLASGDTVFDNKTDNDLKEFQTFADLKFGKEKAVTCIEWHPTIKGIIATSMAEKTSFDQRIDNLSKVILTKSYIILWSFLDPIQPQILLEAPSDLYCFKFNPTDPHIVAGGCISGQVILWDMETHMEDLKNVKGKMKSRNVMPLFSFEEDNEPKIPTMRHAAISHCESSHASPIIDLKWLPDHYEINNLGYSLENLTAKSIQIATAAGDNKILFWDIRPNKAVTAPADKSSQQIATPAGVPETFKYLDMKWKPTLRVHLYKVGPGGDHA-------PTKFSLKEVQGDRKVLECLEEKEKVDEQIITKPGAQKARTLQALNTHIYVGTEDGELVYVDWMPQKDSDSGKLQTTKPEHYWNVHDGPVTAVTRCPFDRTIILVVGGWVWSLWKEGVHSGPILQSCTSPKPLTDGAWSPTRSSVFLITRADGCVEIWDIIDKTHEPTLVQNISSTSALTTISIYNFVKKQLVAFGDINGGLHVYEIPVRFKQHSQSELNDTMKYFDKE 891          
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Match: SMESG000045332.1 (SMESG000045332.1)

HSP 1 Score: 117.087 bits (292), Expect = 4.238e-27
Identity = 96/405 (23.70%), Postives = 190/405 (46.91%), Query Frame = 2
Query:  389 RKKVEKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKTINVFRDMNEVK----RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNP-NKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWD----RRKGSQPTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKTPADKIAAIYPGHLGPVYALQRNPFFPKN------FLTVG-DWTARIWS-EDIRDSSIMWTKYHLS-ALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVCDES-LNCLRVQEQGRLIACGSHSGTTTILELSE 1546
            ++++   + +    ++ +V+ME  ++ N  +DI+ +Y  GI  +      S K +++ R   + +    R  T ++W P     L  +Y + E  S  P+      +W+V +  N P+ VL   SP++   +    +  ++GG Y+GQ+ +WD    +R   Q T +S   ++H  P   +  + +       S STDG++  W +  +++P E   L  TK +++        +E+      KF+ G E G++   +R G  P + +      H GP+ ++    +   +      FLT   D++ ++WS  +   S++++T    S  + D  WSP+ PAVF      G L+VW+ +   +EP  ++ +  +S +N  +  + G  +A G   G   + E++E
Sbjct:  173 KEEILLSDHFMEFFEHATVLMEETLQNN--VDIFTDY-SGIYGDDKSLLNSKKILDLNRVFFDERWSWNRVVTGLNWSPHYSEHLLASYFSNEAVSHEPDGVC--LVWNVKSKLNSPENVLHYQSPIIAAMFAKHHNSLIVGGTYSGQIVIWDIRSNKRTPVQRTLLSATAHTH--PVSSLSTVGTHNAHSLLSLSTDGKMCTWRMEMLSQPIESFQLSNTKSKEITST----CMEFLQN-DNKFVVGGEDGNVYLASRIGSKPGECLTVEGASHDGPIMSVSTQKYSSPDHDCKDLFLTSSVDYSVKLWSNSESYSSNLIFTLDDRSDYVYDVDWSPIHPAVFCCVDGSGKLEVWNFLRSIEEPIAKVTIDSQSAINRCKWHDSGFSLATGDDIGRIRLHEINE 565          
The following BLAST results are available for this feature:
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAI20.000e+066.43dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI20.000e+066.43dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI20.000e+066.43dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI20.000e+064.69dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI23.355e-5170.18dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dyci-15.566e-2424.51DYnein Chain, light Intermediate [Source:UniProtK... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnai20.000e+048.94gene:FBgn0036195 transcript:FBtr0332765[more]
Dnai20.000e+048.94gene:FBgn0036195 transcript:FBtr0301326[more]
CG15714.944e-10834.58gene:FBgn0029993 transcript:FBtr0071106[more]
CG108597.649e-9131.11gene:FBgn0032520 transcript:FBtr0080522[more]
CG108597.649e-9131.11gene:FBgn0032520 transcript:FBtr0342635[more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai2b0.000e+066.10dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b0.000e+066.10dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b0.000e+069.05dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2a0.000e+050.62dynein, axonemal, intermediate chain 2a [Source:ZF... [more]
dnai2a0.000e+050.62dynein, axonemal, intermediate chain 2a [Source:ZF... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogfod30.000e+065.102-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod30.000e+065.322-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod30.000e+065.212-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod30.000e+065.322-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod30.000e+065.322-oxoglutarate and iron-dependent oxygenase domain... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaic20.000e+064.96dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Dnaic20.000e+064.96dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Dnaic20.000e+062.61dynein, axonemal, intermediate chain 2 [Source:MGI... [more]
Dync1i25.021e-2723.50dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
Dync1i25.021e-2723.50dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16960|DYI3_HELCR0.000e+068.48Dynein intermediate chain 3, ciliary OS=Heliocidar... [more]
sp|Q9GZS0|DNAI2_HUMAN0.000e+066.43Dynein intermediate chain 2, axonemal OS=Homo sapi... [more]
sp|Q66HC9|DNAI2_RAT0.000e+064.96Dynein intermediate chain 2, axonemal OS=Rattus no... [more]
sp|A2AC93|DNAI2_MOUSE0.000e+064.96Dynein intermediate chain 2, axonemal OS=Mus muscu... [more]
sp|P27766|DYI3_CHLRE0.000e+049.05Dynein, 70 kDa intermediate chain, flagellar outer... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|204071430.000e+070.44tr|A0A419QF92|A0A419QF92_CLOSI Dynein intermediate... [more]
gnl|BL_ORD_ID|214526260.000e+073.17tr|A0A1S8WXJ4|A0A1S8WXJ4_9TREM WD domain, G-beta r... [more]
gnl|BL_ORD_ID|161785420.000e+070.35tr|A0A4S2LWG0|A0A4S2LWG0_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|203516310.000e+071.94tr|A0A1S3K0K8|A0A1S3K0K8_LINUN dynein intermediate... [more]
gnl|BL_ORD_ID|238633540.000e+072.70tr|V4B996|V4B996_LOTGI WD_REPEATS_REGION domain-co... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai2b0.000e+067.01dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b0.000e+061.56dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b0.000e+060.00dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b0.000e+067.73dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
WDR634.283e-3824.67WD repeat domain 63 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai2b9.607e-14763.99dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dync1i2a2.515e-2824.13dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
ENSPMAT00000004773.13.523e-2423.11pep scaffold:Pmarinus_7.0:GL483227:3631:14047:-1 g... [more]
wdr345.876e-1926.17WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
ENSPMAT00000000105.13.984e-1224.50pep scaffold:Pmarinus_7.0:GL481647:21521:25263:-1 ... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SIF27.321e-821.98WD40 repeat-containing subunit of Set3C histone de... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO400750.000e+064.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297438.170e-3226.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361982.977e-2726.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490797.552e-2725.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432311.647e-2425.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnai20.000e+055.54dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
dnai20.000e+051.14dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
dnai2b5.448e-13944.23dynein axonemal intermediate 2b [Source:NCBI gene;... [more]
dync1i2a3.446e-3126.20dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
dync1i2a5.945e-3126.14dynein cytoplasmic 1 intermediate chain 2 [Source:... [more]
back to top
BLAST of Dynein intermediate chain 3, ciliary vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075110.10.000e+0100.00SMESG000075110.1[more]
SMESG000024276.12.284e-3027.56SMESG000024276.1[more]
SMESG000024276.12.286e-3027.56SMESG000024276.1[more]
SMESG000042025.12.276e-2724.66SMESG000042025.1[more]
SMESG000045332.14.238e-2723.70SMESG000045332.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034110 ID=SMED30034110|Name=Dynein intermediate chain 3, ciliary|organism=Schmidtea mediterranea sexual|type=transcript|length=2074bp
CTTTGGCAACATTTATTTCTTGTGAATTTCAAAATACTTAATTGTATAAT
ATAGACATTAAATTTAACTTCATAGTAGTTAATTTTTCACAGATTACAAA
ATGGAAATTGTTTACGTATATACTAAGAAACGTTCAGAATTTGGTAGACA
GTGTAATTTTCAAGATCGACCAGCTGAATTACATGTTGACATTGCACCAG
ATCCAAGTTTGGCTGAAAATTTTATTGAGAAAAATCCTGTTGATCGTGGA
ATTCAATGTGTTCAAGAAATGTCTGAGCATGAAGTTAACACTGAAAGGTA
TGAAACAGAAACCAGGGGAATTAATCATACCGAAGGTGGTTGGCCTAAAG
ATGTTAATTCACAAGAAGCCGATCAAGTTATTAGATATAGAAAAAAAGTA
GAAAAAGATGAAGCTTACACAAACACTATTCAAAATTTAAGTGTGGTCAT
GGAACACTGCATCAAGCAAAACAATGCTCTCGATATTTACGATAACTATT
TTGAAGGAATTGATATTGAGGCATCTGAAGAGCCTCCTTCGGCCAAAACG
ATAAATGTCTTTAGAGACATGAATGAAGTGAAAAGAACTGCCACTCACAT
TAGCTGGTTCCCAGATGGACCAACGAAATTGGCAGTTGCATATTGTAACA
CGGAATTCCAATCAAGTCCACCTAATACAAGTACAGATTCATACATTTGG
GATGTAATGAATCCGAATAAACCTGACTTGGTATTGAAGCCTGTCTCTCC
ATTGGTTTGCATTGAATACAATCCTAAAGATTCTCATACTCTAATTGGAG
GCTGTTACAATGGACAACTTGCACTTTGGGATCGCAGGAAAGGTTCTCAA
CCGACTGAGGTTTCTCCAGTGGAAAATAGCCATCGAGATCCGGCTTGGAA
AGTTATTTGGATTCAGTCTAAAACCGGAACCGAATGTTTTTCAGCAAGCA
CAGACGGCCAAGTGTTCTGGTGGGACGTGAGAAAAATGGCGGAGCCCACC
GAGATAATGATATTGGACCCGACGAAAAAGCAAGACCTCGAGAAGGCTCA
AGGAGCATACGCATTGGAATATGAATCGACGATCCCAACGAAATTTATGG
CCGGCACTGAACAAGGATCAATAATGTCCTGCAACCGCAAAGGCAAAACA
CCGGCTGATAAGATCGCTGCAATTTATCCTGGTCACCTCGGACCGGTTTA
TGCGTTACAGCGGAATCCGTTCTTTCCTAAAAACTTCCTCACAGTCGGTG
ATTGGACAGCGAGAATCTGGTCAGAGGACATTCGAGATTCGAGCATCATG
TGGACGAAATATCACCTATCTGCACTCACCGATGGAATGTGGAGCCCCGT
TCGTCCGGCGGTGTTCTTCACGACAAAAATGGACGGCACGCTCGATGTGT
GGGATATCGTGTTCAAACAAAAAGAGCCGACTCTTCGTATTCAAGTCTGT
GACGAGTCGCTCAATTGTCTTCGAGTTCAAGAACAAGGCCGTTTGATTGC
TTGTGGGAGCCATTCGGGCACAACAACGATTCTGGAACTGTCAGAGGGGT
TTTGGTCGATGAGCAAGAATGAAAAGAATCTCGTTTCGAATATATTCGAA
AGGGAAACCAGACGGGAAAAGATTCTCGAAGCTCGACATCGGGAATTGAA
ATTGAAAATGAAAAAGGAAGGAGACGGAGAAAAAGTCGGACCGAGCGCAG
GAGGAGCGGAAGAAGCCGAAGCCGAACAAGAAGAGAATCTCGTGGTGAAA
GCCGAAGAGGACTTTTTTCATGCTATTGAGCAGGAACGGAAAATGAGAGA
AAAACGGGAAATTGATCGACAGCGAGCAGCTGCTGGGGCTGATGAGAGCA
CTGTTGCATCGACAATTGATAATATCGATTCGGAGAAAGGCGAGACGGAC
AAGAATGAAAAGGAAGCCTGATGAGTTGGATCATGATTTTATGATGTTGT
TAATACAAATTCCAATAGATTCTAGTTCACTTTGTGTTTTTTTAATTCAA
TATGCACTTTTTCTATTAATTTTCTTAGCCCATTTTTAATTATATTTCAT
CAGCATCAAAACTCTTTAAGGAAG
back to top

protein sequence of SMED30034110-orf-1

>SMED30034110-orf-1 ID=SMED30034110-orf-1|Name=SMED30034110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MEIVYVYTKKRSEFGRQCNFQDRPAELHVDIAPDPSLAENFIEKNPVDRG
IQCVQEMSEHEVNTERYETETRGINHTEGGWPKDVNSQEADQVIRYRKKV
EKDEAYTNTIQNLSVVMEHCIKQNNALDIYDNYFEGIDIEASEEPPSAKT
INVFRDMNEVKRTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIW
DVMNPNKPDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDRRKGSQ
PTEVSPVENSHRDPAWKVIWIQSKTGTECFSASTDGQVFWWDVRKMAEPT
EIMILDPTKKQDLEKAQGAYALEYESTIPTKFMAGTEQGSIMSCNRKGKT
PADKIAAIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIM
WTKYHLSALTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQKEPTLRIQVC
DESLNCLRVQEQGRLIACGSHSGTTTILELSEGFWSMSKNEKNLVSNIFE
RETRREKILEARHRELKLKMKKEGDGEKVGPSAGGAEEAEAEQEENLVVK
AEEDFFHAIEQERKMREKREIDRQRAAAGADESTVASTIDNIDSEKGETD
KNEKEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003774motor activity
GO:0003777microtubule motor activity
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0007368determination of left/right symmetry
GO:0030030cell projection organization
GO:0036158outer dynein arm assembly
GO:0060271cilium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005858axonemal dynein complex
GO:0005874microtubule
GO:0005929cilium
GO:0005930axoneme
GO:0009897external side of plasma membrane
GO:0030286dynein complex
GO:0036126sperm flagellum
GO:0036157outer dynein arm
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 352..391
e-value: 0.39
score: 19.6
coord: 205..244
e-value: 0.93
score: 17.2
coord: 395..435
e-value: 37.0
score: 7.1
coord: 440..479
e-value: 15.0
score: 9.5
coord: 150..201
e-value: 310.0
score: 1.3
coord: 250..292
e-value: 1.9
score: 15.3
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 309..496
e-value: 9.7E-16
score: 59.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 93..308
e-value: 1.1E-16
score: 62.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 543..577
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 519..606
NoneNo IPR availablePANTHERPTHR12442:SF7DYNEIN INTERMEDIATE CHAIN 2, AXONEMALcoord: 2..527
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 2..527
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 199..301
score: 9.547
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 359..488
score: 8.993
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 160..482