Brain protein I3-like protein

Overview
NameBrain protein I3-like protein
Smed IDSMED30034109
Length (bp)495
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Brain protein I3-like protein (SMED30034109) t-SNE clustered cells

Violin plots show distribution of expression levels for Brain protein I3-like protein (SMED30034109) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Brain protein I3-like protein (SMED30034109) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Brain protein I3-like protein (SMED30034109) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034109

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034109SMESG000021817.1 dd_Smed_v4_13415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034109SMESG000021817.1 dd_Smed_v6_13415_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034109SMESG000021817.1 dd_Smed_v4_13415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Brain protein I3-like protein vs. Ensembl Human
Match: BRI3 (brain protein I3 [Source:HGNC Symbol;Acc:HGNC:1109])

HSP 1 Score: 58.151 bits (139), Expect = 7.268e-11
Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            V    C +C+ G L++ F+ LGI LAI LFPFG I CF LR++RC +CG 
Sbjct:   73 VVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGA 122          
BLAST of Brain protein I3-like protein vs. Ensembl Fly
Match: CG12012 (gene:FBgn0035444 transcript:FBtr0300749)

HSP 1 Score: 58.151 bits (139), Expect = 9.881e-12
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  213 PNYGSTSSTE-QIIVQPNVIRQD---VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            P YG+  +T   +++QP  +      +    C  C+ G L++ FS  G+  AIF FP GI+ C  +R++RC +CG +
Sbjct:    4 PTYGAFETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTV 80          
BLAST of Brain protein I3-like protein vs. Ensembl Fly
Match: CG12012 (gene:FBgn0035444 transcript:FBtr0346532)

HSP 1 Score: 58.5362 bits (140), Expect = 2.034e-11
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  213 PNYGSTSSTE-QIIVQPNVIRQD---VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            P YG+  +T   +++QP  +      +    C  C+ G L++ FS  G+  AIF FP GI+ C  +R++RC +CG +
Sbjct:   45 PTYGAFETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTV 121          
BLAST of Brain protein I3-like protein vs. Ensembl Fly
Match: CG12012 (gene:FBgn0035444 transcript:FBtr0073076)

HSP 1 Score: 58.5362 bits (140), Expect = 2.034e-11
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  213 PNYGSTSSTE-QIIVQPNVIRQD---VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            P YG+  +T   +++QP  +      +    C  C+ G L++ FS  G+  AIF FP GI+ C  +R++RC +CG +
Sbjct:   45 PTYGAFETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFFPLGILCCLAMREKRCSNCGTV 121          
BLAST of Brain protein I3-like protein vs. Ensembl Zebrafish
Match: bri3 (brain protein I3 [Source:ZFIN;Acc:ZDB-GENE-030131-3038])

HSP 1 Score: 68.1662 bits (165), Expect = 7.621e-15
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  249 IVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            IVQP+V    V    C  C+ G L+++F+CLGI+ AIF FP GI+FC  LRQ+RC +CG 
Sbjct:   72 IVQPSV----VVVGGCPACRVGVLEDDFTCLGIMCAIFFFPLGILFCLALRQRRCPNCGA 127          
BLAST of Brain protein I3-like protein vs. Ensembl Xenopus
Match: bri3 (brain protein I3 [Source:NCBI gene;Acc:100144285])

HSP 1 Score: 72.7886 bits (177), Expect = 1.737e-16
Identity = 33/73 (45.21%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  210 PPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            PP+  +  ST  II QP      V    C  C+ G L++ F+CLG+  AIF FP GI+FC  LRQ+RC +CG 
Sbjct:   59 PPSQPAYPSTYTIIQQPAATTSVVVVGGCPACRVGVLEDSFTCLGLFCAIFFFPIGILFCMALRQRRCPNCGA 131          
BLAST of Brain protein I3-like protein vs. Ensembl Mouse
Match: Bri3 (brain protein I3 [Source:MGI Symbol;Acc:MGI:1933174])

HSP 1 Score: 61.6178 bits (148), Expect = 2.147e-12
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            V    C +C+ G L+  F+CLGI LAI LFPFG + CF LR++RC +CG +
Sbjct:   69 VVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAV 119          
BLAST of Brain protein I3-like protein vs. Ensembl Mouse
Match: Bri3 (brain protein I3 [Source:MGI Symbol;Acc:MGI:1933174])

HSP 1 Score: 61.2326 bits (147), Expect = 3.292e-12
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            V    C +C+ G L+  F+CLGI LAI LFPFG + CF LR++RC +CG +
Sbjct:   73 VVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAV 123          
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Match: sp|Q5PPK1|BRI3_RAT (Brain protein I3 OS=Rattus norvegicus OX=10116 GN=Bri3 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.279e-11
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            V    C +C+ G L+  F+CLGI LAI LFPFG + CF LR++RC +CG +
Sbjct:   73 VVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAV 123          
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Match: sp|P28662|BRI3_MOUSE (Brain protein I3 OS=Mus musculus OX=10090 GN=Bri3 PE=2 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 2.303e-11
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKI 431
            V    C +C+ G L+  F+CLGI LAI LFPFG + CF LR++RC +CG +
Sbjct:   73 VVVGGCPVCRVGVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAV 123          
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Match: sp|Q32L83|BRI3_BOVIN (Brain protein I3 OS=Bos taurus OX=9913 GN=BRI3 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 7.743e-11
Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            V    C +C+ G L++ F+ LGI LAI LFPFG I CF LR++RC +CG 
Sbjct:   72 VVVGGCPVCRVGVLEDSFTFLGIFLAIVLFPFGFICCFALRKRRCPNCGA 121          
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Match: sp|Q99N46|BRI3_CAVPO (Brain protein I3 OS=Cavia porcellus OX=10141 GN=I3 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.741e-10
Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            V    C +C+ G L++ F+ LGI LAI LFPFG I CF LR++RC +CG 
Sbjct:   73 VVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGA 122          
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Match: sp|O95415|BRI3_HUMAN (Brain protein I3 OS=Homo sapiens OX=9606 GN=BRI3 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.491e-10
Identity = 26/50 (52.00%), Postives = 34/50 (68.00%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            V    C +C+ G L++ F+ LGI LAI LFPFG I CF LR++RC +CG 
Sbjct:   73 VVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGA 122          
BLAST of Brain protein I3-like protein vs. TrEMBL
Match: A0A3S3PKN0 (Brain protein I3-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_14420 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.860e-16
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 3
Query:  213 PNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            PNYGST+    +I+QP  + Q +   +C +C+ G L+E+F+CLG+LLA+  FP GI+ C  LRQ+RC +CG 
Sbjct:   57 PNYGSTT----VIIQPEPVPQVIVVGNCPVCRVGVLEEDFTCLGVLLALICFPLGILCCLALRQRRCPNCGA 124          
BLAST of Brain protein I3-like protein vs. TrEMBL
Match: A0A091TL76 (Brain protein I3 (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_01713 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.095e-16
Identity = 37/81 (45.68%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  186 HTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            + +  P+S PNY   SST  II QP      V    C  C+ G L++ F+CLG+L AI  FP GI+FC  LRQ+RC +CG 
Sbjct:    2 YAVPPPISQPNY---SSTYTIIQQPATTTSVVVVGGCPACRVGVLEDTFTCLGVLCAIVFFPIGILFCLALRQRRCPNCGA 79          
BLAST of Brain protein I3-like protein vs. TrEMBL
Match: A0A087VC68 (Brain protein I3 (Fragment) OS=Balearica regulorum gibbericeps OX=100784 GN=N312_01462 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.416e-15
Identity = 37/81 (45.68%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  186 HTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            + +  P+S PNY   SST  II QP      V    C  C+ G L++ F+CLG+L AI  FP GI+FC  LRQ+RC +CG 
Sbjct:    2 YAVPPPMSQPNY---SSTYTIIQQPATTTSVVVVGGCPACRVGVLEDTFTCLGVLCAIVFFPIGILFCLALRQRRCPNCGA 79          
BLAST of Brain protein I3-like protein vs. TrEMBL
Match: A0A093EK56 (Brain protein I3 (Fragment) OS=Tyto alba OX=56313 GN=N341_05603 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.936e-15
Identity = 37/81 (45.68%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  186 HTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            + +  P S PNY   SST  II QP      V    C  C+ G L++ F+CLG+L AI  FP GI+FC  LRQ+RC +CG 
Sbjct:    2 YAVPPPTSQPNY---SSTYTIIQQPATTTSVVVVGGCPACRVGVLEDTFTCLGVLCAIVFFPIGILFCLALRQRRCPNCGA 79          
BLAST of Brain protein I3-like protein vs. TrEMBL
Match: A0A094K6U3 (Brain protein I3 (Fragment) OS=Antrostomus carolinensis OX=279965 GN=N321_09718 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.936e-15
Identity = 37/81 (45.68%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  186 HTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            + +  P S PNY   SST  II QP      V    C  C+ G L++ F+CLG+L AI  FP GI+FC  LRQ+RC +CG 
Sbjct:    2 YAVPPPTSQPNY---SSTYTIIQQPATTTSVVVVGGCPACRVGVLEDTFTCLGVLCAIVFFPIGILFCLALRQRRCPNCGA 79          
BLAST of Brain protein I3-like protein vs. Ensembl Cavefish
Match: bri3 (brain protein I3 [Source:NCBI gene;Acc:103022426])

HSP 1 Score: 69.3218 bits (168), Expect = 2.218e-15
Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  213 PNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            PNY ST +    I+QP+V    V    C  C+ G L+++F+CLGI+ AI  FP GI+FC  LRQ+RC +CG 
Sbjct:   67 PNYTSTYT----IIQPSV----VVVGGCPACRVGVLEDDFTCLGIMCAILFFPLGILFCLALRQRRCPNCGA 130          
BLAST of Brain protein I3-like protein vs. Ensembl Nematostella
Match: EDO32734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU86])

HSP 1 Score: 48.521 bits (114), Expect = 9.917e-9
Identity = 22/49 (44.90%), Postives = 28/49 (57.14%), Query Frame = 3
Query:  279 VYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCG 425
            V    C  C  G   +EF+ LGI LAI  FP GI+ C +L ++RC  CG
Sbjct:    1 VAGGSCPSCGVGVPNQEFTILGICLAILFFPIGILCCLMLTERRCSHCG 49          
BLAST of Brain protein I3-like protein vs. Ensembl Medaka
Match: bri3 (brain protein I3 [Source:NCBI gene;Acc:101165556])

HSP 1 Score: 70.4774 bits (171), Expect = 6.559e-16
Identity = 32/60 (53.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  249 IVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGK 428
            I+QP+V    V    C  C+ G L+++F+CLGIL AIF FP GI+FCF LRQ+RC +CG 
Sbjct:   71 IIQPSV----VVVGGCPACRVGVLEDDFTCLGILCAIFFFPLGILFCFALRQRRCPNCGA 126          
BLAST of Brain protein I3-like protein vs. Planmine SMEST
Match: SMESG000021817.1 (SMESG000021817.1)

HSP 1 Score: 265.003 bits (676), Expect = 1.627e-92
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 3
Query:   96 MPDLHIIPATEGLNSNNKLSFFLRKETRIFHTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKISHLLFSTFQICLSLNFIC 485
            MPDLHIIPATEGLNSNNKLSFFLRKETRIFHTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKISHLLFSTFQICLSLNFIC
Sbjct:    1 MPDLHIIPATEGLNSNNKLSFFLRKETRIFHTLKHPVSPPNYGSTSSTEQIIVQPNVIRQDVYNSDCSICKYGTLKEEFSCLGILLAIFLFPFGIIFCFLLRQQRCEDCGKISHLLFSTFQICLSLNFIC 130          
The following BLAST results are available for this feature:
BLAST of Brain protein I3-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BRI37.268e-1152.00brain protein I3 [Source:HGNC Symbol;Acc:HGNC:1109... [more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG120129.881e-1233.77gene:FBgn0035444 transcript:FBtr0300749[more]
CG120122.034e-1133.77gene:FBgn0035444 transcript:FBtr0346532[more]
CG120122.034e-1133.77gene:FBgn0035444 transcript:FBtr0073076[more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bri37.621e-1551.67brain protein I3 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bri31.737e-1645.21brain protein I3 [Source:NCBI gene;Acc:100144285][more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Bri32.147e-1250.98brain protein I3 [Source:MGI Symbol;Acc:MGI:193317... [more]
Bri33.292e-1250.98brain protein I3 [Source:MGI Symbol;Acc:MGI:193317... [more]
back to top
BLAST of Brain protein I3-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PPK1|BRI3_RAT2.279e-1150.98Brain protein I3 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|P28662|BRI3_MOUSE2.303e-1150.98Brain protein I3 OS=Mus musculus OX=10090 GN=Bri3 ... [more]
sp|Q32L83|BRI3_BOVIN7.743e-1152.00Brain protein I3 OS=Bos taurus OX=9913 GN=BRI3 PE=... [more]
sp|Q99N46|BRI3_CAVPO2.741e-1052.00Brain protein I3 OS=Cavia porcellus OX=10141 GN=I3... [more]
sp|O95415|BRI3_HUMAN3.491e-1052.00Brain protein I3 OS=Homo sapiens OX=9606 GN=BRI3 P... [more]
back to top
BLAST of Brain protein I3-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S3PKN04.860e-1647.22Brain protein I3-like protein OS=Dinothrombium tin... [more]
A0A091TL769.095e-1645.68Brain protein I3 (Fragment) OS=Phaethon lepturus O... [more]
A0A087VC681.416e-1545.68Brain protein I3 (Fragment) OS=Balearica regulorum... [more]
A0A093EK561.936e-1545.68Brain protein I3 (Fragment) OS=Tyto alba OX=56313 ... [more]
A0A094K6U31.936e-1545.68Brain protein I3 (Fragment) OS=Antrostomus carolin... [more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bri32.218e-1547.22brain protein I3 [Source:NCBI gene;Acc:103022426][more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327349.917e-944.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Brain protein I3-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bri36.559e-1653.33brain protein I3 [Source:NCBI gene;Acc:101165556][more]
back to top
BLAST of Brain protein I3-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021817.11.627e-92100.00SMESG000021817.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034109 ID=SMED30034109|Name=Brain protein I3-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=495bp
TTAAAATATATTTCTAAGGTTTTTCTCTAATCTCTATTAATTATATTTAG
TTAGAATATTTAATGCTTTATTAAATCTTTTGACAGTTAAATATTATGCC
TGATTTACATATTATTCCTGCAACAGAAGGCCTAAATTCAAACAACAAAT
TAAGTTTTTTCCTTCGTAAAGAAACTAGAATTTTTCATACCCTTAAACAT
CCTGTGAGCCCTCCAAATTATGGGTCAACTAGTTCAACCGAACAAATTAT
AGTTCAACCAAATGTTATTAGACAGGATGTATACAATTCGGATTGTTCCA
TATGTAAATATGGAACATTAAAGGAAGAATTTTCTTGCTTAGGAATCTTA
TTAGCTATTTTCTTATTCCCTTTTGGAATAATATTTTGCTTTTTACTCAG
ACAACAGCGGTGTGAAGATTGTGGGAAGATTTCTCATTTATTATTCTCGA
CTTTTCAGATCTGTTTATCATTGAATTTTATTTGTTGATTTTCTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR019317Brain_I3
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019317Brain protein I3PFAMPF10164DUF2367coord: 44..110
e-value: 9.1E-22
score: 77.5
IPR019317Brain protein I3PANTHERPTHR13551BRAIN PROTEIN I3coord: 34..112
NoneNo IPR availableTMHMMTMhelixcoord: 79..101