SMED30034099

Overview
NameSMED30034099
Smed IDSMED30034099
Length (bp)2133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034099 (SMED30034099) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034099 (SMED30034099) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034099 (SMED30034099) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034099 (SMED30034099) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034099

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30034099SMESG000040016.1 dd_Smed_v4_17421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034099SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034099SMESG000040016.1 dd_Smed_v6_17421_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034099SMESG000040016.1 SMESG000040019.1 dd_Smed_v6_22578_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034099SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034099SMESG000040016.1 SMESG000040019.1 dd_Smed_v4_22578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034099 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002009:39695..55639 +10564
Homology
BLAST of SMED30034099 vs. Ensembl Fly
Match: Usp8 (gene:FBgn0038862 transcript:FBtr0304714)

HSP 1 Score: 49.2914 bits (116), Expect = 9.383e-6
Identity = 49/246 (19.92%), Postives = 101/246 (41.06%), Query Frame = 2
Query:  332 IDEQDNSDVLSFLINRMHHDIKT----------------KIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKK-AVRVCKLCKPLPETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAI-----VQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFF 1003
            +D+QD+ + L+ L++ +H D++T                 ++  K+  + +L++ +  + +    + C  E   + +  S +SL L  +S    L    D  F GE + G+NC +  C  K+ A++   + K LP  + + L+    F      +   +K+   +    ++ +  P      +R      Y L A+          ++   C   +  KWF   D+ +   D   ++    YILF+
Sbjct:  119 VDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESF-SNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPS--CKTKRDAIKKLDISK-LPPVLVVHLK---RFYADPSNSGSYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 357          
BLAST of SMED30034099 vs. Planmine SMEST
Match: SMESG000040016.1 (SMESG000040016.1)

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 679/679 (100.00%), Postives = 679/679 (100.00%), Query Frame = 2
Query:   86 MGQLQSFFNLLAKDESLYSFDSTMNQSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFENQISVPSISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKSKDIMDSSQKSIKELSNFELNYQQSISRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLTESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYELLT 2122
            MGQLQSFFNLLAKDESLYSFDSTMNQSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFENQISVPSISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKSKDIMDSSQKSIKELSNFELNYQQSISRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLTESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYNCENKKCSNKTKSKKSIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYELLT
Sbjct:    1 MGQLQSFFNLLAKDESLYSFDSTMNQSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFENQISVPSISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKSKDIMDSSQKSIKELSNFELNYQQSISRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLTESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYNCENKKCSNKTKSKKSIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYELLT 679          
BLAST of SMED30034099 vs. Planmine SMEST
Match: SMESG000039991.1 (SMESG000039991.1)

HSP 1 Score: 166.007 bits (419), Expect = 2.169e-42
Identity = 155/562 (27.58%), Postives = 265/562 (47.15%), Query Frame = 2
Query:  443 IKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFENQISVPSISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKSKDIMDSSQKSIKELSNFELNYQQSISRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLT-ESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLIS---CQFNDKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYEL 2116
            +K PI ++V  +I C+C +      +S+  L L V +   +LQ   D IF  E         +NC          L +P+P+ IC+  +  +    +++L E++I+ S+    S+ D              + D +YFL +I+ +  N  Y+CY+     W+ I D+   E D+   L  K +IL +EN      +  +  T  Y  K  F  S+++P    RK+        + D+  K++     FE  Y   IS+ S  S K       L ICLH+ SSC+  +  IQ I  + M K   F+  I +    + + EI    + E + L +TN+F  L  L+++L  E +   MNP+ +   +T+R  C  C    +  L    +F I  + +I  + +QD ++  F+ +IL  ++C  K C  K     S R+  P  + +C+HV ++IW+G +N  + S I  ++ L +KL Y +  S  N                 K+L+Y LQS+IS       ++Y+C+K +  +W+ +T ++   VS N+++   PYI+FYEL
Sbjct:  469 VKCPINISVMSEIKCKCNETTLKVNKSK--LGLKVFNFCISLQRSIDFIFNVEKEVTLKDNNKNCYCTSGFSKSNLSQPIPKIICVYSENESRLFQIKLLKELVIRNSY-FSQSQLDVRSHSENGKQRTLEKTDTKYFLTSIIGSLDN-GYECYRMCDGSWYHIKDDKSSEIDESANLFGKWHILLYEN------LKETHQTK-YNLKKTFKPSIISP----RKIC-------VEDAIMKNV-----FEFEY---ISKSSNSSHKAYC----LQICLHAFSSCKKFVNEIQNILTEEMEKSNLFMKYITLLLQSFADVEIPLEAVNELHLLEETNIFQFLKDLLSNLSTEWK---MNPFLISRRVTIR--CCLCETLQEDDLNCNLSFNIPATSNIGFIDIQDIVNSSFKIEILKNFDCIKKDCGGKESKMLS-RLCLPFPTVICIHVVRVIWDGLKNVLVNSNIRISEQLQIKLKYLDYQSSINYS--------------NKDLIYILQSVISFTESPVPNEYICFKNVNENWFKITKSSTLRVSKNEMMTYQPYIMFYEL 976          

HSP 2 Score: 96.2857 bits (238), Expect = 3.755e-20
Identity = 166/687 (24.16%), Postives = 301/687 (43.81%), Query Frame = 2
Query:  161 QSKSSCSDIVSKLTKLQSEYPNLEEL----NMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSK----YTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQ------GRNSFIT--LEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQNNTNFRYQ---CYKNDRNKWFLISDESLVECDQPKILEDKDYILFFENQISVP--SISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKSKDIMDSSQKSIKELSNFELNYQQSISRKSPVSLK--KLGINQYLGICLHSLSSCEVLIKRI-----QRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLTESAFTIAVSGSISNLSLQDSIDMIF---QEQIL-----NCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYE 2113
            Q  S+CS++ + L KL+ +YP+L +L     +L +  +I  R+  M + + Q  IF+  ++  +QD+ D+L+ +IN ++ +++ +  + +       ++K  + M +  +I C  E     T Q  ++L++ +  K       LQ+L +  F  E +    CE ++CS K+     KLC  +P T+CIRLQ      G    I   +E   E+ I  S++            N Q N + + N+ +Y LK+++  N N  ++   CY+   N WF ++D S+ + D   IL    Y+LF+EN  S P  ++   R T   +   N   S   P  +   L  R K+K I  +S+      +++         +K+P+  +  +  + Q+  + + +LS+C   ++ +     + I ++  + +K  +N  +       N E+   I+ E    +K  L  +  A  N     +R +N    P+ I++   I C  C +    ++ +S   + V      +SLQ SID IF   +E  L     NCY       S          + QPI   +CV+ E        N+    +I     L+++ +Y+   S     + S        T  K +  Y L S+I    ++ Y CY+     WY + D   S +  +  L    +IL YE
Sbjct:   37 QGISACSNLAATLRKLELKYPSLAKLRTFNKILKDWCDIYVRN--MSFDEDQ--IFQHWNRPGQQDSYDLLAHVINDVYSELQNETNLFQG------SLKLNLPMQISLEITCCPECNNEKTFQFDLALHVPIIKKPRLKSIVLQDLLESYFNEETINE-KCE-KSCSKKQK----KLC-IVPSTLCIRLQRLNWINGELQIIRDRVEFTEELTISASYLT-----------NNQVNMS-LANNQKYHLKSVIAQNPNDSFEHNICYRLMNNNWFCVTDSSVHKEDFNNILNCIAYVLFYENS-SRPLRNLINLRSTFRRSETLNLSRSTRNPFIATIPLNMR-KTKTISLTSRIFRSSSADY---------KKTPLKRETCRFEMFQWEMVLIEALSTCRSFVEALKLINCENIGERYQQIVKCILNRSLSPIKIIDNKEV--DILGE----FKKFLAAIFPAEFNSSITNLRGRNKVKCPINISVMSEIKC-KCNET-TLKVNKSKLGLKVFNFC--ISLQRSIDFIFNVEKEVTLKDNNKNCYCTSGFSKS---------NLSQPIPKIICVYSE--------NESRLFQIKLLKELVIRNSYF---SQSQLDVRSHSENGKQRTLEKTDTKYFLTSIIG-SLDNGYECYRMCDGSWYHIKDDKSSEIDESANLFGKWHILLYE 652          

HSP 3 Score: 93.9745 bits (232), Expect = 1.951e-19
Identity = 84/326 (25.77%), Postives = 155/326 (47.55%), Query Frame = 2
Query: 1187 ELNYQQSISRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQK--SMRKMKTFINLIM-ISDGDYRNAEI-SNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQ-NMNPYPLEINMTVRIS-----CVNCG--KHFQYQLTESAFTIAVSGSISNLSLQDSIDMIFQEQILN--CYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKY---MCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYE 2113
            E++ Q       P+S      N+YL I L  +S+C  L   ++++  K  S+ K++TF  ++    D   RN     + I + WN   + + + LL  ++ND+ +E++ + N+    L++N+ ++IS     C  C   K FQ+ L      I     + ++ LQD ++  F E+ +N  C    +KK                + STLC+ +++L W   + Q I  ++ FT+ L +  +Y  NN               +  ++     YHL+S+I+   ND +   +CY+ + N+W+C+TD+++     N +L    Y+LFYE
Sbjct:    8 EIDLQDVFPAIKPLSSIMHRANRYLNIGLQGISACSNLAATLRKLELKYPSLAKLRTFNKILKDWCDIYVRNMSFDEDQIFQHWNRPGQQDSYDLLAHVINDVYSELQNETNLFQGSLKLNLPMQISLEITCCPECNNEKTFQFDLALHV-PIIKKPRLKSIVLQDLLESYFNEETINEKCEKSCSKKQKKLCI----------VPSTLCIRLQRLNWINGELQIIRDRVEFTEELTISASYLTNNQ--------------VNMSLANNQKYHLKSVIAQNPNDSFEHNICYRLMNNNWFCVTDSSVHKEDFNNILNCIAYVLFYE 308          
BLAST of SMED30034099 vs. Planmine SMEST
Match: SMESG000039986.1 (SMESG000039986.1)

HSP 1 Score: 112.464 bits (280), Expect = 3.490e-25
Identity = 86/298 (28.86%), Postives = 150/298 (50.34%), Query Frame = 2
Query:  161 QSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVSSKYTN----LQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQGRNSFITLEIL---------NEMLIKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIVQN--NTNF-RYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFE 1006
            Q+ S+CS+ V  L   Q + PN  +L  L  L++IL   ++     S++ IF   +K  +QD+ ++L+F++N+++ + K   ++     ++ L ++ P+ + +++ I C  +    + +QS+I+L++T+     +    LQ+L D  F  E+++ F CE   C    A +  KLC PLP TICI LQ R  +    I+          E +I R      S + F E          + N+Y Y LK+++ +  N +F  Y CYK   N WF  SD  + + D   +   + YILF+E
Sbjct:   92 QAISACSNFVKDLNDCQMKNPNFPKLKTLNNLIKILCYGNKKYVDLSRDEIFAGWNKTGQQDSFELLAFIVNQVYKEFKKLNEV-----DDWLKVQLPMRIILEHHITCCSKYGGHNVMQSEIALHITIRKNQRSDPIILQDLIDFYFKKELIEDFICEESKCPGTSAKKQIKLCLPLPNTICIHLQ-RLHYTADNIMKKVEDKVKFEEKIIIRKAFCKRSDNSFSE----------LLNEYDYHLKSVIAHYGNASFGHYICYKKFNNSWFYTSDSFIYKEDIDHVFNCQAYILFYE 373          

HSP 2 Score: 98.2117 bits (243), Expect = 8.255e-21
Identity = 80/291 (27.49%), Postives = 155/291 (53.26%), Query Frame = 2
Query: 1259 LGICLHSLSSCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNALYKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQLTES--AFTIAVSGSISNLSLQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISC-QFND--KYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYEL 2116
            L +C H+LSSC+ +I    +  + +  KM+  I+L+ +       ++++  +++ +   ++TN++HLL  L+++L  E    N NP+ +  + T  I C +CG   Q +  ES  +F I ++ S  ++++QD +D  FQ Q LN Y    +       SK   ++ +P  + +C+HVE+++W+G +N+    +I   + + +K  Y+   SD               +   K+L Y LQS+IS  +++D  +Y CY  L  +W  +T  + ++V+  +++  +PYI+ YEL
Sbjct:  946 LKMCFHALSSCKSVIN--NKYLKCADNKMEKSISLLKVLKSLDNQSDLAIDVMETFPESFETNMYHLLTLLLSNLSKE---WNHNPFLISRDKT--IECYHCGI-LQSRFLESQISFNIPITNSWDHVNIQDFVDKDFQIQTLN-YFECPRGECMGKTSKMLSKLCKPFPTVICIHVERVVWDGEKNKVFNLRIRLPEYIQLKKKYFNIQSDV--------------SNTDKDLNYTLQSVISFREYSDPIEYFCYNNLFGNWSKITKFSKTSVNKYEIMSCNPYIMLYEL 1213          

HSP 3 Score: 90.1225 bits (222), Expect = 3.377e-18
Identity = 83/319 (26.02%), Postives = 160/319 (50.16%), Query Frame = 2
Query: 1211 SRKSPVSLKKLGINQYLGICLHSLSSCEVLIKRIQ--RITQKSMRKMKTFINLIMI-SDGDYRNAEIS-NSIIKEWNALYKTNLFHLLLALMNDLRNEIR-IQNMNPY-----PLEINMTVRISCVNCGKHFQYQLTESAFTIAVSGSISNLS----LQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQ-NQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFN---DKYMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYE 2113
            S + PVSL   G N YL   L ++S+C   +K +   ++   +  K+KT  NLI I   G+ +  ++S + I   WN   + + F LL  ++N +  E + +  ++ +     P+ I +   I+C  C K+  + + +S   + ++   +  S    LQD ID  F+++++  + CE  KC   +  K+ I++  P+ +T+C+H+++L +      + +  K+ F + +I++  + + + +  S+LL+             E  YHL+S+I+   N     Y+CYKK  N W+  +D+ +    ++ V     YILFYE
Sbjct:   71 SERIPVSLINYGANCYLNSGLQAISACSNFVKDLNDCQMKNPNFPKLKTLNNLIKILCYGNKKYVDLSRDEIFAGWNKTGQQDSFELLAFIVNQVYKEFKKLNEVDDWLKVQLPMRIILEHHITC--CSKYGGHNVMQSEIALHITIRKNQRSDPIILQDLIDFYFKKELIEDFICEESKCPGTSAKKQ-IKLCLPLPNTICIHLQRLHYTADNIMKKVEDKVKFEEKIIIRKAFCKRSDNSFSELLN-------------EYDYHLKSVIAHYGNASFGHYICYKKFNNSWFYTSDSFIYKEDIDHVFNCQAYILFYE 373          

HSP 4 Score: 55.0694 bits (131), Expect = 1.990e-7
Identity = 49/199 (24.62%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  452 PIIMTVKYDIIC-QCEKVIFSTVQSQISLNLTVSSKY--TNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQ------GRNSFITLEI-LNEML-IKRSFVIDVSRDDFEEPPNQQTNSNRMENDYRYFLKAIV---QNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDKDYILFFE 1006
            P +++    I C  C  +    ++SQIS N+ +++ +   N+Q+  DK F  + +  F C    C  K +  + KLCKP P  ICI ++       +N    L I L E + +K+ +             N Q++ +  + D  Y L++++   + +    Y CY N    W  I+  S    ++ +I+    YI+ +E
Sbjct: 1026 PFLISRDKTIECYHCGILQSRFLESQISFNIPITNSWDHVNIQDFVDKDFQIQTLNYFECPRGECMGKTSKMLSKLCKPFPTVICIHVERVVWDGEKNKVFNLRIRLPEYIQLKKKYF------------NIQSDVSNTDKDLNYTLQSVISFREYSDPIEYFCYNNLFGNWSKITKFSKTSVNKYEIMSCNPYIMLYE 1212          
BLAST of SMED30034099 vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 108.997 bits (271), Expect = 4.158e-25
Identity = 110/364 (30.22%), Postives = 176/364 (48.35%), Query Frame = 2
Query: 1220 SPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQK--SMRKMKTFINLIMISDGDYRNA-EIS-NSIIKEWNALYKTNLFHLLLALMNDLRNEIR----IQN-MNPY-----PLEINMTVRISCVNCGKHFQYQL-TESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSC---NEIFLETAV---------------------------------------------KKELVYHLQSLISCQFNDK---YMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYE 2113
            SP SL  +G N YL   L S+SSCE   + I+R+  K   + K+  F NL+++ +   +NA EIS N+I + WN   + + F LL  ++N + NEIR    ++N ++ +     P+++ +   I C +CG      L ++ A  I+V  +  N +L+  +D  F + I+  Y C+ K C+     K + ++ +P+  TLC+H++K  WNG Q + I ++INF+  LI+K  Y     + +S+LL S    + I    A+                                             KK ++Y+L S+I  + N K   YMCYK + N WY   D  +S V    V +SDPYIL YE
Sbjct:   55 SPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCGTIISIPLHSDLALHISVPRN-GNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMT-KLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 415          

HSP 2 Score: 100.908 bits (250), Expect = 1.701e-22
Identity = 53/184 (28.80%), Postives = 113/184 (61.41%), Query Frame = 2
Query:  161 QSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVS-SKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQ 709
            QS SSC      + +L S+Y +L++L +   L+ +L   S+   + S+N+IF+  +K  +QD+ ++L+++IN+++++I+   +++   S   L I+ P+ + ++Y I C C  +I   + S ++L+++V  +    L+   D+ F  +++  + C+T++C+   A+++ KL +PLP+T+CI LQ
Sbjct:   73 QSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDIS-GWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQ 255          
BLAST of SMED30034099 vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 108.612 bits (270), Expect = 4.969e-25
Identity = 110/364 (30.22%), Postives = 176/364 (48.35%), Query Frame = 2
Query: 1220 SPVSLKKLGINQYLGICLHSLSSCEVLIKRIQRITQK--SMRKMKTFINLIMISDGDYRNA-EIS-NSIIKEWNALYKTNLFHLLLALMNDLRNEIR----IQN-MNPY-----PLEINMTVRISCVNCGKHFQYQL-TESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYXXXXXXXXXXXXXXXXIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNSDRNSKLLSSC---NEIFLETAV---------------------------------------------KKELVYHLQSLISCQFNDK---YMCYKKLGNDWYCLTDTAMSNVSLNQVLESDPYILFYE 2113
            SP SL  +G N YL   L S+SSCE   + I+R+  K   + K+  F NL+++ +   +NA EIS N+I + WN   + + F LL  ++N + NEIR    ++N ++ +     P+++ +   I C +CG      L ++ A  I+V  +  N +L+  +D  F + I+  Y C+ K C+     K + ++ +P+  TLC+H++K  WNG Q + I ++INF+  LI+K  Y     + +S+LL S    + I    A+                                             KK ++Y+L S+I  + N K   YMCYK + N WY   D  +S V    V +SDPYIL YE
Sbjct:   53 SPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDISGWLRIRLPMKLLIQYSIKC-SCGTIISIPLHSDLALHISVPRN-GNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMT-KLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKSISNNSSITFSKALSKSSDSEKSLIGKGISLQKSFPSIKDNVINNLRLTSINSGEHLKQKKNILYNLCSVIVHKGNVKGGHYMCYKCIDNQWYLADDNQISKVRKEIVFKSDPYILIYE 413          

HSP 2 Score: 101.293 bits (251), Expect = 1.452e-22
Identity = 53/184 (28.80%), Postives = 113/184 (61.41%), Query Frame = 2
Query:  161 QSKSSCSDIVSKLTKLQSEYPNLEELNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMHHDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISLNLTVS-SKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLPETICIRLQ 709
            QS SSC      + +L S+Y +L++L +   L+ +L   S+   + S+N+IF+  +K  +QD+ ++L+++IN+++++I+   +++   S   L I+ P+ + ++Y I C C  +I   + S ++L+++V  +    L+   D+ F  +++  + C+T++C+   A+++ KL +PLP+T+CI LQ
Sbjct:   71 QSISSCEKFKEDIKRLHSKYKDLDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSEVKNDIS-GWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQ 253          
The following BLAST results are available for this feature:
BLAST of SMED30034099 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Usp89.383e-619.92gene:FBgn0038862 transcript:FBtr0304714[more]
back to top
BLAST of SMED30034099 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034099 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040016.10.000e+0100.00SMESG000040016.1[more]
SMESG000039991.12.169e-4227.58SMESG000039991.1[more]
SMESG000039986.13.490e-2528.86SMESG000039986.1[more]
SMESG000040010.14.158e-2530.22SMESG000040010.1[more]
SMESG000040010.14.969e-2530.22SMESG000040010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034099 ID=SMED30034099|Name=SMED30034099|organism=Schmidtea mediterranea sexual|type=transcript|length=2133bp
GTTAAACATTCTTTAAATTTTAATCACATTCTAATTCGATTCAAATTTTA
AATTTTGTAATTATATTTTCTCAAGTATTTTATTAATGGGGCAATTGCAA
AGCTTTTTCAATCTGCTTGCCAAAGATGAATCTTTGTATTCATTCGATTC
AACAATGAATCAGAGTAAATCGTCATGCTCGGATATTGTTAGCAAACTGA
CAAAACTACAGTCTGAATACCCGAATCTTGAAGAGTTGAATATGCTCATT
GAATTGGTGGAGATTCTGCAAAGAGATAGTGAAATGAAATGGAAAAAATC
TCAAAATAGTATATTTAAACCGAGGTCAAAAATAGATGAACAAGATAACT
CTGATGTTTTGTCCTTTCTCATCAATCGCATGCATCACGACATAAAAACA
AAAATTAAAATCCAGAAAAGTTGTTCAAATAATTTACTGAACATCAAATT
CCCCATAATAATGACCGTGAAGTATGACATAATCTGTCAATGTGAAAAGG
TCATCTTCAGTACGGTCCAATCCCAAATATCACTGAATCTAACAGTTTCA
TCCAAGTACACAAATTTACAAAATCTATTCGATAAAATATTCCTTGGAGA
AGTAGTGAAGGGATTCAATTGTGAAACGAGAAATTGCTCTCATAAAAAAG
CCGTCAGAGTGTGCAAATTATGTAAGCCTCTACCGGAAACAATATGCATT
AGATTACAAGGAAGAAATTCATTCATAACCCTTGAAATATTGAATGAAAT
GTTGATCAAAAGGTCTTTTGTTATTGACGTTTCAAGGGATGATTTCGAAG
AACCTCCTAATCAACAGACCAATTCAAATCGAATGGAAAATGACTATCGA
TACTTTCTAAAAGCAATTGTGCAAAACAATACAAATTTTCGGTATCAATG
CTACAAAAACGATAGGAATAAATGGTTTTTGATTTCAGATGAGAGTTTAG
TTGAATGTGACCAACCCAAAATATTGGAAGACAAAGATTATATTTTGTTT
TTCGAAAACCAAATCAGCGTTCCTTCCATTTCCGGAAGTAGAGTAACATC
GTTATATGCATCAAAAGACAACTTTCCATCCTCACTTGTTACCCCATTGA
GTTCTCATCGGAAATTGTACAGTAGATTCAAATCAAAAGACATTATGGAT
TCCAGTCAAAAATCCATTAAGGAATTATCGAATTTTGAATTGAATTATCA
GCAATCGATCTCTAGAAAATCACCAGTCAGTCTGAAAAAATTAGGAATCA
ATCAATATCTTGGCATCTGTCTTCACTCTTTATCAAGCTGTGAAGTTCTA
ATCAAACGAATACAGCGGATAACGCAAAAATCAATGAGAAAAATGAAAAC
GTTCATCAATTTAATTATGATTTCCGACGGAGATTACCGAAATGCAGAAA
TATCGAACTCCATTATTAAAGAATGGAATGCTCTTTACAAAACAAATCTG
TTCCACCTGTTGCTTGCGTTAATGAATGATTTGCGTAATGAAATCAGAAT
TCAGAATATGAATCCGTATCCATTGGAAATAAATATGACAGTTAGAATAT
CATGCGTAAATTGCGGGAAACATTTCCAATATCAATTAACGGAATCAGCA
TTTACAATAGCCGTAAGCGGTTCTATAAGCAACTTAAGTTTACAAGATTC
AATTGATATGATATTTCAAGAACAAATTCTGAATTGTTATAATTGCGAAA
ATAAAAAATGCTCCAATAAAACAAAAAGCAAAAAATCAATTCGAATGCGC
CAGCCAATAGCAAGCACGCTTTGCGTACACGTGGAAAAGTTAATCTGGAA
TGGTCGACAGAATCAGTTTATTTTTTCGAAAATTAATTTTACCGATGTGC
TCATCATGAAGTTGAATTATTATGAAAATAACTCTGACAGAAATTCCAAA
CTTTTGTCATCATGCAATGAGATTTTCCTCGAGACCGCGGTGAAAAAAGA
GCTTGTTTATCATTTGCAGTCTCTGATTTCCTGCCAATTTAATGACAAAT
ATATGTGCTATAAAAAACTGGGAAATGATTGGTATTGCCTTACAGATACT
GCAATGTCGAACGTTTCGTTAAATCAGGTTTTAGAAAGTGATCCGTATAT
TTTGTTCTATGAGCTCTTAACTTGAATATTATT
back to top

protein sequence of SMED30034099-orf-1

>SMED30034099-orf-1 ID=SMED30034099-orf-1|Name=SMED30034099-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MGQLQSFFNLLAKDESLYSFDSTMNQSKSSCSDIVSKLTKLQSEYPNLEE
LNMLIELVEILQRDSEMKWKKSQNSIFKPRSKIDEQDNSDVLSFLINRMH
HDIKTKIKIQKSCSNNLLNIKFPIIMTVKYDIICQCEKVIFSTVQSQISL
NLTVSSKYTNLQNLFDKIFLGEVVKGFNCETRNCSHKKAVRVCKLCKPLP
ETICIRLQGRNSFITLEILNEMLIKRSFVIDVSRDDFEEPPNQQTNSNRM
ENDYRYFLKAIVQNNTNFRYQCYKNDRNKWFLISDESLVECDQPKILEDK
DYILFFENQISVPSISGSRVTSLYASKDNFPSSLVTPLSSHRKLYSRFKS
KDIMDSSQKSIKELSNFELNYQQSISRKSPVSLKKLGINQYLGICLHSLS
SCEVLIKRIQRITQKSMRKMKTFINLIMISDGDYRNAEISNSIIKEWNAL
YKTNLFHLLLALMNDLRNEIRIQNMNPYPLEINMTVRISCVNCGKHFQYQ
LTESAFTIAVSGSISNLSLQDSIDMIFQEQILNCYNCENKKCSNKTKSKK
SIRMRQPIASTLCVHVEKLIWNGRQNQFIFSKINFTDVLIMKLNYYENNS
DRNSKLLSSCNEIFLETAVKKELVYHLQSLISCQFNDKYMCYKKLGNDWY
CLTDTAMSNVSLNQVLESDPYILFYELLT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR028889USP_dom
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 63..306
e-value: 1.5E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 3..311
e-value: 2.8E-14
score: 55.2
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 463..678
e-value: 2.4E-14
score: 55.3
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 86..307
e-value: 3.28392E-15
score: 74.0566
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 458..676
e-value: 4.96468E-10
score: 58.6486
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 381..678
score: 13.896
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 1..309
score: 10.019
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 69..309
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 391..677