SMED30034098

Overview
NameSMED30034098
Smed IDSMED30034098
Length (bp)4968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034098 (SMED30034098) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034098 (SMED30034098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034098 (SMED30034098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034098 (SMED30034098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034098

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034098SMESG000022171.1 dd_Smed_v4_4552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034098SMESG000022171.1 dd_Smed_v4_4552_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30034098SMESG000022171.1 dd_Smed_v4_4552_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034098 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009014:2344..9905 -24279
Homology
BLAST of SMED30034098 vs. UniProt/SwissProt
Match: sp|P49687|NU145_YEAST (Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP145 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 7.221e-7
Identity = 77/229 (33.62%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 4225 HQSTGLFGTAIQTA--STTKESSGLFNTPISSNNLF---GNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGS------STNNQLFGNVNNTPTPAS----GLFAQSNT-----NGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNA---PNSG 4842
             +STGLFG     A  ST   S GLFN   ++N++     N++ + N  AQPS  GGLFG+  NT S                          + AG    +NN  AN+T   G+FSGS      + N  LFGN NN    ++    GLF +  T      GLF NS +T  TTGLFG +                N+ ++ G+FG K   S + G+FG N    P SG
Sbjct:   35 QKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPS--GGLFGATNNTTS--------------------------KSAGSLFGNNNATANSTGSTGLFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSN----------------NTQSSTGIFGQKPGASTTGGLFGNNGASFPRSG 219          

HSP 2 Score: 56.9954 bits (136), Expect = 1.624e-6
Identity = 79/205 (38.54%), Postives = 109/205 (53.17%), Query Frame = 1
Query: 4291 LFNTPISSNNLFGN---STPYTNNTAQPS-------QSGGLFG-------SGTNTASGGLFXXXXXXXXXXX--XXXXLFG-KSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTP--TPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSS----GLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKN 4827
            +FN  ++S   FGN   STP T+  AQPS       +S GLFG       + T + SGGLF +  +  S +Q  ++  LFG K  Q   G+F ++NN  + +       +GS     LFGN N T   T ++GLF+ SN      N  ++ Q  GLFG S+N + TS+    GLFG P T  +   GLFGN SST+ +TG+FG N
Sbjct:    1 MFNKSVNSGFTFGNQNTSTP-TSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKS-------AGS-----LFGNNNATANSTGSTGLFSGSN------NIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSN 186          
BLAST of SMED30034098 vs. UniProt/SwissProt
Match: sp|G0S4X2|NUP49_CHATD (Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP49 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.676e-6
Identity = 81/222 (36.49%), Postives = 102/222 (45.95%), Query Frame = 1
Query: 4240 LFGTAIQTASTTKESSGLFNTPIS----SNNLFGNSTPYTNNTAQPSQSGGLFGS-GTNTASGGLFXXXXXXXXXXXXXXXLFGKSN-----QQGAGIFASSNNVNANTTQPVGIFSGSSTNN-----QLFGNVNNTPTPASGLFAQSNTNGLFANSKAT--GQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNA--PNSGLF 4848
            LFGT   T S T    GLF T  S    + +LFG +T      +QP Q+GGLFGS  T T S  L             S GLFG +      QQ  G+F S+    +   Q  G+F  ++T+       LFGN   T  PA        T GLF  +      Q+ GLFG ++     + GLFGS  TN  T  GLFGN S+T    G+FG+ A     GLF
Sbjct:    3 LFGT--NTTSQTPAGGGLFGTTTSQSAQTGSLFGTAT------SQPQQTGGLFGSTATQTPSSQL------------QSTGLFGSTTATSQPQQTGGLFGSTTTTTSQPQQTGGLFGATATSQPQSTGGLFGNTTTTSQPA-------QTVGLFGTTTQPQPAQSGGLFGSATQQKPATGGLFGSTTTN--TGAGLFGNTSNTIGGGGLFGQTAKPATGGLF 195          
BLAST of SMED30034098 vs. TrEMBL
Match: G8C1A6 (Peptidase S59 domain-containing protein OS=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) OX=1071381 GN=TPHA0N01530 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.658e-13
Identity = 104/276 (37.68%), Postives = 136/276 (49.28%), Query Frame = 1
Query: 4129 IFTSSTAKPAQSLFSTPISTK-TTGLFDNSSGSHQSTGLFGTAIQTASTTKESSGLFN----TPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTAS--------GGLFXXXXXXXXXXXXXXXLFGKSN--QQGAGIFAS------------SNNV---NANTTQPVGIFSGSSTNNQ----LFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKN--APNSGLF 4848
            +F  S ++P+  LF    +T+ + GLF  S+ +  S GLFG   Q+ +   +SSGLF     T   S  LFG         AQPS +GGLFG   NT          GGLFG   +  +       LFG++N  QQ  GIF +            +NN    N NT Q  G+F  ++TNNQ    LFG  NN+  P+ GLF QSNT         T  + GLFG S+     SSGLFG   T    + GLFGNK + +P+ G+FG    AP+ GLF
Sbjct:  283 LFGQSNSQPSGGLFGQNNTTQPSGGLFGQSNTTQPSGGLFG---QSNTNQPQSSGLFGQSNTTQQPSGGLFG--------AAQPSSAGGLFGQNNNTFGQNNNSQQPGGLFGQNNNNTNQQSGG--LFGQNNNQQQAGGIFGAKPAATTGGLFGQANNAFGQNNNTQQTGGLFGQANTNNQSSGGLFGQNNNS-QPSGGLFGQSNT---------TQPSGGLFGQSNTNQPQSSGLFGQSNTAQQPSGGLFGNKPA-APAGGLFGSKPMAPSGGLF 534          
BLAST of SMED30034098 vs. TrEMBL
Match: A0A2T9YGH8 (RRM domain-containing protein OS=Smittium simulii OX=133385 GN=BB561_004416 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.979e-11
Identity = 124/347 (35.73%), Postives = 183/347 (52.74%), Query Frame = 1
Query: 3949 TSVKPSGTLFGNSG--GSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPI--------STKTTGLFDNS--SGSHQSTGLFGTAIQTASTTKESSGLFNTP-----ISSNNLFGNSTPYTN-------NTAQPS---QSGGLFGS---GTNTASGGLFXXXXXXXXXXXXXXXLFG----KSNQQGAGIFASSNNVNANTTQPVGIFSGS--STNNQ---LFGNVN-NTPTPASGLF------AQSNTNGLFANSKAT--GQTTGLFG---PSSNLSTTSSGLFGSPQTNSSTNE-GLFGNKSSTS--PSTGIFGKN 4827
            T +  S   FG++   G+TQ + +F S+  ++   S G+F +++      SA    S QNT +F S+  +P  +  ST +        + ++TGLF ++  + + QSTGLFG+    A+T  +S+GLF +        S  LFGN+ P  N        +AQP+   QS GLFGS    TNT S GLF    +  +TN  S GLFG     +N Q AG+F S+    A  TQ  G+F  +  +TN Q   LFG+    T T ++GLF      A + + GLF +++ T   Q+TGLFG   P++N  T ++GLFGS Q  ++T   GLFG+   T+   S G+FG N
Sbjct:  298 TDMNQSSGFFGSAQPMGNTQTTGMFGSTQPAANTQSTGMFGSTQPAANTQSAGLFGSTQNTGMFGST--QPTANTQSTGLFGSTQPTTNAQSTGLFGSTQPTTNAQSTGLFGSTQPAANT--QSAGLFGSAQPAANTQSTGLFGNTQPTANTQNTGLFGSAQPAANTQSTGLFGSTQPTTNTQSTGLF--GSTQPTTNAQSTGLFGSTQPAANTQSAGLFGSAQ--PAANTQSTGLFGSTQPTTNTQSTGLFGSTQPATNTQSTGLFGSTQPAANTQSTGLFGSAQPTTNTQSTGLFGNTQPTAN--TQNTGLFGSAQPAANTQSTGLFGSTQPTANTQSAGLFGNN 634          

HSP 2 Score: 73.9442 bits (180), Expect = 3.197e-9
Identity = 139/407 (34.15%), Postives = 197/407 (48.40%), Query Frame = 1
Query: 3580 NTSSTGLFNIAPSTKPA---QSTAVSVSTTIPQSIFSTPTFTNQKTDLFGNSNLTQPSGVFD----TSSSTKQNLFGKSNISSSEITSGASQPHGLFAT--PTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVK--PSGTLFGNSG--GSTQNSNLFASSLTSSPAPSNGIF------TTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNS--SGSHQSTGLFGTAIQTASTTKESSGLFN-----TPISSNNLFGNSTPYTNNTAQPSQSGGLFGSG---TNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGS--STNNQ---LFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFG 4698
            NT +TG+F    ST+PA   QST +  ST         P    Q   LFG+   TQ +G+F     T+++    LFG     S++ T+ A Q  GLF +  PT++ QST LFG+    A   T+   +F S+       S  LFGN+    +TQN+ LF S+  ++   S G+F      T ++S  L  S    T+ Q+T +F S+  +PA        +T++ GLF ++  + + QSTGLFG+   T +T  +S+GLF      T   S  LFG++ P  N     +QS GLFGS    TNT S GLFG+ Q T             +N Q  G+F S+    A  TQ  G+F  +  + N Q   LFGN        S L  Q+        S  +GQT+GLFG
Sbjct:  315 NTQTTGMFG---STQPAANTQSTGMFGSTQ--------PAANTQSAGLFGS---TQNTGMFGSTQPTANTQSTGLFG-----STQPTTNA-QSTGLFGSTQPTTNAQSTGLFGSTQPAAN--TQSAGLFGSAQPAANTQSTGLFGNTQPTANTQNTGLFGSAQPAANTQSTGLFGSTQPTTNTQSTGLFGSTQPTTNAQSTGLFGST--QPA-------ANTQSAGLFGSAQPAANTQSTGLFGSTQPTTNT--QSTGLFGSTQPATNTQSTGLFGSTQPAAN-----TQSTGLFGSAQPTTNTQSTGLFGNTQPT-------------ANTQNTGLFGSAQP--AANTQSTGLFGSTQPTANTQSAGLFGNNQ------SSLKRQNQNISSLNFSAGSGQTSGLFG 662          

HSP 3 Score: 72.7886 bits (177), Expect = 7.036e-9
Identity = 118/354 (33.33%), Postives = 178/354 (50.28%), Query Frame = 1
Query: 3463 QPHANIQPSLLFNVAIAEKSSSPSTNPPRVGL----------SSSAFTLNTSSTGLFNIAPSTKPAQSTAVSVSTTIPQSIFSTPTFTNQKTDLFGNSNL---TQPSGVFDTSS----STKQNLFGKSNISSSEITSGASQPHGLF--ATPTSSKQSTALFGNADTPATQTTKPQSIFSS---STSVKPSGTLFGNS--GGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNS--SGSHQSTGLFGTAIQTASTTKESSGLF-NTPISSN----NLFGNSTPYTNNTAQPSQSGGLFGS---GTNTASGGLF 4422
            QP AN Q + +F       S+ P+ N    GL           S+  T NT STGLF     T  AQST +  ST         PT   Q T LFG++     TQ +G+F ++     +    LFG +  +++      +Q  GLF  A P ++ QST LFG+  T  T  T+   +F S   +T+ + +G LFG++    +TQ++ LF S+  ++   S G+F +++           T+ Q+T +F S+  +PA        +T++TGLF ++  + + QSTGLFG+A  T +T  +S+GLF NT  ++N     LFG++ P  N     +QS GLFGS     NT S GLF
Sbjct:  326 QPAANTQSTGMFG------STQPAANTQSAGLFGSTQNTGMFGSTQPTANTQSTGLFGSTQPTTNAQSTGLFGST--------QPTTNAQSTGLFGSTQPAANTQSAGLFGSAQPAANTQSTGLFGNTQPTAN------TQNTGLFGSAQPAANTQSTGLFGS--TQPTTNTQSTGLFGSTQPTTNAQSTG-LFGSTQPAANTQSAGLFGSAQPAANTQSTGLFGSTQ---------PTTNTQSTGLFGST--QPA-------TNTQSTGLFGSTQPAANTQSTGLFGSAQPTTNT--QSTGLFGNTQPTANTQNTGLFGSAQPAAN-----TQSTGLFGSTQPTANTQSAGLF 631          
BLAST of SMED30034098 vs. TrEMBL
Match: A0A1Y5I326 (Nucleoporin complex subunit 54-domain-containing protein OS=Ostreococcus tauri OX=70448 GN=BE221DRAFT_84359 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.022e-10
Identity = 88/245 (35.92%), Postives = 131/245 (53.47%), Query Frame = 1
Query: 4165 LFSTPISTKTTG--LFDNSSGSHQSTGLFGTAIQTASTTKESSGLFNT-PISS--NNLFGNSTPYTNNT-----AQPSQS--GGLFGSGT--NTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGA----GIFASSNNVNANTTQPVGIFSGS---STNNQLFGNVNNTPTPASGLF----AQSNTNGLFANSKATGQTTG-LFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFG 4821
            LF  P    +TG  LF  +  +    GLFG+A   +S+   + GLF   P +S    LFG++TP +++      A P+ S  GGLFGS T  ++++GGLFG+  +  +       LFG +    A    G+FAS+   +  TT   G+F  +   ST   LFG+  + PT ++GLF    A S   G+F ++     T+G LFG ++  +TTS GLFGS    SS   GLFG+ + ++PS G+FG
Sbjct:  126 LFGGPAPAASTGGGLFGAAPAASTGGGLFGSATPASSS---AGGLFGAAPAASTGGGLFGSATPASSSAGGLFGAAPAASTGGGLFGSATPASSSAGGLFGAAPAASTGGG----LFGSATPTPATTSGGLFASTAASSPATTS-GGLFGAAPAASTGGGLFGS--SAPTSSAGLFGAAPAASTGGGMFGSAAPASSTSGGLFGSAAPTATTSGGLFGSTAPASSAGGGLFGSAAPSTPSGGLFG 360          

HSP 2 Score: 65.4698 bits (158), Expect = 1.141e-6
Identity = 82/225 (36.44%), Postives = 114/225 (50.67%), Query Frame = 1
Query: 4237 GLFGTAIQTASTTKESSGLFNT-PISS--NNLFGNSTPYTNNTAQPSQSGGLFGSG-TNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQ--GAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTPTPAS---GLFA-------QSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKS-STSPSTGIFGKNAPNS----GLF 4848
            GLFG     AST     GLF   P +S    LFG++TP +      S +GGLFG+    +  GGLFGS     S+      LFG +     G G+F S+   +++     G    +ST   LFG+   TPTPA+   GLFA        + + GLF  + A     GLFG  S+  T+S+GLFG+    +ST  G+FG+ + ++S S G+FG  AP +    GLF
Sbjct:  125 GLFGGPAPAAST---GGGLFGAAPAASTGGGLFGSATPAS------SSAGGLFGAAPAASTGGGLFGSATPASSSAGG---LFGAAPAASTGGGLFGSATPASSSAGGLFGAAPAASTGGGLFGSA--TPTPATTSGGLFASTAASSPATTSGGLFGAAPAASTGGGLFG--SSAPTSSAGLFGA-APAASTGGGMFGSAAPASSTSGGLFGSAAPTATTSGGLF 332          
BLAST of SMED30034098 vs. TrEMBL
Match: A0A376B6T2 (Peptidase S59 domain-containing protein OS=Saccharomycodes ludwigii OX=36035 GN=SCODWIG_02102 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.096e-10
Identity = 103/304 (33.88%), Postives = 148/304 (48.68%), Query Frame = 1
Query: 3967 GTLFGNSGGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNIS--ASSNTSIQNTNIFTSSTAKPAQS---LFSTPISTKTTGLFDNSSGSHQSTGLFGTAIQTASTTKES-SGLFNTPISSN-----NLFGNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFXXXXXXXXXXXXXXXLFGKSNQ-QGAGIFA--SSNNVNANTTQPVGIFSGS-STNNQLFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFG--NKSSTSPSTGIFGKN 4827
            G+LFG +  +TQ + LF  S T +     G+F  + +     S    +NT+ Q T +F  +          LF    +T+ TGLF  ++ + Q+TGLFG A    +  + +  GLF    ++N      LFG     TNNT    Q+ GLFG   N A+G                 GLFG++N  QG G+F   ++ N N NT    G+F    +T   LFGN+NN  T       Q+ T GLF  +     T GLFG ++N +  S+GLFG   TN+S + GLFG  N + T+   G+FG+N
Sbjct:  369 GSLFGQANTATQGTGLFGQSNTVNRGT--GLFGQANTGNQGTSLFGQNNTTSQGTGLFGQNNNNTNTQGTGLFGQTNNTQATGLFGQNNNATQNTGLFGQANNNTNNNQATTGGLFGQANNNNANQGTGLFG----QTNNT----QNTGLFGQTNNNATG----------------TGLFGQNNNTQGTGLFGQNNNMNNNNNTQGSTGLFGAKPATGGGLFGNMNNNNTAG-----QTGTGGLFGQATNNQGTGGLFGQNNNNTARSTGLFGQTNTNNSASGGLFGQNNNNQTTSGGGLFGQN 641          
BLAST of SMED30034098 vs. TrEMBL
Match: I2GXE4 (Peptidase S59 domain-containing protein OS=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) OX=1071380 GN=TBLA0A10170 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.255e-9
Identity = 129/429 (30.07%), Postives = 198/429 (46.15%), Query Frame = 1
Query: 3700 QKTDLFGNSNLTQP-SGVFDTSSSTKQN-LFGKSNISSSEITSGASQPHGLFATPTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVKPSGTLFGNSGGST---------QNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQS--LFSTPISTKTTGLFDNSSGSHQ-STGLFG------TAIQTASTTKESSGLFNTPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQ---------------LFGNVNNTPTPASGLFAQSNTN----GLFANSKATGQTTGLFGPSSN---LSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNAPNS----GLF 4848
            Q+ + FG +N +   +G+F  ++  K N LFG++N +S      A Q  G F    +++Q+  +FG            QS   +S +   +G LFGN  G++         Q+  LF  S T+S   SN +F  S +N            Q+  +F  ++    QS  LF  P + ++ GLF  S+ + Q    LFG      +     + T+ S GLF    +S +LF          +Q +Q+ G FGS  N+ +GG+FG   +         G     +QQG G+F  +N+      QP G+F G + + Q               LFGN NN+      LF  +N+     GLF +  AT Q+ GLFG +SN   L+  + GLFG+  +NS+   GL GN ++ S + G+FG +A NS    GLF
Sbjct:  288 QQNNAFGTNNASNAGTGLFGQNNGQKGNGLFGQNNNNSFGNN--AQQAGGFFGQSANNQQAGGIFG------------QSNMQTSNNSNAAGGLFGNKQGTSLFGQATSTQQSGGLFGQSNTNSNQQSNNLFGQSNNN------------QSGGLFGQNSGSQQQSGSLFGQPNNQQSGGLFGQSNNNQQQGRSLFGQTNSNFSGFGQQTQTQASGGLFGNKSTSGSLF----------SQSNQNNG-FGSNMNSNTGGIFGQNNNQQQQGGGLFGQNNNQSQQGGGLFGQNNS----QQQPGGLF-GQNNSQQSNSLFGNKPGGSAGGLFGNNNNSSGQPGSLFGNNNSQQQNGGLFGSRPAT-QSNGLFGNNSNQNSLTNNTGGLFGNKTSNSA---GLLGNNTAASNAGGLFGNSAANSTTSGGLF 670          
BLAST of SMED30034098 vs. Ensembl Yeast
Match: NUP145 (Essential protein with distinct roles in two nuclear pore subcomplexes; catalyzes its own proteolytic cleavage in vivo to generate a C-terminal fragment that is a structural component of the Nup84p subcomplex (with roles in NPC biogenesis and localization of genes to the nuclear periphery), and an N-terminal fragment that is one of several FG-nucleoporins within the NPC central core directly responsible for nucleocytoplasmic transport; homologous to human NUP98 [Source:SGD;Acc:S000003060])

HSP 1 Score: 58.151 bits (139), Expect = 1.040e-8
Identity = 77/229 (33.62%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 4225 HQSTGLFGTAIQTA--STTKESSGLFNTPISSNNLF---GNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGS------STNNQLFGNVNNTPTPAS----GLFAQSNT-----NGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNA---PNSG 4842
             +STGLFG     A  ST   S GLFN   ++N++     N++ + N  AQPS  GGLFG+  NT S                          + AG    +NN  AN+T   G+FSGS      + N  LFGN NN    ++    GLF +  T      GLF NS +T  TTGLFG +                N+ ++ G+FG K   S + G+FG N    P SG
Sbjct:   35 QKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPS--GGLFGATNNTTS--------------------------KSAGSLFGNNNATANSTGSTGLFSGSNNIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSN----------------NTQSSTGIFGQKPGASTTGGLFGNNGASFPRSG 219          

HSP 2 Score: 56.9954 bits (136), Expect = 2.338e-8
Identity = 79/205 (38.54%), Postives = 109/205 (53.17%), Query Frame = 1
Query: 4291 LFNTPISSNNLFGN---STPYTNNTAQPS-------QSGGLFG-------SGTNTASGGLFXXXXXXXXXXX--XXXXLFG-KSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTP--TPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSS----GLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKN 4827
            +FN  ++S   FGN   STP T+  AQPS       +S GLFG       + T + SGGLF +  +  S +Q  ++  LFG K  Q   G+F ++NN  + +       +GS     LFGN N T   T ++GLF+ SN      N  ++ Q  GLFG S+N + TS+    GLFG P T  +   GLFGN SST+ +TG+FG N
Sbjct:    1 MFNKSVNSGFTFGNQNTSTP-TSTPAQPSSSLQFPQKSTGLFGNVNVNANTSTPSPSGGLFNANSNANSISQQPANNSLFGNKPAQPSGGLFGATNNTTSKS-------AGS-----LFGNNNATANSTGSTGLFSGSN------NIASSTQNGGLFGNSNNNNITSTTQNGGLFGKPTTTPAGAGGLFGNSSSTNSTTGLFGSN 186          
BLAST of SMED30034098 vs. Planmine SMEST
Match: SMESG000022171.1 (SMESG000022171.1)

HSP 1 Score: 1960.27 bits (5077), Expect = 0.000e+0
Identity = 1157/1190 (97.23%), Postives = 1163/1190 (97.73%), Query Frame = 1
Query: 1405 TSQIETPISQINLFVTPNSNNPDPQLNIFGTK--NKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTPQSNLFGNTNATFQKSIFSTVTPETSAGQSPLTSISNIDSNSQHVSSFQSRNKSNIQIGNQNKVLTPGIFGAXXXXXXXXXXXXXXXXXXXXXXXEIETENPPKSNSSQVSISDTSPGKLPENKISAHNKNSQKFNLEDHNKQNIKSENVAXXXXXXXXXXXXXXXXXVIDNFLPNAIECLEKQINDIKTNTKHIIDKSKNSLDNGEINKEISKMFHDLEKNFXXXXXXXXXXXXXXXXXXXLCQDIEITLEFTTRFQEAILDSKINHKHFRSAPNPLLKKTSVNLNELAKKVGFYLQDLEDALDYVESKKDFKIISKNKNAQLQDIKQTLKSNMKVISVERSKLDLIKEHIDDSSSEEIDFHHSHLQARNVNKEMEEYLHALMCRRPVNNISCKLPEXXXXXXXXXXXXXXXXNNLNASRPANESIKTESKLTTSKPLIVKLVEKDSYKCNQDSKSNNVASTGDVHYSGNVLANKNAGISTFNEIAPKLENLDPIKSTEVKLKPEAFNGDNILKPSSSKDSGFFDVSHAKTVPVTNLXXXXXXXXXXXXVQSLSDNISQSRNESSQLNASFPSIVPNCSKPVDIIQSNSVIKQTDDLHENSNKTPRSTTATNQLSDITLQPHANIQPSLLFNVAIAEKSSSPSTNPPRVGLSSSAFTLNTSSTGLFNIAPSTKPAQSTAVSVSTTIPQSIFSTPTFTNQKTDLFGNSNLTQPSGVFDTSSSTKQNLFGKSNISSSEITSGASQPHGLFATPTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVKPSGTLFGNSGGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNSSGSHQSTGLFGTAIQTASTTKESSGLFNTPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFXXXXXXXXXXXXXXXLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNAPNSGLFXXXXXXXXXXXXXIFGSSXXXXXXXXXXXXXSIFATPPQN 4968
            T  I+ P SQ NLF   NS+ P  Q N+FGTK  +KPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPT QSNLFGNTNATFQKSIFSTVTPETSAGQSPLTSISNIDSNSQHVSSFQSRNKSNIQIGNQNKVLTPGIFGASNSDSSYLQSSKSTQQQKNSKLTEI TENPPKSNSSQVSISDTS GKLPENKISAHNKNSQKFNLEDHNKQNIKSENVATRRSIKISKSKSD K DVIDNFLPNAIECLEKQINDIKTNTKHIIDKSKNSLDNGEINKEISKMFHDLEKNFIDVDKINMKNKNIIENSKSLCQDIEITLEFTTRFQEAILDSKINHKHFRSAPNPLLKKTSVNLNELAKKVGFYLQDLEDALDYVESKKDFKIISKNKNAQLQDIKQTLKSNMKVISVERSKLDLIKEHIDDSSSEEIDFHHSHLQ RNVNKEMEEYL+ALMCRRPVNNISCKLPETKQ IKSKKIISTPPKNN NASRPANESIKTESKLTTSKPLIVKLVEKDSYKCNQDSKSNNVASTGDVHYSGNVLANKNAGISTFNEIAPKLENLDPIKSTEVKLKPEAFNGDNILKPSSSKDSGFFDVSHAKTVPVTNLTPISSTIATPTIVQSLSDNISQSRNESSQLNASFPSIVPNCSKPVDIIQSNSVIKQTDDLHENSNKTPRSTTATNQLSDI LQPHANIQPSLLFNVAIAEKSSSPSTNPPRVGLSSSAFTLNTSSTGLFNIAPSTKPAQSTAVSVSTTIPQSIFSTPTFTNQKTDLFGNSNLTQPSGVF TSSSTKQNLFGKSNISSSEITSGASQPHGLFATPTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVKPSGTLFGNSGGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNSSGSHQSTGLFGTAIQTASTTKESSGLFNTPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFGSPQSTGSTNQSSGGLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSP TNSSTNEGLFGNKSSTSPSTGIFGKNAPNSGLFNSSNQTNNQLSSNIFGSSLPQNQT+Q LP NSIFATPPQN
Sbjct:  688 TKTIDKPTSQSNLFGNTNSDVPSSQGNLFGTKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNLFGNTNATFQKSIFSTVTPETSAGQSPLTSISNIDSNSQHVSSFQSRNKSNIQIGNQNKVLTPGIFGASNSDSSYLQSSKSTQQQKNSKLTEIGTENPPKSNSSQVSISDTSTGKLPENKISAHNKNSQKFNLEDHNKQNIKSENVATRRSIKISKSKSDNKGDVIDNFLPNAIECLEKQINDIKTNTKHIIDKSKNSLDNGEINKEISKMFHDLEKNFIDVDKINMKNKNIIENSKSLCQDIEITLEFTTRFQEAILDSKINHKHFRSAPNPLLKKTSVNLNELAKKVGFYLQDLEDALDYVESKKDFKIISKNKNAQLQDIKQTLKSNMKVISVERSKLDLIKEHIDDSSSEEIDFHHSHLQVRNVNKEMEEYLYALMCRRPVNNISCKLPETKQAIKSKKIISTPPKNNFNASRPANESIKTESKLTTSKPLIVKLVEKDSYKCNQDSKSNNVASTGDVHYSGNVLANKNAGISTFNEIAPKLENLDPIKSTEVKLKPEAFNGDNILKPSSSKDSGFFDVSHAKTVPVTNLTPISSTIATPTIVQSLSDNISQSRNESSQLNASFPSIVPNCSKPVDIIQSNSVIKQTDDLHENSNKTPRSTTATNQLSDINLQPHANIQPSLLFNVAIAEKSSSPSTNPPRVGLSSSAFTLNTSSTGLFNIAPSTKPAQSTAVSVSTTIPQSIFSTPTFTNQKTDLFGNSNLTQPSGVFATSSSTKQNLFGKSNISSSEITSGASQPHGLFATPTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVKPSGTLFGNSGGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTSIQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNSSGSHQSTGLFGTAIQTASTTKESSGLFNTPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTASGGLFGSPQSTGSTNQSSGGLFGKSNQQGAGIFASSNNVNANTTQPVGIFSGSSTNNQLFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNLSTTSSGLFGSPPTNSSTNEGLFGNKSSTSPSTGIFGKNAPNSGLFNSSNQTNNQLSSNIFGSSLPQNQTSQSLPSNSIFATPPQN 1877          

HSP 2 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 322/326 (98.77%), Postives = 324/326 (99.39%), Query Frame = 3
Query:   33 MSDDILNLQPLHPFKSTNKDISKGIRYSAIDSHSGLLISVADKEIYFYDTNTYEDHSINSKLRRDKSIDFEKSFSINCEFDVSWVEFNCSGSYLFVATTSNSNYLNTIKIIDVAKTLKERKEVAICIFKPNIDSKLVDLKWHPCKTDILLLVLNDSVHICHVKANELVIMHARPNAFCVSWSPKGKQFSVIMQKVESKKFVLNQYDINFVEKRSTEIPNASNDFKVSFDLVPIEICWYATYSVIIGFRGVPNGDEQFKIFVCRFAIKTSKIQVLPDVRSSSDCINRNPGPCARLYYLHIPDWKAIILVNNSAEDAVVFEYDSNDDV 1010
            MSDDILNLQPLHPFKSTNKDI KGIRYSAIDSHSGLLISVADKEIYFYDTNTYEDHSINSKLRRDKSIDFEKSFSINCEFDVSWVEFNCSGSYLFVATTSNSNYLNTIKIIDVAKTL ERKEVAICIFKPNIDSKLVDLKWHPC+TDILLLVLNDSVHICHVKANELVIMHARPNAFCVSWSPKGKQFSVIMQKVESKKFVLNQYDINFVEKRSTEIPNASNDFKVSFDLVPIEICWYATYSVIIGFRGVPNGDEQFKIFVCRFAIKTSKIQVLPDVRSSSDCINRNPGPCARLYYLHIPDWKAIILVNNSAEDAVVFEYDSNDD+
Sbjct:    1 MSDDILNLQPLHPFKSTNKDICKGIRYSAIDSHSGLLISVADKEIYFYDTNTYEDHSINSKLRRDKSIDFEKSFSINCEFDVSWVEFNCSGSYLFVATTSNSNYLNTIKIIDVAKTLIERKEVAICIFKPNIDSKLVDLKWHPCETDILLLVLNDSVHICHVKANELVIMHARPNAFCVSWSPKGKQFSVIMQKVESKKFVLNQYDINFVEKRSTEIPNASNDFKVSFDLVPIEICWYATYSVIIGFRGVPNGDEQFKIFVCRFAIKTSKIQVLPDVRSSSDCINRNPGPCARLYYLHIPDWKAIILVNNSAEDAVVFEYDSNDDL 326          

HSP 3 Score: 389.037 bits (998), Expect = 0.000e+0
Identity = 195/233 (83.69%), Postives = 201/233 (86.27%), Query Frame = 1
Query: 1048 LHTITTYCLPIEGNVVGLSIDYTSIKTVPESWLPAGFETSASNPLLFLKLSNDDCFGCYLLHSQKKINIYNKMFISSISPEKGDRNKNDNIIQSDVPGERNQNCFLTQPLMNLDNHLEITSQIETPISQINLFVTPNSNNPDPQLNIFGTKNKPTSQSNLFGTPSSDV-------------PSSQGNLFGTKTIDKPTPQSNLFGNTNATF---QKSIFSTVTPETSAGQSPL 1698
            LHTITTYCLPIEGNVVGLSIDYTSIKTVPESWLPAGFETSASNPLLFLKLSNDDCFGCYLLHSQKKINIY+KMFISSISPEKGDRNKNDNIIQSDV GERNQNCFLTQPLMNLDNHLEITSQIETPISQINLFVTPNSNNPDPQLNIFGTKNKPTSQSNLFGTPSSDV              SSQGNLFGTKTIDKPT QSNLFG  ++     Q ++F T T +    QS L
Sbjct:  326 LHTITTYCLPIEGNVVGLSIDYTSIKTVPESWLPAGFETSASNPLLFLKLSNDDCFGCYLLHSQKKINIYDKMFISSISPEKGDRNKNDNIIQSDVSGERNQNCFLTQPLMNLDNHLEITSQIETPISQINLFVTPNSNNPDPQLNIFGTKNKPTSQSNLFGTPSSDVTQYEQNQRFVCILSSSQGNLFGTKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNL 558          

HSP 4 Score: 107.071 bits (266), Expect = 9.763e-23
Identity = 70/123 (56.91%), Postives = 81/123 (65.85%), Query Frame = 1
Query: 1342 ERNQN--CFLTQPLMNLDNHLEITSQIETPISQINLFVTPNSNNPDPQLNIFGTK--NKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTPQSNLFGNTNATFQKSIFSTVTPETSAGQSPL 1698
            E+NQ   C L+    NL      T  I+ P SQ NLF TP+S+ P  Q N+FGTK  +KPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPT QSNLFG       +++F T T +    QS L
Sbjct:  497 EQNQRFVCILSSSQGNLFG----TKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNLFGT-----PRNLFGTKTIDKPTSQSNL 610          

HSP 5 Score: 97.8265 bits (242), Expect = 6.163e-20
Identity = 64/125 (51.20%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 1405 TSQIETPISQINLFVTPNSNNPDPQLNIFGTK------------------------NKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTPQSNLFGNTNATF---QKSIFSTVTPETSAGQSPL 1698
            T  I+ P SQ NLF TP+S+ P  Q N+FGTK                        +KPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPT QSNLFG  ++     Q ++F T T +    QS L
Sbjct:  546 TKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNLFGTPRNLFGTKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNLFGTPSSDVPSSQGNLFGTKTIDKPTSQSNL 670          
The following BLAST results are available for this feature:
BLAST of SMED30034098 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P49687|NU145_YEAST7.221e-733.62Nucleoporin NUP145 OS=Saccharomyces cerevisiae (st... [more]
sp|G0S4X2|NUP49_CHATD1.676e-636.49Nucleoporin NUP49 OS=Chaetomium thermophilum (stra... [more]
back to top
BLAST of SMED30034098 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G8C1A67.658e-1337.68Peptidase S59 domain-containing protein OS=Tetrapi... [more]
A0A2T9YGH83.979e-1135.73RRM domain-containing protein OS=Smittium simulii ... [more]
A0A1Y5I3265.022e-1035.92Nucleoporin complex subunit 54-domain-containing p... [more]
A0A376B6T27.096e-1033.88Peptidase S59 domain-containing protein OS=Sacchar... [more]
I2GXE46.255e-930.07Peptidase S59 domain-containing protein OS=Tetrapi... [more]
back to top
BLAST of SMED30034098 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NUP1451.040e-833.62Essential protein with distinct roles in two nucle... [more]
back to top
BLAST of SMED30034098 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034098 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022171.19.763e-2397.23SMESG000022171.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034098 ID=SMED30034098|Name=SMED30034098|organism=Schmidtea mediterranea sexual|type=transcript|length=4968bp
CCGATCTCGAGTATCAATAAAAAACTTTTGAAATGTCAGATGACATATTA
AATTTACAACCTCTACATCCTTTTAAATCTACTAATAAAGATATTTCCAA
AGGTATTAGATATAGTGCTATCGATTCGCACTCTGGTTTGCTTATTTCTG
TGGCTGATAAAGAAATATATTTTTATGACACCAACACTTATGAAGATCAT
AGTATAAATTCAAAATTAAGAAGAGATAAATCAATTGATTTCGAAAAATC
TTTTTCAATTAATTGTGAATTTGATGTATCATGGGTTGAATTTAATTGTT
CTGGCTCATATCTCTTCGTGGCAACAACATCAAACAGCAATTATTTAAAT
ACTATTAAAATAATTGATGTTGCTAAAACATTAAAAGAACGCAAAGAAGT
TGCCATATGCATATTTAAGCCCAACATTGACTCGAAATTAGTGGATTTGA
AATGGCATCCGTGTAAAACTGATATTTTATTATTAGTTCTGAATGATTCT
GTTCATATATGCCATGTTAAAGCCAATGAATTAGTTATAATGCATGCTAG
GCCCAATGCATTTTGTGTATCATGGAGTCCAAAAGGAAAACAGTTTTCTG
TTATTATGCAAAAAGTAGAATCTAAAAAATTCGTTTTAAATCAGTATGAT
ATTAATTTTGTTGAAAAACGCTCGACAGAAATTCCAAACGCATCGAATGA
CTTTAAAGTCTCATTTGATTTGGTTCCAATTGAAATATGCTGGTACGCGA
CTTATTCTGTAATAATCGGATTTCGTGGAGTTCCTAACGGAGATGAGCAG
TTCAAGATCTTCGTTTGCAGATTTGCAATTAAAACAAGTAAGATTCAAGT
ATTGCCAGACGTCAGGAGTTCGTCAGATTGTATAAATCGTAACCCAGGTC
CATGTGCTCGGTTGTATTATTTGCACATACCTGATTGGAAAGCTATTATT
TTGGTGAACAATAGTGCAGAGGATGCAGTAGTTTTTGAATATGACTCTAA
TGATGACGTATGACTTTTGCTCTTACTTTTTATTTACTTGTACATAGCTT
CATACAATTACAACATATTGCTTACCTATTGAAGGTAATGTGGTTGGTCT
TTCAATTGACTACACATCAATTAAAACCGTTCCTGAAAGTTGGTTACCGG
CTGGATTTGAAACATCTGCTTCAAATCCATTGCTATTTCTTAAATTGAGC
AATGACGATTGTTTTGGATGTTACTTACTGCATTCACAAAAGAAAATAAA
TATTTATAACAAAATGTTTATAAGTAGTATTAGTCCTGAAAAAGGTGATA
GAAATAAAAATGATAATATTATCCAATCGGATGTACCTGGAGAGCGCAAT
CAAAACTGCTTTTTAACTCAACCACTTATGAACTTAGATAATCACTTAGA
AATTACTTCACAGATAGAGACACCGATTTCTCAAATAAATTTATTTGTAA
CTCCTAATTCAAACAATCCTGATCCTCAATTGAACATATTCGGAACGAAA
AATAAACCGACTTCACAATCCAATTTATTCGGAACTCCAAGTTCGGATGT
TCCCAGTTCTCAAGGAAATCTATTCGGAACGAAAACTATCGATAAACCGA
CTCCGCAATCCAATTTATTCGGAAATACAAATGCCACTTTTCAAAAATCC
ATATTCAGTACAGTAACACCAGAAACCTCTGCAGGTCAATCGCCATTAAC
CTCAATTTCAAATATCGACAGCAATTCTCAACATGTATCTTCATTTCAAA
GCCGTAACAAATCCAATATTCAAATTGGAAATCAAAATAAAGTCTTAACT
CCTGGAATATTTGGAGCATCCAATTCTGATTCATCATATTTACAATCATC
TAAATCTACACAACAGCAGAAAAACTCAAAGCTAACAGAAATCGAAACTG
AAAACCCACCAAAGTCAAATAGTTCCCAAGTGTCAATTTCTGATACAAGC
CCCGGAAAATTGCCGGAAAATAAAATTAGTGCTCACAATAAAAATTCACA
GAAATTTAATTTGGAAGATCACAACAAACAAAATATTAAATCGGAAAATG
TTGCTACTCGACGATCAATTAAAATATCAAAAAGCAAGAGCGATACTAAG
AGTGATGTGATTGATAATTTTCTTCCGAACGCCATAGAATGTTTAGAAAA
ACAGATAAACGATATAAAAACCAATACAAAACATATCATAGATAAATCTA
AGAACTCATTAGATAACGGTGAAATTAATAAAGAAATTTCGAAAATGTTT
CATGATTTGGAAAAGAATTTTATCGACGTAGATAAAATCAATATGAAAAA
TAAGAACATTATAGAAAATTCTAAATCGCTCTGTCAAGATATTGAAATCA
CTTTAGAATTCACAACTCGCTTCCAGGAAGCTATTTTAGATTCAAAAATA
AATCATAAGCATTTTAGGTCTGCTCCAAATCCTTTATTAAAGAAAACATC
TGTAAATCTCAACGAATTAGCCAAAAAAGTCGGTTTTTATCTGCAAGATC
TTGAAGATGCTTTGGATTACGTCGAATCCAAGAAAGATTTCAAAATTATA
TCAAAAAATAAAAATGCGCAATTACAGGACATAAAGCAAACATTGAAATC
CAATATGAAAGTCATTTCAGTTGAGAGATCTAAGCTCGATCTAATCAAAG
AGCATATTGACGATTCATCTAGCGAAGAGATCGATTTCCATCATTCACAC
TTGCAAGCAAGAAATGTGAACAAGGAAATGGAAGAATATCTTCATGCGTT
AATGTGTCGACGGCCTGTGAATAATATCTCCTGCAAATTGCCAGAAACTA
AGCAGCCTATTAAAAGTAAAAAAATAATTTCGACTCCACCCAAAAACAAT
TTAAACGCCAGCAGACCCGCAAACGAATCTATTAAAACCGAATCGAAATT
AACAACTTCAAAACCGCTAATTGTAAAGCTGGTCGAAAAAGATTCATATA
AATGCAATCAAGACTCAAAAAGTAATAATGTGGCATCAACAGGTGATGTT
CACTATTCAGGAAATGTATTGGCCAATAAAAATGCAGGAATATCAACTTT
CAATGAAATTGCTCCCAAATTAGAAAATCTAGATCCTATTAAAAGCACCG
AGGTTAAACTGAAACCGGAAGCGTTTAATGGTGATAATATTTTGAAACCA
TCCAGTTCCAAGGATTCCGGGTTTTTCGATGTGTCTCATGCAAAAACCGT
TCCAGTTACCAATCTTACACCGATTTCGAGTACGATAGCAACACCAACTA
TTGTACAATCATTATCTGACAACATAAGTCAATCAAGAAATGAATCTAGC
CAACTTAATGCTTCATTCCCATCGATTGTTCCCAATTGTTCTAAACCCGT
TGACATTATCCAATCCAATTCAGTTATCAAACAAACGGACGACTTGCACG
AAAATTCCAATAAAACTCCGCGATCAACAACTGCAACAAATCAATTGAGC
GATATCACTTTACAGCCACATGCAAACATTCAACCGTCATTGCTATTCAA
TGTTGCTATTGCAGAAAAATCCAGTAGCCCGTCAACCAATCCTCCTAGAG
TTGGTTTAAGTTCTAGCGCATTTACTCTCAACACTAGTTCCACTGGGCTT
TTCAATATCGCTCCATCGACAAAACCAGCTCAAAGTACAGCTGTATCCGT
ATCGACCACAATTCCGCAATCCATTTTCAGTACTCCTACATTCACTAATC
AGAAAACTGACTTATTTGGTAATTCTAACTTAACGCAACCTTCTGGAGTT
TTCGATACTAGTTCATCGACTAAACAGAATTTATTTGGCAAATCTAACAT
TTCTTCATCAGAAATAACTAGTGGAGCTTCACAGCCACATGGACTTTTCG
CTACACCGACATCATCAAAACAAAGTACTGCGCTTTTTGGCAATGCCGAT
ACACCAGCAACACAAACTACAAAACCGCAATCGATTTTTAGTTCTTCTAC
ATCGGTGAAACCGAGTGGAACTTTGTTTGGTAACTCTGGCGGATCTACTC
AAAATTCGAATTTGTTTGCGTCATCGTTAACAAGTTCTCCTGCGCCTTCA
AATGGGATTTTCACAACTTCTGAATCGAATAAGCTGAATATATCTGCTAG
CTCAAATACTTCCATTCAAAATACCAACATATTTACATCTTCAACTGCAA
AACCTGCACAATCTCTTTTCAGTACTCCAATATCGACCAAAACAACTGGG
TTATTCGACAATTCTAGTGGATCTCATCAAAGCACTGGGTTGTTTGGAAC
TGCTATCCAAACTGCATCAACAACAAAAGAATCATCTGGACTATTTAATA
CTCCTATATCATCGAATAATTTATTTGGTAATTCTACACCATATACAAAC
AATACCGCACAACCGTCTCAAAGTGGAGGTTTATTTGGAAGTGGAACTAA
TACCGCAAGTGGAGGACTATTTGGATCACCACAATCAACGGGCTCCACAA
ACCAATCTAGCGGAGGATTGTTTGGAAAGTCGAATCAGCAGGGCGCTGGA
ATCTTTGCCTCATCAAATAATGTGAACGCTAATACAACACAACCTGTTGG
AATTTTTAGCGGTTCTTCTACCAATAATCAATTATTCGGAAATGTAAATA
ATACTCCGACACCAGCTAGTGGACTGTTTGCACAATCTAACACCAATGGA
CTTTTCGCAAATTCCAAGGCCACTGGCCAGACTACCGGTTTATTTGGTCC
CTCATCCAATTTGTCGACCACAAGTTCTGGGTTATTTGGAAGTCCACAGA
CAAATAGTAGCACAAATGAAGGGTTATTTGGAAATAAATCATCAACTTCT
CCATCTACTGGAATTTTCGGCAAAAATGCTCCAAATTCAGGATTATTCAA
TTCGTCAAATCAAACCAATAACCAATTGTCATCTAATATATTCGGTTCAT
CTTTACCCCAAAATCAAACCAACCAGCCACTGCCACCCAACAGCATATTC
GCTACACCACCCCAAAAC
back to top

protein sequence of SMED30034098-orf-1

>SMED30034098-orf-1 ID=SMED30034098-orf-1|Name=SMED30034098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1235bp
MFISSISPEKGDRNKNDNIIQSDVPGERNQNCFLTQPLMNLDNHLEITSQ
IETPISQINLFVTPNSNNPDPQLNIFGTKNKPTSQSNLFGTPSSDVPSSQ
GNLFGTKTIDKPTPQSNLFGNTNATFQKSIFSTVTPETSAGQSPLTSISN
IDSNSQHVSSFQSRNKSNIQIGNQNKVLTPGIFGASNSDSSYLQSSKSTQ
QQKNSKLTEIETENPPKSNSSQVSISDTSPGKLPENKISAHNKNSQKFNL
EDHNKQNIKSENVATRRSIKISKSKSDTKSDVIDNFLPNAIECLEKQIND
IKTNTKHIIDKSKNSLDNGEINKEISKMFHDLEKNFIDVDKINMKNKNII
ENSKSLCQDIEITLEFTTRFQEAILDSKINHKHFRSAPNPLLKKTSVNLN
ELAKKVGFYLQDLEDALDYVESKKDFKIISKNKNAQLQDIKQTLKSNMKV
ISVERSKLDLIKEHIDDSSSEEIDFHHSHLQARNVNKEMEEYLHALMCRR
PVNNISCKLPETKQPIKSKKIISTPPKNNLNASRPANESIKTESKLTTSK
PLIVKLVEKDSYKCNQDSKSNNVASTGDVHYSGNVLANKNAGISTFNEIA
PKLENLDPIKSTEVKLKPEAFNGDNILKPSSSKDSGFFDVSHAKTVPVTN
LTPISSTIATPTIVQSLSDNISQSRNESSQLNASFPSIVPNCSKPVDIIQ
SNSVIKQTDDLHENSNKTPRSTTATNQLSDITLQPHANIQPSLLFNVAIA
EKSSSPSTNPPRVGLSSSAFTLNTSSTGLFNIAPSTKPAQSTAVSVSTTI
PQSIFSTPTFTNQKTDLFGNSNLTQPSGVFDTSSSTKQNLFGKSNISSSE
ITSGASQPHGLFATPTSSKQSTALFGNADTPATQTTKPQSIFSSSTSVKP
SGTLFGNSGGSTQNSNLFASSLTSSPAPSNGIFTTSESNKLNISASSNTS
IQNTNIFTSSTAKPAQSLFSTPISTKTTGLFDNSSGSHQSTGLFGTAIQT
ASTTKESSGLFNTPISSNNLFGNSTPYTNNTAQPSQSGGLFGSGTNTASG
GLFGSPQSTGSTNQSSGGLFGKSNQQGAGIFASSNNVNANTTQPVGIFSG
SSTNNQLFGNVNNTPTPASGLFAQSNTNGLFANSKATGQTTGLFGPSSNL
STTSSGLFGSPQTNSSTNEGLFGNKSSTSPSTGIFGKNAPNSGLFNSSNQ
TNNQLSSNIFGSSLPQNQTNQPLPPNSIFATPPQN
back to top

protein sequence of SMED30034098-orf-2

>SMED30034098-orf-2 ID=SMED30034098-orf-2|Name=SMED30034098-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MSDDILNLQPLHPFKSTNKDISKGIRYSAIDSHSGLLISVADKEIYFYDT
NTYEDHSINSKLRRDKSIDFEKSFSINCEFDVSWVEFNCSGSYLFVATTS
NSNYLNTIKIIDVAKTLKERKEVAICIFKPNIDSKLVDLKWHPCKTDILL
LVLNDSVHICHVKANELVIMHARPNAFCVSWSPKGKQFSVIMQKVESKKF
VLNQYDINFVEKRSTEIPNASNDFKVSFDLVPIEICWYATYSVIIGFRGV
PNGDEQFKIFVCRFAIKTSKIQVLPDVRSSSDCINRNPGPCARLYYLHIP
DWKAIILVNNSAEDAVVFEYDSNDDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR019774Aromatic-AA_hydroxylase_C
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR025574Nucleoporin_FG_rpt
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005643nuclear pore