SMED30034070

Overview
NameSMED30034070
Smed IDSMED30034070
Length (bp)2325
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034070 (SMED30034070) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034070 (SMED30034070) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034070 (SMED30034070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034070 (SMED30034070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig45405newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 Contig41392uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034070SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017519.1 Contig14476newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034070SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30034070SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30034070SMESG000029570.1 SMESG000045686.1 SMESG000045684.1 SMESG000017522.1 SMESG000017520.1 SMESG000017517.1 SMESG000017519.1 dd_Smed_v6_6577_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034070 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013837:9879..15906 -11440
Homology
BLAST of SMED30034070 vs. TrEMBL
Match: R7T9B7 (SH3_10 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_205084 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.426e-9
Identity = 95/417 (22.78%), Postives = 186/417 (44.60%), Query Frame = 1
Query:  145 SIAKSIFENHLELDPMICD-VDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDE--------------KDFTIESVSKIDANDENKKYRTKINVGNLLKSLN--QLRCFDKFGMDTIENAV--------------IGKNEDSKEEFEM--------TIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCF-----DKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEM-KLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYAD 1260
            +I ++  E  L +D +  + VDGEK  + +  ++G+++   ++ +L  +  L     +E + EDS    II+A   E +  K  E + + E              +D    ++  + A  ENKK   +   G ++  +   ++      G   I+ A+              + ++ D K++  M        T+ E+V+NG+LD+      +    E  ++ ++V   L++ + A+ IL+ +   S   LI   I D     F      K +SL+EAI++ LL P  V++   E  +V +L  +I+ G  N      K   +    +E+ LN A+K+  GIL+  ++ E M + KVP  +K +L +  +N   +++F+  +   + +  AL    +  + +V  D K   ++   D
Sbjct:  739 TIGEAFDEGLLHVDTLHLEGVDGEKFPLQEAALQGLVEPHTLREILGTLDPL----AIENLMEDS----IIDANTGEYVDPKTGERMSLAEAIEQGRLDPDQVFLRDLVSGAIMSLSAAIENKKINPE--TGKVIDPVTGQEMSFATAIGNHVIDPAIDADKLAAQISALKFLNEHLDVKQKGVMNPLSGSMSTLEEAVLNGSLDIPNGSYVNTTTDEASTLAEAVNEKLMNPQVAKEILNAMNENSLGALIDKGIIDPNTGKFIDPVTGKKMSLKEAIDKGLLDPCSVFVVDPETGQVTSLDSLIKDGRFNPVSGKFKDPLTG---LEVSLNNAIKK--GILTPRIDPERMIEEKVP--VKDILANSKLN-PADLIFQAPDGSTLPLKTALGAGFLTPDSIVKIDPKTGVLTVAGD 1137          
BLAST of SMED30034070 vs. TrEMBL
Match: K1R1R1 (Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=Crassostrea gigas OX=29159 GN=CGI_10016946 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.781e-8
Identity = 55/220 (25.00%), Postives = 109/220 (49.55%), Query Frame = 1
Query:  616 ESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCF-----DKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYAD 1260
            E++  G++DL    + D +  E+ S+ ++++   ID  AA+++LD L+ +S  E+I+    + +   F      + ++++EA++  LL PE VY+   E N +++L  +I+ G  +    +V I++  G    M L+EA+   NGI+   +  ++  +    T+K L+D   +N      F      +M++ DAL    +     V  D +   +   AD
Sbjct: 1012 EAIKAGSVDLQNGMVKDLRTGEVMSLAEAMQTSKIDPTAAKSLLDALDKLSLHEMIQKGQINPDKGHFIPSDKSRPITIQEAMDRGLLHPENVYVVDKENNNIVSLDSLIKSGRFDPKTGMV-IDQKTGRA--MSLSEAIA--NGIIGGKIAVDDF-VDTSVTLKDLIDSSKVNP-RSTTFVAPNNYKMSLRDALANGFLTMNSNVKLDPETGCVVLAAD 1224          
BLAST of SMED30034070 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 771/775 (99.48%), Postives = 772/775 (99.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYY DKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  460 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1234          

HSP 2 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 425/787 (54.00%), Postives = 558/787 (70.90%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E+   +K +           NR             +    IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    ++MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1235 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEISPPAKEE-----------NR-----------SILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1989          

HSP 3 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 375/407 (92.14%), Postives = 385/407 (94.59%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV 1218
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V
Sbjct: 1990 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRV 2396          

HSP 4 Score: 366.311 bits (939), Expect = 8.026e-109
Identity = 201/260 (77.31%), Postives = 219/260 (84.23%), Query Frame = 1
Query: 1546 YLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            YL   +K+        +FE V I + I C+A S+  DS T+I G +   N++I+ I +A+K  +I++E QT + D    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  208 YLSLEYKI--------LFEGVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 459          
BLAST of SMED30034070 vs. Planmine SMEST
Match: SMESG000045684.1 (SMESG000045684.1)

HSP 1 Score: 1470.29 bits (3805), Expect = 0.000e+0
Identity = 771/775 (99.48%), Postives = 772/775 (99.61%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYY DKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  416 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYGDKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1190          

HSP 2 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 425/787 (54.00%), Postives = 558/787 (70.90%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E+   +K +           NR             +    IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    ++MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKN+EEETNPKCFA
Sbjct: 1191 IVQRKPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFLGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEISPPAKEE-----------NR-----------SILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNMEEETNPKCFA 1945          

HSP 3 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 375/407 (92.14%), Postives = 385/407 (94.59%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV 1218
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V
Sbjct: 1946 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRV 2352          

HSP 4 Score: 366.311 bits (939), Expect = 8.198e-109
Identity = 201/260 (77.31%), Postives = 219/260 (84.23%), Query Frame = 1
Query: 1546 YLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            YL   +K+        +FE V I + I C+A S+  DS T+I G +   N++I+ I +A+K  +I++E QT + D    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  164 YLSLEYKI--------LFEGVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCDRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 415          
BLAST of SMED30034070 vs. Planmine SMEST
Match: SMESG000017522.1 (SMESG000017522.1)

HSP 1 Score: 1427.92 bits (3695), Expect = 0.000e+0
Identity = 753/767 (98.17%), Postives = 756/767 (98.57%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEE 2301
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEE EELM+EVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM    K  D  +EE
Sbjct:  766 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEAEELMNEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM----KPTDPEIEE 1528          

HSP 2 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 375/407 (92.14%), Postives = 385/407 (94.59%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV 1218
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V
Sbjct: 2271 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRV 2677          

HSP 3 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 422/783 (53.90%), Postives = 554/783 (70.75%), Query Frame = 1
Query:   13 KPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            KPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E+   +K +           NR             +    IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    ++MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1520 KPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFIGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEISPPAKEE-----------NR-----------SILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2270          

HSP 4 Score: 363.614 bits (932), Expect = 7.236e-108
Identity = 196/244 (80.33%), Postives = 214/244 (87.70%), Query Frame = 1
Query: 1594 IFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            +FE+V I + I C+A S+  DS T+I G +   N++I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  522 LFEVVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 765          
BLAST of SMED30034070 vs. Planmine SMEST
Match: SMESG000017522.1 (SMESG000017522.1)

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 753/767 (98.17%), Postives = 756/767 (98.57%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEE 2301
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLC+ENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEE EELM+EVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM    K  D  +EE
Sbjct:  671 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCKENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLVNEECLVCYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEAEELMNEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIM----KPTDPEIEE 1433          

HSP 2 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 375/407 (92.14%), Postives = 385/407 (94.59%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV 1218
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V
Sbjct: 2176 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRV 2582          

HSP 3 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 422/783 (53.90%), Postives = 554/783 (70.75%), Query Frame = 1
Query:   13 KPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV-----CYDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDI------KAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            KPTDPEIEELCEDSSNKEVNMKIL KAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEK+SI   F+KG I  E + + L  +KD+F G ++E +++   G++I EA+   +  +   E L+ID+K FTI +VSKI    E   Y T I   +++  LNQL+  + +G++T   ++  KN+++   F +TIFE++MNG L+ DEL I+D    EMCS++  VERGL+DV+ A ++LD +ES++F ELI   I+D+ NN F   LSL+EA+E  L+RPE+VYL+L +ENK++NLSKMIE GMLN   N ++ + S+ EII MKLNEA+  EN IL++ +N +++K++ P  + + +D ++I+   +++ F  S+I+ + I++AL++ L+  E LV      ++N++  I Y        L+N LNE  K +  Y+  L     +I          IL++K++ +   D   + TV +    ++   +   ++NLK+K ++ +E ++E+   +K +           NR             +    IS + ++ TII+GVK   +D+I+ I +A+K  +I++E QT + +    ++MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIE KILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1425 KPTDPEIEELCEDSSNKEVNMKILYKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKKSIFISFIKGNISLEILYKFLSGLKDIFIGVIIENLNKQLKGRQIFEAIEAFNFPNLNNESLVIDQKTFTILTVSKI---KEEMIYLTSIEPASVIAKLNQLKYLETYGINTNNLSLSPKNQNN---FNLTIFEAIMNGDLNFDELEIYDSNNHEMCSIVDGVERGLVDVRTARHLLDRMESLTFGELITDGIYDVHNNSFGDFLSLDEAVENKLIRPELVYLSLPKENKLMNLSKMIEYGMLNPLTNEIRTQNSENEIITMKLNEALNSENRILATDLNCKQIKMRFPEKLINFVDKKLIDPDQDMIQFSNSKIEPIYISEALKKKLLCRESLVKLTGDHFENEIIIIEYCGSNEPASLMNELNEFIKYIDNYLSILTVSHGEILPNNEETIKSILKDKIKIIDDVDAFLLNTVNK----EVNKEQAFYIQNLKLKIDQAKERLEEISPPAKEE-----------NR-----------SILRYGPISGDENNETIIIGVKLQDDDEILCIEEAIKENLINVEYQTCRCNRENKEEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIERKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2175          

HSP 4 Score: 363.614 bits (932), Expect = 8.321e-108
Identity = 196/244 (80.33%), Postives = 214/244 (87.70%), Query Frame = 1
Query: 1594 IFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            +FE+V I + I C+A S+  DS T+I G +   N++I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSK LIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  427 LFEVVQINDVIFCKAQSENEDSRTVIFGWQNQMNNEILGINEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKDLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 670          
BLAST of SMED30034070 vs. Planmine SMEST
Match: SMESG000017520.1 (SMESG000017520.1)

HSP 1 Score: 1078.54 bits (2788), Expect = 0.000e+0
Identity = 599/785 (76.31%), Postives = 652/785 (83.06%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV----C-YDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLK----DSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE +V    C  +  + ++ Y  D  +  L+N LNEL+  L E + +L   +++    +IL   V +   K     + +   L  D      D   P+++ L  K+++V+ L+ E+      D     F V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  886 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESMVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENE-DVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKFLLSEINDQKNCDKFQNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIKEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 1669          

HSP 2 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 594/785 (75.67%), Postives = 650/785 (82.80%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEECLV----C-YDNKLAAISYYADKXXXXXXXXXXXXAKALKEYIFALDTDKDDIKAFKILREKVENLYLKDCRFMETVEQILSVDLK----DSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            IVQRKPTD EI+ELCEDSSNKEVNMKILC+AIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEH+KDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLR FDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE  V    C  +  + ++ Y  D  +  L+N LNEL+  L E + +L   +++    +IL   V +   K     + +   L  D      D   P+++ L  K+++V+ L+ E+      D L   F V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct: 1670 IVQRKPTDLEIKELCEDSSNKEVNMKILCRAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHMKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRFFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEESRVKLFECNLETGVKSMEYCGDSEVADLINDLNELSTILPELLMSLKNGENE-DVMQILETSVISRLDKRVNLFDRINACLCEDADNGTFDEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKLKNLFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 2453          

HSP 3 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 369/399 (92.48%), Postives = 379/399 (94.99%), Query Frame = 1
Query:   16 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYME-IVFKESEIQQMTINDALEQNLVNEE 1209
            PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL+ + +N   + I+F   +I+ M I D L+  L+NEE
Sbjct:  170 PTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLESEEVNKEKDIIIFPGMKIKPMLIKDGLKNELLNEE 568          

HSP 4 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 368/407 (90.42%), Postives = 383/407 (94.10%), Query Frame = 1
Query:    1 IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSVVNSEEMKLKVPRTIKSLLDDQIINIYMEIV-FKESEIQQMTINDALEQNLVNEECLV 1218
            IVQRKPTD EIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENK INLSKMIECGMLNASENLVKIEKS+GEIIEMKLNEAVKEENGILSSVVNSEEMK   PR +K LL++  I++  +++ F    + ++ + DA+EQ L + E  V
Sbjct: 2454 IVQRKPTDLEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESIAKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLFAGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKIDANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEFEMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILDCLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEENKEINLSKMIECGMLNASENLVKIEKSNGEIIEMKLNEAVKEENGILSSVVNSEEMKKHFPRHLKDLLENGEIDVNRDLICFVGKTVLEVNVKDAIEQKLASLESFV 2860          

HSP 5 Score: 375.17 bits (962), Expect = 1.055e-111
Identity = 205/291 (70.45%), Postives = 232/291 (79.73%), Query Frame = 1
Query: 1453 DSEVPELRNLKMKYEEVEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKEADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNPKCFA 2325
            D   P+++ L  K+++V+ L+ E+      D    WF V      +++ E V I + I C+A+S      TII+ VK   +D I+ I +A+K  +I++E QT + +    D+MSWK AI E  MIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDEL KGLIPLR+AIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHE SLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA
Sbjct:  595 DEGRPDVKVLNAKFDQVKSLLAEINDQKNCDKFQNWFAVHIGANFQNLLENVGITDVITCDAVSGNECEKTIIIAVKLQNDDKILCIEEAIKENLINVEYQTCRCNRENKDEMSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELLKGLIPLRKAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHEMSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNVEEETNPKCFA 885          

HSP 6 Score: 302.368 bits (773), Expect = 6.333e-87
Identity = 165/175 (94.29%), Postives = 168/175 (96.00%), Query Frame = 1
Query: 1789 MSWKCAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYXXXXXXXXXXXMDAIMLGMIKIEDKNVEEETNP 2313
            MSWK AI E  MIACEINKNIITEEYMKCLIESNT+EYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDC+LHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV   T+P
Sbjct:    1 MSWKNAIEEKLMIACEINKNIITEEYMKCLIESNTDEYINTDEMEILGAVNTRNNKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSDCKLHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIMDAIMLGMIKIEDKNV--PTDP 173          
The following BLAST results are available for this feature:
BLAST of SMED30034070 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
R7T9B75.426e-922.78SH3_10 domain-containing protein OS=Capitella tele... [more]
K1R1R11.781e-825.00Bullous pemphigoid antigen 1, isoforms 6/9/10 OS=C... [more]
back to top
BLAST of SMED30034070 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034070 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045684.18.026e-10999.48SMESG000045684.1[more]
SMESG000045684.18.198e-10999.48SMESG000045684.1[more]
SMESG000017522.17.236e-10898.17SMESG000017522.1[more]
SMESG000017522.18.321e-10898.17SMESG000017522.1[more]
SMESG000017520.11.055e-11176.31SMESG000017520.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034070 ID=SMED30034070|Name=SMED30034070|organism=Schmidtea mediterranea sexual|type=transcript|length=2325bp
ATTGTACAAAGGAAGCCAACTGATCCAGAAATAGAAGAATTATGTGAAGA
TTCATCAAATAAAGAAGTGAATATGAAAATATTGTGCAAGGCAATTGAAT
GTGATTGCATGAATGAATTCCTGATTTATGACGATGTGAAAGAAAGTATT
GCGAAAAGCATATTCGAAAATCATTTAGAACTTGATCCAATGATTTGTGA
TGTAGACGGAGAAAAGCAAAGCATTTTGAAAGGATTCGTGAAAGGCGTGA
TCGATTCGGAAGAAATGAAACGGTTGTTAGAACACGTGAAAGATTTATTT
GCAGGAGAAATGCTAGAGACGATTGATGAAGATTCGAATGGAAAAGAAAT
AATTGAAGCTTTGAATAGAGAAGATCTGAAAGATAAATGTGCGGAAATGT
TAATAATTGATGAGAAGGATTTCACAATAGAAAGCGTATCAAAAATTGAT
GCAAATGACGAGAATAAGAAATATAGAACAAAGATTAATGTTGGAAATTT
ATTGAAAAGTCTTAATCAACTGAGATGTTTTGATAAATTTGGAATGGACA
CGATTGAAAATGCAGTAATTGGAAAGAATGAAGATAGTAAAGAAGAGTTC
GAAATGACAATATTTGAATCAGTAATGAACGGAACTTTGGATTTGGATGA
ATTGGGAATATTTGATGAGAAAGAAAAAGAAATGTGTTCAATGATTAAAA
GTGTGGAACGAGGACTGATTGATGTGAAAGCAGCAGAAAATATTTTGGAT
TGTTTAGAATCGATGAGCTTCGAAGAACTAATAAAAGCAAAAATATTTGA
CATTGAAAATAATTGTTTTGATAAAAATTTGTCATTGGAAGAAGCGATTG
AAGAGGATTTGTTGAGACCGGAAGTTGTATATTTGAATTTGTGTGAGGAA
AATAAAGTAATAAATTTAAGTAAAATGATTGAATGCGGAATGTTGAATGC
GTCGGAAAACTTGGTGAAGATAGAGAAAAGCGATGGCGAAATCATTGAAA
TGAAATTGAATGAAGCAGTGAAGGAAGAAAACGGAATTTTGTCAAGTGTC
GTGAACAGTGAAGAAATGAAACTAAAAGTTCCAAGAACGATAAAGTCTCT
GCTAGATGATCAAATAATAAACATATACATGGAAATTGTTTTCAAAGAAT
CCGAAATACAGCAAATGACGATAAATGACGCTTTGGAGCAAAACTTAGTA
AATGAGGAATGTTTAGTCTGTTATGACAATAAATTAGCAGCAATTTCTTA
TTACGCAGACAAAAATTTACTTCATTTACTAAATATGCTGAATGAGTTAG
CTAAAGCCCTTAAAGAATACATTTTTGCCTTAGATACTGATAAAGATGAT
ATCAAAGCTTTCAAAATTCTCAGGGAAAAAGTTGAAAATCTTTATCTGAA
AGACTGCAGATTTATGGAAACCGTTGAGCAGATTTTGAGTGTTGATCTCA
AGGACAGTGAAGTGCCTGAACTTAGAAATCTGAAAATGAAATATGAAGAA
GTGGAGGAATTAATGGATGAAGTTAAGAGCTCTTCTAAAAATGACTATCT
GGATTATTGGTTTAAAGTTTGCTTTGCAAATAGACTAGAAGATATCTTTG
AAATTGTAACAATCGCTGAAACAATACTTTGTGAAGCAATATCCAAAGAA
GCCGATTCCTGTACCATCATATTGGGCGTTAAACAATATTGCAATGATGA
TATTATAAGTATAACGGATGCTTTAAAGGGAGAAATCATAGACATTGAAT
GTCAAACATATAAATATGATCCAACTCAAAATGATAAAATGTCATGGAAA
TGTGCAATTTCCGAAGGATACATGATTGCATGTGAAATTAATAAAAACAT
AATTACAGAGGAATATATGAAATGTCTCATAGAAAGTAACACAAATGAAT
ACATAAATACAGATGAAATGGAAATCCTCGGAGCAGTAAATACACGGAAT
AATAAACTATTGGAGACTAATGAAGCAATTGAAGGGAAAATATTAGATTT
GAATGGACATTTATTTATGGATGAATTATCAAAGGGTTTGATACCATTGA
GACAGGCAATTGACAGTGGATATGTGATGGCAAAGAAAAAGGATTCCGAT
TGTGAATTGCATCGAGTATTTGTAGGATCTGTAAAAGTAGGTAAAGATCA
ACATGAAACGAGCTTGGAAGAAGCGATAAAAGCTAAAGTTATTGATCAAT
TAGAAAATGTTTACAGAATCGAAGAAGAAAACATTGAAATACGAATAATG
GACGCGATAATGTTGGGAATGATAAAGATTGAAGACAAGAATGTGGAAGA
AGAAACAAATCCTAAATGTTTTGCA
back to top

protein sequence of SMED30034070-orf-1

>SMED30034070-orf-1 ID=SMED30034070-orf-1|Name=SMED30034070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=775bp
IVQRKPTDPEIEELCEDSSNKEVNMKILCKAIECDCMNEFLIYDDVKESI
AKSIFENHLELDPMICDVDGEKQSILKGFVKGVIDSEEMKRLLEHVKDLF
AGEMLETIDEDSNGKEIIEALNREDLKDKCAEMLIIDEKDFTIESVSKID
ANDENKKYRTKINVGNLLKSLNQLRCFDKFGMDTIENAVIGKNEDSKEEF
EMTIFESVMNGTLDLDELGIFDEKEKEMCSMIKSVERGLIDVKAAENILD
CLESMSFEELIKAKIFDIENNCFDKNLSLEEAIEEDLLRPEVVYLNLCEE
NKVINLSKMIECGMLNASENLVKIEKSDGEIIEMKLNEAVKEENGILSSV
VNSEEMKLKVPRTIKSLLDDQIINIYMEIVFKESEIQQMTINDALEQNLV
NEECLVCYDNKLAAISYYADKNLLHLLNMLNELAKALKEYIFALDTDKDD
IKAFKILREKVENLYLKDCRFMETVEQILSVDLKDSEVPELRNLKMKYEE
VEELMDEVKSSSKNDYLDYWFKVCFANRLEDIFEIVTIAETILCEAISKE
ADSCTIILGVKQYCNDDIISITDALKGEIIDIECQTYKYDPTQNDKMSWK
CAISEGYMIACEINKNIITEEYMKCLIESNTNEYINTDEMEILGAVNTRN
NKLLETNEAIEGKILDLNGHLFMDELSKGLIPLRQAIDSGYVMAKKKDSD
CELHRVFVGSVKVGKDQHETSLEEAIKAKVIDQLENVYRIEEENIEIRIM
DAIMLGMIKIEDKNVEEETNPKCFA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR035915Plakin_repeat_sf
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 491..511
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 184..326
IPR035915Plakin repeat superfamilySUPERFAMILYSSF75399Plakin repeatcoord: 545..738