SMED30034068

Overview
NameSMED30034068
Smed IDSMED30034068
Length (bp)2109
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034068 (SMED30034068) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034068 (SMED30034068) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034068 (SMED30034068) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034068 (SMED30034068) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034068

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034068SMESG000013089.1 SMESG000013083.1 Contig1460GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30034068SMESG000013089.1 SMESG000013083.1 dd_Smed_v4_6887_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30034068 vs. Ensembl Zebrafish
Match: cntnap5b (contactin associated protein-like 5b [Source:ZFIN;Acc:ZDB-GENE-070705-209])

HSP 1 Score: 50.447 bits (119), Expect = 7.524e-6
Identity = 28/96 (29.17%), Postives = 47/96 (48.96%), Query Frame = 3
Query:  702 IAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNT--SSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVT 983
            I    + +   +GC+   +I  + + L    + +   +   C   C++  S C N+G+C E   G Y CDC +S + G  C+ E S+ F+S  SVT
Sbjct:  808 IGGTASRQRGFLGCIRSLNINGMTLDLEERAK-MTPGVSSGCPGHCSSQNSLCHNRGKCIEKSSG-YVCDCTHSAYGGPNCKKEVSVSFESGSSVT 901          
BLAST of SMED30034068 vs. Ensembl Xenopus
Match: gldc (glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-1221322])

HSP 1 Score: 55.8398 bits (133), Expect = 2.727e-7
Identity = 37/134 (27.61%), Postives = 60/134 (44.78%), Query Frame = 3
Query:  657 VWIGNIPKTSNKFQNIAKLKTIRLNL--IGCVEQFSITNLNMKLATSGEHVGE-MIEPFC----KPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSI-KFDSTF---------SVTENHFISLK 1007
            +++G +P+     Q   ++ T  L L  +GC+    +   +  +    E  G   + PFC    +  C +S C N GQC E W   Y CDC  + ++G  CE E ++  +D T          S TE   +SL+
Sbjct:  612 MYLGGLPEPREDLQLPPEVWTASLGLGFVGCIRDLFVDGKSRDIRRLAELPGAPGLAPFCTRETQRQCTSSPCRNGGQCREGWN-RYICDCVGTGYLGDSCEREAAVLSYDGTMYLKVLLPGVSHTEAEDVSLR 744          
BLAST of SMED30034068 vs. TrEMBL
Match: A0A2T7NPF9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16313 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.439e-8
Identity = 66/259 (25.48%), Postives = 109/259 (42.08%), Query Frame = 3
Query:  264 FLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEF-SENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVK------PLYPIPESNLKQFI---ETFTMPIPFFDNSNETTEIHVWIGNIPK--TSNKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIE--PFCKPICNTSSCFNQGQCYELWR-GNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHF 995
             L++ + +     +   LL Y  D     L +E   E  +V  Y NF        T +     G  K +I  ++   Y   KL IY  D+ QI+++ +       + P  +S  K+ +    T+  P+PF         I +++G +    TS  F            L GC+    + ++ ++LA   E    + +  P C   C  ++C N G+C+E W+ GN+ CDC  S F G  CE E S   +   SV ++ F
Sbjct:  374 ILDKTVVLSFRTQQADALLMYAYDHLSNFLQMELHQEKTIVFTYNNFHTIVRGSITVQDKLNDGEWKQIIAQNY---YNNTKL-IY-GDQSQIIEFRRMKLRSYSVDPFKDSIKKETVFITRTYEEPLPF---------IRLYVGGVDDGGTSTPF------------LKGCIRGMRMGDIQIELAHGIEGRDNITDLTPSCVAGCKANTCLNHGECFEYWKYGNFSCDCSNSDFSGVHCEKEASALLNG-LSVIQHKF 605          
BLAST of SMED30034068 vs. TrEMBL
Match: V4A796 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_233060 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.082e-7
Identity = 93/412 (22.57%), Postives = 164/412 (39.81%), Query Frame = 3
Query:  303 KYQGLLFYIIDSNYRTLWLEFSENF-LVINYYNFKINELEKHTFKISFLL--GNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVK------PLYPIPESNLKQFI---ETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLIGCVEQFSITNL--NMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWR-GNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISL-------KRLRFSFRPNTV-------GEYDGFKLL---SLKFKD------QQYFVMYIDSNSLLHGRLIYSNDLNID----VYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDL--HIPFFYSMKRFKGCLTNFV 1406
            K + ++ YI D     +  E  +   L+I+Y NF     E  TF I   L  G  K VI    G     +  R+   DK  ++ Y +        +P  ES + + +        P+PF         +H+++G +PK +                 GC+    I     N++        G+ +   C+  C    C N G C E ++ G Y+CDC  + + G++C++E S KFD    + +   + L       ++L F+F  + V       GE     ++   S K KD      +Q   + I++N  +    IY   + +D         + K + S +F+  +  ++    I        IE  T+++    +  ++  I VG +      FYS+  F GC++N V
Sbjct:  877 KREAMILYIHDEMNNFIQFELQKGTKLIISYNNFNEVIRETITFDIEHKLSDGKWKQVIAEIIG-----DSTRLQVEDKTLLIQYPRLKLRNYNTFPYKESRIPESVFLPRPSEKPVPF---------VHLYVGGVPKGATTLPTFD----------GCLRGLKIGKRIYNLREQGVKAKAGD-VTTACETGCIEDRCLNGGYCTEYFKLGQYDCDCTETDYSGQQCQIEPSGKFDGNSVIEQKFRLPLIDQRSLSEQLSFTFISDGVDPSLYVKGEIIEMAMIYVTSSKKKDYLLAKLEQDGSVMIETNQEIG---IYRMKIPVDFANGKAHELRYKRDGSDMFVTVIPYDKKGFPII-----DGIEEATMNYAAFDL-DDIDSIYVGGMAQQTDDFYSVVNFTGCISNVV 1254          
BLAST of SMED30034068 vs. TrEMBL
Match: A0A2C9LN94 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065004 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.669e-7
Identity = 74/327 (22.63%), Postives = 138/327 (42.20%), Query Frame = 3
Query:  612 PIPFFDNSNETTE--IHVWIGNIPKTSNKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHV--GEMIEPFCKPICNTSSCFNQGQCYELWRG-NYECDCEYSQFIGRRCELEYSIKFDST--------FSVTENHFISLKRLRFSFRPNTVGEYDGFK-----LLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNY--TLIETQ---TISFGEISIFFNVRQILVGDLHIPF---FYSMKRFKGCLTNFVLQSETKQFILNTSRE-STNYPPCQQIAGYNEAWNSS 1511
            P  F     + T+  IH ++G +P   N + +          L GC+      N    L  + E V    ++ P C+  C  ++C N+G C E WR   +ECDC  + F G  CE E SI F+              E++ +S + L   F+ + +   DG K     ++S  FKD  Y ++ ++ N      ++ +N        T      QS   +   + +++ +++     +   LI+ +   T+++ +  +  N+  I +G  +IP     + ++ F GC++NF           +T R+   N+   + I    E+ N+S
Sbjct: 1127 PTVFMQRPTKKTQPFIHAYVGGVPG-KNSYAS---------RLTGCIRGVRAGNYVFHLRKAAEAVNNDTLVAPMCESGCGENTCLNKGFCVEKWRNRTFECDCSDNGFTGFHCEKEPSISFNKNTVIYQELKLGPNEDNSVS-EMLSLRFKSDMIP--DGQKVVLAYIISSDFKD--YILITLNVNDASKIVILETNQGYGKYRITGAFSLGQSHDLIYIRKRDQMHLQVIPVDTFGTVLIDDKVETTLNYPDFPL-NNLNAIYIGG-YIPDTLNLFGLRNFSGCISNFTFLPAVNGVPRHTLRDFHLNHTDIELIGEERESCNTS 1436          
BLAST of SMED30034068 vs. TrEMBL
Match: A0A226F4U4 (Contactin-associated protein-like 5 OS=Folsomia candida OX=158441 GN=Fcan01_01850 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.677e-7
Identity = 64/256 (25.00%), Postives = 109/256 (42.58%), Query Frame = 3
Query:  729 NLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRG-NYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISLKRLRFSFRPNTVGEYD---GFK----------LLSLKFKDQQY------------FVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLA---EVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLH--IPFFYSMKRFKGCLTNF 1403
             ++GC+  F I N  + ++       +++E  CK +C+T  C N G C E +    Y CDC ++ + G  C+ E    F            S  R RF+   +TV E +   GF           LL+++   Q Y             +M   +N +   ++ Y + ++   +  Y  +++   IF+    E+ L+ +  K   FQ   LI  Q ++ GE         I VG ++  +P   + KRFKGCL+N 
Sbjct: 1373 GMLGCLRGFKIGNEQIPISNMANQ-NDVLE-GCKMVCDTKPCHNAGICMEDFTSRQYSCDCTFTSYYGPACKEERGATFQGE---------SYIRRRFNNPADTVMEIETRFGFSSNFFNGKETVLLTVQIPGQNYSLLFAINAEGHLILMETGTNGVEGAKIKYQHFIDGSRHSVYYKRNSDETIFIVDQEEIHLSSLNTKKPKFQ---LIPNQNLNVGE---------IFVGGVNEAVPDLINYKRFKGCLSNI 1605          
BLAST of SMED30034068 vs. TrEMBL
Match: A0A2R2MJW0 (contactin-associated protein-like 4 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106169903 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.882e-7
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  630 NSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVT---ENHFISL---KRLRFSFRPNTV 1040
            ++N   E+ V+IG  P ++              +L GC     I N+   L+ + +   + I   C+  C+ + C + G+C E W+G Y CDC ++ + G  C+ +  ++FD    +T   E   + +   + + F+F  NTV
Sbjct: 1137 SANYPIELKVYIGGHPNSTQ-------------SLHGCFSGLKIGNMPYNLSKAADEGRQGILLGCESGCDATPCQHGGRCTERWQGQYHCDCSHTTYTGDNCDTDVGVEFDGNTVITTELEAEMVPVSEKESIFFTFATNTV 1266          
BLAST of SMED30034068 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002142.1 (pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1 gene:ENSPMAG00000001935.1 transcript:ENSPMAT00000002142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 2.068e-7
Identity = 32/110 (29.09%), Postives = 50/110 (45.45%), Query Frame = 3
Query:  648 EIHVWIGNIPKTSNKFQNIAKLKTIRLNL--IGCVEQFSITNLNMKLATSGEHV-GEMIEPFCKPI----CNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSI 956
            +  V++G +P+         +L +  LN+  +GCV    I   +  +    E      ++PFC       C+++ C N G C E W   Y CDC  + + GR CE E SI
Sbjct:  340 DSEVFLGGLPEDKADLLLPTELWSALLNIGYVGCVRDLFIDGQSKDVRQLAEQQNAAGVKPFCAKDSPKQCSSNPCRNHGVCREGWN-RYVCDCTATGYTGRSCEREASI 448          
BLAST of SMED30034068 vs. Ensembl Medaka
Match: cntnap5a (contactin-associated protein-like 5 [Source:NCBI gene;Acc:101169574])

HSP 1 Score: 50.447 bits (119), Expect = 6.211e-6
Identity = 59/268 (22.01%), Postives = 106/268 (39.55%), Query Frame = 3
Query:  702 IAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSS--CFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTEN--HFISLKRLRFS----FRPNTVGEYD----------GFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQM----KIFYFQ-------------NYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTN 1400
            +    + +   +GC+   ++  +   L    + +   +   C   C+ SS  C N+G+C E   G Y CDC  S + G  C  E S+ FD   SVT       S+ + R S      P++    D             LL++    Q+Y  + +  N  L        D + DV+       N +   LA+ RL+ I++    K  Y Q             +  LI  ++++ G+++   N+ + +          ++K F GCL++
Sbjct:  906 VGGTASQQRGFLGCIRSLTVNGMGFDLEERAK-MTPGVSAGCPGYCSGSSNLCHNRGKCIEKSNG-YICDCSQSAYGGTTCNQEVSVSFDRESSVTYTFQEPFSVMQNRSSKASGVSPDSRAREDVAFSFVTSQRPAMLLTVSTSGQRYIAVILARNGTLQIWYRLQTDRSPDVF-------NPTPGNLADGRLHRIRIHRVGKNLYVQIDQDVHRKYTLSSDAELISIRSLTLGKVTGMENLDEEV-------RRAALKGFFGCLSS 1157          
BLAST of SMED30034068 vs. Ensembl Medaka
Match: cntnap5a (contactin-associated protein-like 5 [Source:NCBI gene;Acc:101169574])

HSP 1 Score: 50.447 bits (119), Expect = 7.579e-6
Identity = 59/257 (22.96%), Postives = 103/257 (40.08%), Query Frame = 3
Query:  735 IGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSS--CFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTEN--HFISLKRLRFS----FRPNTVGEYD----------GFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQM----KIFYFQ-------------NYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTN 1400
            +GC+   ++  +   L    + +   +   C   C+ SS  C N+G+C E   G Y CDC  S + G  C  E S+ FD   SVT       S+ + R S      P++    D             LL++    Q+Y  + +  N  L        D + DV+       N +   LA+ RL+ I++    K  Y Q             +  LI  ++++ G+++   N+ + +          ++K F GCL++
Sbjct:  917 LGCIRSLTVNGMGFDLEERAK-MTPGVSAGCPGYCSGSSNLCHNRGKCIEKSNG-YICDCSQSAYGGTTCNQEVSVSFDRESSVTYTFQEPFSVMQNRSSKASGVSPDSRAREDVAFSFVTSQRPAMLLTVSTSGQRYIAVILARNGTLQIWYRLQTDRSPDVF-------NPTPGNLADGRLHRIRIHRVGKNLYVQIDQDVHRKYTLSSDAELISIRSLTLGKVTGMENLDEEV-------RRAALKGFFGCLSS 1157          
BLAST of SMED30034068 vs. Planmine SMEST
Match: SMESG000013083.1 (SMESG000013083.1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 568/573 (99.13%), Postives = 570/573 (99.48%), Query Frame = 3
Query:  237 MVMIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISLKRLRFSFRPNTVGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYXXXXXXXXXXXXXXXXXXXXCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGXXXXXXXXXXXTLAVPEDREKLQ 1955
            MVMIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNL+GCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIK D TFSVTENHFISLKRLRFSFRPNT GEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYI+ISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVPEDREKLQ
Sbjct:    1 MVMIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLLGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKLDGTFSVTENHFISLKRLRFSFRPNTAGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYIIISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVPEDREKLQ 573          
BLAST of SMED30034068 vs. Planmine SMEST
Match: SMESG000013083.1 (SMESG000013083.1)

HSP 1 Score: 1095.88 bits (2833), Expect = 0.000e+0
Identity = 566/571 (99.12%), Postives = 568/571 (99.47%), Query Frame = 3
Query:  243 MIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISLKRLRFSFRPNTVGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYXXXXXXXXXXXXXXXXXXXXCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGXXXXXXXXXXXTLAVPEDREKLQ 1955
            MIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNL+GCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIK D TFSVTENHFISLKRLRFSFRPNT GEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYI+ISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVPEDREKLQ
Sbjct:    1 MIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKFQNIAKLKTIRLNLLGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKLDGTFSVTENHFISLKRLRFSFRPNTAGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNNYTAYIIISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVPEDREKLQ 571          
BLAST of SMED30034068 vs. Planmine SMEST
Match: SMESG000067632.1 (SMESG000067632.1)

HSP 1 Score: 386.726 bits (992), Expect = 1.455e-125
Identity = 246/633 (38.86%), Postives = 370/633 (58.45%), Query Frame = 3
Query:  111 MKFIKFFVIGYFFNFLQAQNLNESVSFVQTSRTFWQNSYWHDMVMIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFL---LGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTS--NKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISLKRLRFSFRPNTVGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQ-------FIGKTRNISEN---KNNYTAYXXXXXXXXXXXXXXXXXXXXCKIHSRKEKH-KESFQVLE-----NNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGXXXXXXXXXXXTLAVPEDRE 1946
            M FI  F++G+  + + A   ++S+SF   S++F  NSYWH  + I +++ F+EEGI +K+ LN++QGLLFY IDSNYRT+W+EF +  L I+YYNF I+E  +  F+I  L   + ++K ++          N++ I CN   + +DY +P   + E+ L+ F      P+P+F+     TE+H WIGN+P  +  N +QNI   K+ RLNL GCVE F I N  +KLA+SG   GEMI+PFCKPIC  +SCFN G+C ELWRG + CDC +SQF+G RC L++S+KF+ +FS   + +  L++L+F+F+P    ++ G K+LSLK    QY  +Y+D     H R   + D   D  F  KL +++ ++   +V ++EI++++F   + +L E + I   E ++   +  ILVGD H      M +++GCLTN +L+ ++++FI N  R    +P C+      EA  ++ KPN+      K Q          KT N +EN    N+Y  YI I+ +    L+   +I++  K     +K   ES   +      N  L+H+ L E+Q    N+   + +   H+YPSPI MTFKPAYKAKSM SSITN S++SLP   SPTLA  ED E
Sbjct:    1 MAFIYQFLLGWMLSLISA--YDQSISFSPISKSF-PNSYWHGKMAILRSKSFIEEGILLKVQLNQFQGLLFYAIDSNYRTIWVEFVQEMLEISYYNFMISEANRGYFRIKDLCIPINDNKLIL----NFVSKNNEIIISCNGNSRTLDYTQPPEIVSENELRTFNSYMNFPVPYFNE----TEVHFWIGNVPSENEENLYQNIVHWKSNRLNLWGCVELFQIKNKILKLASSGNFFGEMIQPFCKPICKANSCFNNGKCLELWRGRFICDCGFSQFVGERCNLDHSVKFNRSFSFQHSIYFKLQKLQFAFQPVIDDQHRGHKMLSLKLFKNQYIYIYLDIEYFFHVRFEQNTDWIFDEKFRMKLYNSRMYLVFIDVNIDEIRIQLFDALDKSLFERKIIQPQESNLV--ITDILVGDSHSHGMGWMGKYEGCLTNLMLKLDSRKFIWNEIRNFDKFPNCK------EAARTTLKPNQTRSSKSKSQNQNSRAVLHSKTLNGTENIPRNNDYLIYITIASIFFALLIATLLIVIIIKFKLTNQKSFSESSDKIRLTDNFNKSLNHSELPEQQQIITNSLCNSPTNSNHIYPSPIYMTFKPAYKAKSMTSSITNRSVMSLPNPTSPTLATQEDGE 614          
BLAST of SMED30034068 vs. Planmine SMEST
Match: SMESG000067632.1 (SMESG000067632.1)

HSP 1 Score: 379.407 bits (973), Expect = 8.269e-123
Identity = 240/612 (39.22%), Postives = 359/612 (58.66%), Query Frame = 3
Query:  174 NESVSFVQTSRTFWQNSYWHDMVMIGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYYNFKINELEKHTFKISFL---LGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVDYVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTS--NKFQNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNTSSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHFISLKRLRFSFRPNTVGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIYSNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTISFGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTSRESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQ-------FIGKTRNISEN---KNNYTAYXXXXXXXXXXXXXXXXXXXXCKIHSRKEKH-KESFQVLE-----NNRLHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGXXXXXXXXXXXTLAVPEDRE 1946
            ++S+SF   S++F  NSYWH  + I +++ F+EEGI +K+ LN++QGLLFY IDSNYRT+W+EF +  L I+YYNF I+E  +  F+I  L   + ++K ++          N++ I CN   + +DY +P   + E+ L+ F      P+P+F+     TE+H WIGN+P  +  N +QNI   K+ RLNL GCVE F I N  +KLA+SG   GEMI+PFCKPIC  +SCFN G+C ELWRG + CDC +SQF+G RC L++S+KF+ +FS   + +  L++L+F+F+P    ++ G K+LSLK    QY  +Y+D     H R   + D   D  F  KL +++ ++   +V ++EI++++F   + +L E + I   E ++   +  ILVGD H      M +++GCLTN +L+ ++++FI N  R    +P C+      EA  ++ KPN+      K Q          KT N +EN    N+Y  YI I+ +    L+   +I++  K     +K   ES   +      N  L+H+ L E+Q    N+   + +   H+YPSPI MTFKPAYKAKSM SSITN S++SLP   SPTLA  ED E
Sbjct:    9 DQSISFSPISKSF-PNSYWHGKMAILRSKSFIEEGILLKVQLNQFQGLLFYAIDSNYRTIWVEFVQEMLEISYYNFMISEANRGYFRIKDLCIPINDNKLIL----NFVSKNNEIIISCNGNSRTLDYTQPPEIVSENELRTFNSYMNFPVPYFNE----TEVHFWIGNVPSENEENLYQNIVHWKSNRLNLWGCVELFQIKNKILKLASSGNFFGEMIQPFCKPICKANSCFNNGKCLELWRGRFICDCGFSQFVGERCNLDHSVKFNRSFSFQHSIYFKLQKLQFAFQPVIDDQHRGHKMLSLKLFKNQYIYIYLDIEYFFHVRFEQNTDWIFDEKFRMKLYNSRMYLVFIDVNIDEIRIQLFDALDKSLFERKIIQPQESNLV--ITDILVGDSHSHGMGWMGKYEGCLTNLMLKLDSRKFIWNEIRNFDKFPNCK------EAARTTLKPNQTRSSKSKSQNQNSRAVLHSKTLNGTENIPRNNDYLIYITIASIFFALLIATLLIVIIIKFKLTNQKSFSESSDKIRLTDNFNKSLNHSELPEQQQIITNSLCNSPTNSNHIYPSPIYMTFKPAYKAKSMTSSITNRSVMSLPNPTSPTLATQEDGE 603          
BLAST of SMED30034068 vs. Planmine SMEST
Match: SMESG000013089.1 (SMESG000013089.1)

HSP 1 Score: 194.126 bits (492), Expect = 4.067e-58
Identity = 130/143 (90.91%), Postives = 133/143 (93.01%), Query Frame = 3
Query: 1527 FTKELPKIQFIGKTRNISENKNNYTAYXXXXXXXXXXXXXXXXXXXXCKIHSRKEKHKESFQVLENNR-----LHHNYLKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGXXXXXXXXXXXTLAVPED 1940
             + ELPKIQF GKTRNISENKNNYTAYILISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNR      HHNYLKEKQFQSLNNGDVT+SIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVP+ 
Sbjct:    5 LSNELPKIQFNGKTRNISENKNNYTAYILISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRRFLNRTHHNYLKEKQFQSLNNGDVTNSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLLSLPLSISPTLAVPQG 147          
The following BLAST results are available for this feature:
BLAST of SMED30034068 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cntnap5b7.524e-629.17contactin associated protein-like 5b [Source:ZFIN;... [more]
back to top
BLAST of SMED30034068 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gldc2.727e-727.61glycine decarboxylase [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of SMED30034068 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NPF98.439e-825.48Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V4A7961.082e-722.57Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9LN941.669e-722.63Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A226F4U42.677e-725.00Contactin-associated protein-like 5 OS=Folsomia ca... [more]
A0A2R2MJW03.882e-725.17contactin-associated protein-like 4 isoform X2 OS=... [more]
back to top
BLAST of SMED30034068 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002142.12.068e-729.09pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1... [more]
back to top
BLAST of SMED30034068 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034068 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cntnap5a6.211e-622.01contactin-associated protein-like 5 [Source:NCBI g... [more]
cntnap5a7.579e-622.96contactin-associated protein-like 5 [Source:NCBI g... [more]
back to top
BLAST of SMED30034068 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013083.10.000e+099.13SMESG000013083.1[more]
SMESG000013083.10.000e+099.12SMESG000013083.1[more]
SMESG000067632.11.455e-12538.86SMESG000067632.1[more]
SMESG000067632.18.269e-12339.22SMESG000067632.1[more]
SMESG000013089.14.067e-5890.91SMESG000013089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034068 ID=SMED30034068|Name=SMED30034068|organism=Schmidtea mediterranea sexual|type=transcript|length=2109bp
TTCAAATATTCTTCATTGGTCGTTCGATTTAACCCAATTAAATAATCTTA
TTAAAATTAGAGTGTTACATTGTCCACAATTTATTGGATTCTAAAATGTT
TCAGGTGCTCATGAAATTTATAAAATTTTTTGTAATCGGATATTTTTTCA
ATTTTCTGCAAGCTCAAAATTTGAATGAATCAGTCAGTTTTGTTCAAACT
TCCCGAACTTTTTGGCAGAATTCTTATTGGCACGATATGGTGATGATTGG
AAAAAATCGATTTTTCCTGGAAGAAGGAATCAATATGAAAATAAATTTAA
ACAAATATCAAGGACTTTTATTTTATATAATTGATAGCAATTATCGAACT
CTTTGGTTGGAATTCTCAGAAAATTTTCTTGTAATTAATTATTACAATTT
CAAAATAAATGAATTAGAAAAACACACTTTTAAAATATCATTTTTGCTTG
GAAATCACAAAAATGTTATTGAGGCAGATTTTGGATTATCATATACCCAG
AATAAACTCAGAATATACTGTAATGACAAATTTCAAATAGTTGACTATGT
AAAACCTTTATATCCTATACCAGAGAGTAATTTGAAACAATTTATTGAAA
CATTTACAATGCCAATACCATTTTTCGATAATTCTAATGAAACGACTGAA
ATTCATGTTTGGATCGGAAACATACCGAAGACCAGCAATAAATTTCAAAA
TATTGCTAAATTGAAAACCATTCGTTTGAACTTGATTGGATGTGTTGAAC
AATTTTCTATTACTAATTTGAATATGAAATTAGCAACATCCGGTGAACAT
GTTGGTGAAATGATTGAGCCATTTTGTAAACCTATATGCAATACGTCTTC
ATGCTTTAATCAAGGTCAGTGTTACGAACTTTGGAGAGGAAATTATGAAT
GTGATTGTGAATATTCACAATTTATAGGACGACGTTGTGAATTAGAGTAT
TCAATAAAATTCGATAGCACCTTTTCTGTTACAGAAAATCATTTTATTTC
ATTGAAACGACTCCGGTTTTCATTCAGGCCAAACACAGTCGGGGAATACG
ATGGTTTTAAATTATTATCCTTGAAATTTAAAGATCAGCAATATTTTGTT
ATGTACATTGATTCGAATAGTCTTTTGCACGGAAGACTTATTTATTCAAA
CGATTTGAATATCGATGTCTATTTTACATATAAATTGAAACACAATCAAT
CGTTCATATTTTTGGCGGAAGTGAGATTGAATGAAATACAAATGAAGATA
TTTTATTTTCAAAATTACACTCTGATTGAAACTCAAACTATTTCCTTCGG
AGAAATTTCCATCTTTTTCAACGTAAGACAAATTCTTGTTGGAGATTTAC
ACATTCCATTTTTCTATTCAATGAAACGTTTCAAAGGATGTTTAACAAAT
TTTGTTTTACAGTCAGAAACTAAACAATTCATATTGAATACATCTAGAGA
ATCCACAAATTATCCTCCATGTCAACAAATTGCAGGATATAATGAAGCAT
GGAATTCCTCGTATAAACCAAATAAATTTACAAAAGAATTACCTAAAATC
CAATTTATTGGAAAAACACGAAATATAAGTGAAAACAAAAATAATTATAC
TGCATACATCCTTATCTCAGTTGTTTCATCCTTTTCACTGTTGGTTGTTG
GTATAATCATTTTGTTCTGTAAAATTCATTCACGAAAAGAGAAACATAAA
GAGTCGTTTCAAGTTTTAGAAAACAACCGATTACACCACAATTATCTAAA
AGAAAAACAATTTCAGTCATTAAACAATGGCGACGTAACAGATTCAATTC
CATGTCATGTATATCCATCGCCTATCTGTATGACATTTAAACCAGCTTAT
AAAGCCAAAAGTATGTGCTCCTCAATTACAAATGGATCTCTTTTGTCTTT
GCCCCTCTCTATATCTCCTACTTTAGCAGTTCCTGAAGATCGAGAGAAAC
TACAGTAATACTTATTCCAATAGAACTTCTACGACACCAAAATTAAAATG
GAAACCCAGCAAGTCAACATATTGTAGATAAATTTAATTTTATGGATTTG
AATTCGTTTGTTGAGAGATTTGTTTAAAATTGTTTTTTATTTGATTCGTT
ATTGTTCAC
back to top

protein sequence of SMED30034068-orf-1

>SMED30034068-orf-1 ID=SMED30034068-orf-1|Name=SMED30034068-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MFQVLMKFIKFFVIGYFFNFLQAQNLNESVSFVQTSRTFWQNSYWHDMVM
IGKNRFFLEEGINMKINLNKYQGLLFYIIDSNYRTLWLEFSENFLVINYY
NFKINELEKHTFKISFLLGNHKNVIEADFGLSYTQNKLRIYCNDKFQIVD
YVKPLYPIPESNLKQFIETFTMPIPFFDNSNETTEIHVWIGNIPKTSNKF
QNIAKLKTIRLNLIGCVEQFSITNLNMKLATSGEHVGEMIEPFCKPICNT
SSCFNQGQCYELWRGNYECDCEYSQFIGRRCELEYSIKFDSTFSVTENHF
ISLKRLRFSFRPNTVGEYDGFKLLSLKFKDQQYFVMYIDSNSLLHGRLIY
SNDLNIDVYFTYKLKHNQSFIFLAEVRLNEIQMKIFYFQNYTLIETQTIS
FGEISIFFNVRQILVGDLHIPFFYSMKRFKGCLTNFVLQSETKQFILNTS
RESTNYPPCQQIAGYNEAWNSSYKPNKFTKELPKIQFIGKTRNISENKNN
YTAYILISVVSSFSLLVVGIIILFCKIHSRKEKHKESFQVLENNRLHHNY
LKEKQFQSLNNGDVTDSIPCHVYPSPICMTFKPAYKAKSMCSSITNGSLL
SLPLSISPTLAVPEDREKLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 245..284
e-value: 3.7E-8
score: 35.1
NoneNo IPR availableCDDcd00054EGF_CAcoord: 253..282
e-value: 0.00498103
score: 32.9938
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.657
NoneNo IPR availableTMHMMTMhelixcoord: 503..525
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 245..282
score: 12.143
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 269..443