Voltage-gated hydrogen channel 1

Overview
NameVoltage-gated hydrogen channel 1
Smed IDSMED30034056
Length (bp)2197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-gated hydrogen channel 1 (SMED30034056) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30034056) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-gated hydrogen channel 1 (SMED30034056) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-gated hydrogen channel 1 (SMED30034056) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034056

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30034056SMESG000070756.1 dd_Smed_v4_15085_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30034056SMESG000070756.1 dd_Smed_v4_15085_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034056SMESG000070756.1 dd_Smed_v4_15085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30034056SMESG000070756.1 dd_Smed_v4_15085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034056SMESG000070756.1 dd_Smed_v6_15085_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30034056SMESG000070756.1 dd_Smed_v4_15085_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 64.6994 bits (156), Expect = 8.783e-11
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  138 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 237          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 64.6994 bits (156), Expect = 9.217e-11
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  118 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 217          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 64.3142 bits (155), Expect = 1.234e-10
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  138 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 237          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 64.3142 bits (155), Expect = 1.234e-10
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  138 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 237          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Match: HVCN1 (hydrogen voltage gated channel 1 [Source:HGNC Symbol;Acc:HGNC:28240])

HSP 1 Score: 64.3142 bits (155), Expect = 1.234e-10
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  138 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 237          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 68.5514 bits (166), Expect = 1.727e-12
Identity = 36/112 (32.14%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  877 VVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVN--IGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQL 1206
            +  +  HY S+ +L  F++E+  KI     +F   KFEV D +V+V SF+ DII ++       + ++I+  LWR+ R+ING+L+  + R   R+   +K + ++E  V Q+
Sbjct:   99 IAPQVFHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYISKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV---EKLKEINESLVHQV 207          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 53.9138 bits (128), Expect = 5.138e-7
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSF---VADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            +H+ S++IL +F  E   +I  +G   + + K EV D  VIV S    VA  +     S    IS++I   +WR+ R+I+  ++  K   E  I   +K++ V E ++E+LT
Sbjct:  133 IHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQYEKSKAVREEQLERLT 244          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 74.7146 bits (182), Expect = 1.978e-14
Identity = 40/120 (33.33%), Postives = 67/120 (55.83%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQ 1227
            H++ E  HY SI +L  F+LE+  K+     +FF  KFEV DA ++V SF+ DI+ ++       + ++I+  LWR+ R++NG+++  K + E +I   K+ +     KV  L  Q   Q
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKIHRLKENQESLLEKVAHLEQQCAQQ 210          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:496712])

HSP 1 Score: 73.1738 bits (178), Expect = 6.480e-14
Identity = 34/96 (35.42%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRI 1155
            H++ E  HY SI +L  F+LE+  K+     +FF  KFEV DA ++V SF+ DI+ ++       + ++I+  LWR+ R++NG+++  K + E +I
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKI 186          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Match: mcf2l2 (MCF.2 cell line derived transforming sequence-like 2 [Source:Xenbase;Acc:XB-GENE-6037884])

HSP 1 Score: 52.7582 bits (125), Expect = 1.547e-6
Identity = 36/115 (31.30%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  883 SETLHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSF---VADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            S  +H+ S+ IL +F +E  L+I  +G   + + K EV+D  VIV S    VA  +     S    IS+ I   +WR+ R+I+  ++  K   E  +   +KA+ + E ++E LT
Sbjct:   74 SGIIHWISLAILSMFFVETVLRIVILGIWDYIENKVEVIDGAVIVLSLAPMVASTVANGPSSPWDAISLFISLRIWRVKRIIDAYILPVKVEMEILVQQYEKAKLIQEEQMEHLT 188          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 63.5438 bits (153), Expect = 1.460e-10
Identity = 41/121 (33.88%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQ--TEMQEVIF 1239
              HY S  IL  F+LE+  KI     +FF  KFE++DA V+V SFV D++++      + + ++I+  LWR+ R+ING+++  K R E +I           ++++Q+ IQ  T++Q + F
Sbjct:  134 AFHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLLFKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQI-----------LRLKQINIQLATKIQHLEF 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Hvcn1 (hydrogen voltage-gated channel 1 [Source:MGI Symbol;Acc:MGI:1921346])

HSP 1 Score: 63.5438 bits (153), Expect = 1.460e-10
Identity = 41/121 (33.88%), Postives = 70/121 (57.85%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQ--TEMQEVIF 1239
              HY S  IL  F+LE+  KI     +FF  KFE++DA V+V SFV D++++      + + ++I+  LWR+ R+ING+++  K R E +I           ++++Q+ IQ  T++Q + F
Sbjct:  134 AFHYMSFAILVFFMLEIFFKIFVFRLEFFHHKFEILDAFVVVVSFVLDLVLLFKSHHFEALGLLILLRLWRVARIINGIIISVKTRSERQI-----------LRLKQINIQLATKIQHLEF 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Tmem266 (transmembrane protein 266 [Source:MGI Symbol;Acc:MGI:2142980])

HSP 1 Score: 53.5286 bits (127), Expect = 7.971e-7
Identity = 33/113 (29.20%), Postives = 62/113 (54.87%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSFVADIIIVNIGS------QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            +H+ S++IL +F  E  L+I  +G   + + K EV D  VI+ S  A ++   + +        IS++I+F +WR+ RVI+  ++  K   E      +KA+ + + ++E+LT
Sbjct:  138 IHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSL-APMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERLT 249          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Match: Tmem266 (transmembrane protein 266 [Source:MGI Symbol;Acc:MGI:2142980])

HSP 1 Score: 50.8322 bits (120), Expect = 3.254e-6
Identity = 33/114 (28.95%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVG-CKFFKAKFEVVDAVVIVTSFVADIIIVNIGS------QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
             +H+ S++IL +F  E  L+I  +G   + + K EV D  VI+ S +A ++   + +        IS++I+F +WR+ RVI+  ++  K   E      +KA+ + + ++E+LT
Sbjct:   72 VIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILS-LAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQLERLT 184          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5F4C0|HVCN1_CHICK (Voltage-gated hydrogen channel 1 OS=Gallus gallus OX=9031 GN=HVCN1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.790e-17
Identity = 42/113 (37.17%), Postives = 72/113 (63.72%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIV--NIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQL 1206
            H+  +  HY S+ IL +F++EVG KI   G +FF  KFEV+D++V+V SF+ D++++      + + ++I+  LWR+ R+ING+++  K R E +++  K+       KVEQL
Sbjct:   95 HIAPKVFHYLSLSILTIFLVEVGFKIFVYGREFFHHKFEVLDSIVVVVSFILDLVLLFREHEFEAVGLLILLRLWRVARIINGIILSVKTRSEQQVSKLKQVNLKLATKVEQL 207          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M7E9|HVCN1_XENLA (Voltage-gated hydrogen channel 1 OS=Xenopus laevis OX=8355 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.984e-13
Identity = 34/93 (36.56%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDE 1146
            H++ E  HY SI +L  F+LE+  K+     +FF  KFEV DA ++V SF+ DI+ ++       + ++I+  LWR+ R++NG+++  K R E
Sbjct:   91 HIIPEIFHYLSISVLTFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGVIVSVKTRAE 183          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q5M8L8|HVCN1_XENTR (Voltage-gated hydrogen channel 1 OS=Xenopus tropicalis OX=8364 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 3.433e-13
Identity = 34/96 (35.42%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRI 1155
            H++ E  HY SI +L  F+LE+  K+     +FF  KFEV DA ++V SF+ DI+ ++       + ++I+  LWR+ R++NG+++  K + E +I
Sbjct:   91 HIIPEIFHYLSISVLSFFILEIAGKLYAFRLEFFHHKFEVFDAAIVVISFIIDIVYISREDIFNAVGLLILLRLWRVARIVNGIIVSVKTQAEDKI 186          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q6DHQ1|HVCN1_DANRE (Voltage-gated hydrogen channel 1 OS=Danio rerio OX=7955 GN=hvcn1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.419e-11
Identity = 36/112 (32.14%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  877 VVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVN--IGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQL 1206
            +  +  HY S+ +L  F++E+  KI     +F   KFEV D +V+V SF+ DII ++       + ++I+  LWR+ R+ING+L+  + R   R+   +K + ++E  V Q+
Sbjct:   99 IAPQVFHYLSLALLTFFMVELAGKIFAYRLEFLHHKFEVFDGIVVVVSFILDIIYISKEDAFDAMGLLILLRLWRVARIINGILVSVQNRANHRV---EKLKEINESLVHQV 207          
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Match: sp|Q96D96|HVCN1_HUMAN (Voltage-gated hydrogen channel 1 OS=Homo sapiens OX=9606 GN=HVCN1 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.928e-10
Identity = 38/106 (35.85%), Postives = 64/106 (60.38%), Query Frame = 1
Query:  889 TLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQ--EISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVE 1200
              HY SI IL  F++E+  K+     +FF  KFE++DAVV+V SF+ DI+++    Q   + ++I+  LWR+ R+ING+++  K R E      ++  R+ +M V+
Sbjct:  138 VFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE------RQLLRLKQMNVQ 237          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A158QF49 (Ion_trans domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8325 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.512e-71
Identity = 168/463 (36.29%), Postives = 247/463 (53.35%), Query Frame = 1
Query:  289 YSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNS---IEAHQEQ-----------------IRETIVFVNKTFRSQ--IAHLNQ----------GDSHDE--IGTMETILDTLNEYSFNCTTPKLK--NIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTS-QTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRFAASYSPSCTPRNRSPQF--HKK 1557
            Y++ ++W   +  + QL KDNID  L   E ++    +  ++ +++ L   +SN  QI++ +LVL+D+GIVI EIILEI S++N     + H ++                 +   I+  NK   +     H+NQ            S DE  +  +E  L+    Y  N    KL   N+   ++  HL                     N++     + SE+  T+  TLH  SE +HY SI + GLF++   LKI C+G KFF   +EV+DA+VI+TSF++DI  + + SQEI+ M+I LLWRIVR+IN +LM+E+QR EFR+ LQK+ARR+ E KV+ L    E+QE                       KHI  LE+ +R  G  E  ++ C+P+Y+ ++K+QT N LKSIAA+TTGFMGGLVGA  + KE I RFA S SP  T  N++  F  H+K
Sbjct:   51 YNYELSWANSKTFIKQLAKDNIDSSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFDIHAQRLSYIMANQNFHWTGSWCVPPGIILENKPIETSNDRLHMNQIHRTIIPLGSTASTDEHRLAVLEDFLECWRAYVDNAEKTKLGGCNLDLLQRCIHL---------------------NTSEIQEPETSERNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGKKFFLNVYEVIDALVILTSFISDISYIKLDSQEIAAMVILLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQE-----------------------KHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARFATS-SPPTTNANQASLFNNHQK 468          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A0R3T0R3 (Ion_trans domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS428 PE=4 SV=2)

HSP 1 Score: 250.366 bits (638), Expect = 4.685e-71
Identity = 158/448 (35.27%), Postives = 241/448 (53.79%), Query Frame = 1
Query:  289 YSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLK-------------NSIEAHQ------------EQIRET---IVFVNKTFRSQIAH--LNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXH---GQNSTSTSSHKVSEKKHTS-QTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRFAASYSPSCTP 1527
            Y++ + W   +  + QL KDN D  L   E ++    +  ++ +++ L   +SN  QI++ +LVL+D+GIVI EIILEI S++             N I A Q            E +RE+   I    + +  Q  H  +  G +   I + E  L  L ++ F C    + +   ++ D  +    +  + S    ++        N++     + SE   T+  TLH  SE +HY SI + GLF++   LKI C+G KFF   +EV+DA+VI+TSF++DI  + + SQEI+ M++ LLWRIVR+IN +LM+E+QR EFR+ LQK+ARR+ E KV+ L    E+QE                       KHI  LE+ +R  G  E  ++ C+P+Y+ ++K+QT N LKSIAA+TTGFMGGLVGA  + K+ I RFA +  P+  P
Sbjct:   51 YNYELGWANSKAFIKQLAKDNTDPSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFDIHAQRLNYIMAKQNSQWTGSWCLPTEVVRESELNITTKKRLYMKQTHHTIIQHGST---IMSDENRLAVLEDF-FECWRTYVDDAEQTRLDVTVAAAITHAENSNCCDSDLRQRCINLNNSKIQEPETSEGNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGRKFFSNVYEVIDALVILTSFISDISYIKLDSQEIAAMVLLLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQE-----------------------KHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPFTQKDSIARFATNSLPTANP 471          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: A0A564Y6F8 (Ion_trans domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2644 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.070e-71
Identity = 162/448 (36.16%), Postives = 239/448 (53.35%), Query Frame = 1
Query:  289 YSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNS---IEAHQEQ-----------------IRETIVFVNKTFRSQ--IAHLNQ----------GDSHDE--IGTMETILDTLNEYSFNCTTPKLK--NIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTS-QTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRFAASYSPS 1518
            Y++ ++W   +  + QL KDNID  L   E ++    +  ++ +++ L   +SN  QI++ +LVL+D+GIVI EIILEI S++N     + H ++                 +   I+  NK   +     H+NQ            S DE  +  +E  L+    Y  N    KL   N+   ++  HL                     N++     + SE+  T+  TLH  SE +HY SI + GLF++   LKI C+G KFF   +EV+DA+VI+TSF++DI  + + SQEI+ M+I LLWRIVR+IN +LM+E+QR EFR+ LQK+ARR+ E KV+ L    E+QE                       KHI  LE+ +R  G  E  ++ C+P+Y+ ++K+QT N LKSIAA+TTGFMGGLVGA  + KE I RFA S  P+
Sbjct:   51 YNYELSWANSKTFIKQLAKDNIDSSLLNEELQRHAENRRRRSWRAKCLGRFRSNIAQILLCILVLIDSGIVITEIILEIRSIQNYKQFFDIHAQRLSYIMANQNFHWTGSWCVPPGIILENKPIETSNDRLHMNQIHRTIIPLGSTASTDEHRLAVLEDFLECWRAYVDNAEKTKLGGCNLDLLQRCIHL---------------------NTSEIQEPETSERNLTNPATLHRASEAMHYISIGVTGLFIVTTVLKIVCLGKKFFLNVYEVIDALVILTSFISDISYIKLDSQEIAAMVILLLWRIVRLINAMLMYERQRCEFRVVLQKRARRLQERKVDNLQRTKELQE-----------------------KHITNLEELARNIGCSEETLRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARFATSSPPT 454          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: G7YBB9 (Voltage-gated hydrogen channel 1 OS=Clonorchis sinensis OX=79923 GN=CLF_104291 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 6.446e-69
Identity = 149/395 (37.72%), Postives = 218/395 (55.19%), Query Frame = 1
Query:  289 YSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLK--NSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGA 1467
            Y +  +W ++  +L QL KDNIDI + + E      Q+  KT +  LL  L+S+ +QII++LLVL+DAGIVI EI+LEI SL+  N+   H        +   + +   I H  +  +H     ++T    ++    N TTP   NI  S  D  +  +   +        +  HG N             +++Q +H  SE LHY SI I GLF++ V +KI C+  KF +   E  DA +I+ SF +D++ V   S+  + M++FLLWRI+R+IN L+MH++Q+ E RIA+QK+ARR+   K+E +  + EMQ+                       KHI ALED  RE G    +I+RC+P+Y + TK+QTNN LKSIAA+TTG MGGLVGA
Sbjct:   18 YGYDFDWSRNRAILKQLVKDNIDISMLKDEMSTTLQQRGRKTWRQYLLTILRSHMMQIILSLLVLLDAGIVITEIVLEIQSLQKANAQLNHTPSKSGAALRRTRKYSKIILHRQRNGTH-----LQT-FSEIHRQPRNYTTPTTPNIALS--DVQI-DRLGEENIFAHDPLSFTHGTNV-----------DNSAQMMHEASEVLHYLSIAITGLFLICVIIKIICLKRKFLRDTNEYFDAGIIMASFASDVLYVRYASETAAAMVVFLLWRIIRIINALMMHKQQQYELRIAMQKRARRLLGRKMEIIRTEKEMQD-----------------------KHIGALEDLLRELGASAEVIRRCKPRYKKCTKEQTNNALKSIAALTTGVMGGLVGA 369          
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Match: W6VCQ5 (Voltage-gated hydrogen channel OS=Echinococcus granulosus OX=6210 GN=EGR_00639 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.774e-55
Identity = 104/217 (47.93%), Postives = 139/217 (64.06%), Query Frame = 1
Query:  871 LHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRFAASYSPS 1518
            LH  SE +H+ SI + GLF+    LKI C+G KFF   +EV DA+VI+ SFV+DI  + + SQEIS M+I LLWRIVR+IN +LM+E+QR EFR+ LQK+ARR+ E KV+ L    E+                        +KHI  LE+ +R  G  E  I+ C+P+Y+ ++K+QT N LKSIAA+TTGFMGGLVGA  + KE I RF A+  P+
Sbjct:   38 LHHASEVMHFVSIGVTGLFIAFTVLKIVCLGRKFFTNIYEVTDALVILVSFVSDISYIKLDSQEISAMVILLLWRIVRLINAMLMYERQRCEFRVILQKRARRLQERKVDNLQRNKEL-----------------------FQKHITNLEELARNLGCSEESIRDCKPRYVYHSKEQTQNALKSIAALTTGFMGGLVGAPLAQKESIARFTANSPPA 231          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:103044620])

HSP 1 Score: 71.2478 bits (173), Expect = 1.958e-13
Identity = 38/123 (30.89%), Postives = 73/123 (59.35%), Query Frame = 1
Query:  877 VVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVN--IGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRI-----ALQKKARRVSEMKVEQLTIQTEM 1224
            V  +  HY S+ +L  F++E+ LK+     +FFK KFEV D +V+V SFV DI+ ++       +  +I+  LWR+ R+ING+L+  + R   ++     +  +  ++V+E++ ++ T++ E+
Sbjct:   93 VAPQVFHYLSLALLTFFMVELLLKLFAYRLEFFKHKFEVFDGIVVVVSFVLDIVYISKEDAFDGMGFLILLRLWRVARIINGILVTVENRAHHKVQKVQESNDRLVQQVNELQEQKATMEHEI 215          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Match: tmem266 (transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GENE-070112-2382])

HSP 1 Score: 54.299 bits (129), Expect = 3.514e-7
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSF---VADIIIVNIGS--QEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            +H+ S++IL +F  E   +I  +G   + + K EV D  VIV S    VA  +     S    IS++I   +WR+ R+I+  ++  K   E  +   +KA+ V E ++E+LT
Sbjct:  132 IHWISLVILSVFFTETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMVASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELELQQYEKAKAVREEQLERLT 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Match: hvcn1 (hydrogen voltage-gated channel 1 [Source:NCBI gene;Acc:436618])

HSP 1 Score: 71.2478 bits (173), Expect = 3.159e-14
Identity = 37/102 (36.27%), Postives = 57/102 (55.88%), Query Frame = 1
Query:  877 VVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNI--GSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKAR 1176
            V  E LHY S+ IL LF++E+ +K+     +FF    EV+D  V+  SF  DI   +   G    + +I+  LWRI R+ NG++M  K R   R+A+ K+ +
Sbjct:   92 VAPEVLHYMSLAILSLFMVELAVKLFAFRLEFFWHPLEVLDGAVVAISFALDIFYASRHDGFDATAFLILLRLWRIARIANGIVMSVKNRTGRRVAVLKREK 193          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO34401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPG1])

HSP 1 Score: 73.1738 bits (178), Expect = 1.697e-14
Identity = 37/89 (41.57%), Postives = 57/89 (64.04%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQE-ISVMIIFLLWRIVRVINGLLMHEKQRDEFRI 1155
            LH  SI IL LF++E+ +KI  +G +FF  K EV D +V++ SF  DI      + E  S++II  LWR+ R++NG+++  K +DE +I
Sbjct:  104 LHDVSIAILSLFIIELIVKIYAMGMEFFHHKLEVFDGIVVIVSFALDIAFSGGNAAEGASLLIILRLWRVTRIVNGIILSVKMQDEKKI 192          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Match: EDO37671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF11])

HSP 1 Score: 58.151 bits (139), Expect = 1.433e-9
Identity = 30/88 (34.09%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFK-AKFEVVDAVVIVTSFVADIII----VNIGSQEISVMIIFLLWRIVRVINGLL 1122
            H  S  LH+  I IL +F LEV LK+  +G ++FK  K E+ DAV+++T+ + +I++     +   + +  +I   LWR+ RVI  ++
Sbjct:   85 HFASRLLHFVGISILAIFALEVFLKLFALGIEYFKIEKLEIFDAVIVITALIVEILLSATHTSKAWKSLGFVIGLRLWRVCRVITNII 172          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: hvcn1 (hydrogen voltage gated channel 1 [Source:NCBI gene;Acc:101159070])

HSP 1 Score: 71.2478 bits (173), Expect = 1.486e-13
Identity = 37/114 (32.46%), Postives = 67/114 (58.77%), Query Frame = 1
Query:  874 HVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIV--NIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKA-----RRVSEMK 1194
            H+  E  HY S+ +L  F++E+  K+     +FF  KFE+ D +V+V SF+ DI+ +        + ++I+  LWR+ R+ING+++  K R + RI   K++     +RV+E++
Sbjct:   89 HIAPEVFHYLSLAVLTFFMMELAGKLFAFRLEFFHHKFEMFDGLVVVVSFILDIVFIFHEDAFDGMGLLILLRLWRVARIINGIVVSVKNRADQRIHKLKESYDHVVQRVTELQ 202          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000015469.2 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 53.1434 bits (126), Expect = 9.102e-7
Identity = 36/112 (32.14%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSFVADI--IIVNIGSQE---ISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            +H+ S+IIL LF  E   +I  +G   + + K EV D  VIV S    +   + N  S     IS++I   +WR+ R+I+  ++  K   E  I   +K + V E ++E+LT
Sbjct:  132 IHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERLT 243          
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Match: ENSORLT00000046304.1 (transmembrane protein 266 [Source:NCBI gene;Acc:101174011])

HSP 1 Score: 52.7582 bits (125), Expect = 1.044e-6
Identity = 36/112 (32.14%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  892 LHYASIIILGLFVLEVGLKIACVGC-KFFKAKFEVVDAVVIVTSFVADI--IIVNIGSQE---ISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLT 1209
            +H+ S+IIL LF  E   +I  +G   + + K EV D  VIV S    +   + N  S     IS++I   +WR+ R+I+  ++  K   E  I   +K + V E ++E+LT
Sbjct:  131 IHWISLIILSLFFSETVFRIVVLGIWDYIENKVEVFDGAVIVLSLAPMMASTVANGPSSPWDAISLIITLRIWRVKRIIDAYVLQVKVEMELEIQQCEKTKAVREEQLERLT 242          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 606/629 (96.34%), Postives = 606/629 (96.34%), Query Frame = 1
Query:  163 MEGIIRDAVMNNNKANKDQNKGNKYSKAKTHLTIDDTFAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCXXXXXXXXXXXXKEENTEXXXXXXXXXXXXXXXKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 2049
            MEGIIRDAVMNNNKANKDQNKGNKYSKAKTHLTIDDTFAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE                       KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV
Sbjct:    1 MEGIIRDAVMNNNKANKDQNKGNKYSKAKTHLTIDDTFAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE-----------------------KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 606          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 1051.58 bits (2718), Expect = 0.000e+0
Identity = 565/589 (95.93%), Postives = 566/589 (96.10%), Query Frame = 1
Query:  283 RSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCXXXXXXXXXXXXKEENTEXXXXXXXXXXXXXXXKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 2049
            +SYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE                       KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV
Sbjct:   55 KSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE-----------------------KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 620          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000070756.1 (SMESG000070756.1)

HSP 1 Score: 1030.78 bits (2664), Expect = 0.000e+0
Identity = 557/580 (96.03%), Postives = 557/580 (96.03%), Query Frame = 1
Query:  310 MKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCXXXXXXXXXXXXKEENTEXXXXXXXXXXXXXXXKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 2049
            MKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE                       KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV
Sbjct:    1 MKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKRSVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQE-----------------------KHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAFNWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLENVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFRCTHHIGSDTTLVPSNDEDFDFVSKFTDYV 557          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000077167.1 (SMESG000077167.1)

HSP 1 Score: 350.517 bits (898), Expect = 1.054e-112
Identity = 200/430 (46.51%), Postives = 268/430 (62.33%), Query Frame = 1
Query:  274 FAERSYSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTF-------RSQIAHLNQGDS-HDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSE----KKHTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYSPSCTP 1527
            F +RS S  V W+ D K L QL +DNIDI++   E   E + +    ++  +L  LQ +P+QI+IA+LVL+DAGIVIAEI+LEIHS+KN IEA+ EQ+R+TI F+N TF          I  L +  S H E+  +  IL  L +   +  + ++++ +   K+S +                  H +  T  + H   E    K+H S  LH  SE LH+ASI +LGLFV+E+ +KI C+G  FFKA+FEV+DA+VI+TSF+ADI+IV +GSQEISVMIIFLLWRIVRVINGL+MHEKQRDE RI LQKKARR+SEMK+E L IQ EMQE                       KH + LE+    AG    +I++C+PK+    K  TNNPLKSIAA+T+GFMG +VGA  +NK I++F   +S S +P
Sbjct:    4 FIKRSCSLHVRWLNDTKFLQQLSEDNIDIDILNKELYAEESGRKQTHIQKIILNILQCHPMQILIAILVLIDAGIVIAEIVLEIHSMKNKIEAYSEQMRDTIHFLNHTFVDTHIFDNVDIQALEESPSTHKELDLLAQILQLLPQ---SIASFQIQSQFQCFKNSPVNGS---------------HPKEKTQITKHGHQEATYIKQHRSTNLHKASEMLHFASIALLGLFVVELTVKILCIGPTFFKARFEVIDAIVILTSFIADIVIVVVGSQEISVMIIFLLWRIVRVINGLIMHEKQRDELRIFLQKKARRISEMKLEDLIIQKEMQE-----------------------KHCIVLEELCVRAGASPDLIQKCKPKFTPINKCHTNNPLKSIAALTSGFMGTIVGAHATNKFIHKFVF-HSNSTSP 391          
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Match: SMESG000002770.1 (SMESG000002770.1)

HSP 1 Score: 308.531 bits (789), Expect = 4.822e-95
Identity = 180/444 (40.54%), Postives = 262/444 (59.01%), Query Frame = 1
Query:  289 YSFRVNWMKDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQIIIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQIAHLNQ-----GDSHDEIGTMETI-----------LDTLNEYSFNCTTPKLKNIYNSKKDSHLXXXXXXXXXXXXXXXXXXHGQNSTSTSSHKVSEKK--HTSQTLHVVSETLHYASIIILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQEISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTIQTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIKRCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKE-INRFAASYSPSCTPRNRSPQFHKKLK 1563
            Y+  + W+ ++K + QL+KDNID+EL + E  ++   K H T + + L  ++ N +Q++++LL+L+DAGIVI EIILEIHS+KN  E +++   E +++ N    S  A LN      G  + ++  +E I           L  L   SF+   P      ++  DSH                        + +S HKV+ +   H S  LH +   LHY SI IL +F++E+ L+I C+G +FFK K E+ D  +IVTSF+ADII V + S +ISVM++FLLWRIVR+INGL+MHEKQRDEFRI LQKK RR+ +MKV++L+ + E+                       L KH++ LE+  +E G  E  +K C+P++ +Y+K+QTNN LKSIAA+TTGFMGG+VGA  SN+  INR++ + SPS  P  +SP   KKLK
Sbjct:   29 YTINIEWLNNKKFIKQLEKDNIDVELLREELTRQHRIKRHYTWREKTLQLIKGNFVQVLLSLLILIDAGIVITEIILEIHSMKNKKEHYED---ENVIYKNFIQTSLNALLNSSKVVTGTHNKKLSLLEIISNISKFHSKYSLMPLCNLSFHLPKPSESQTSDNHDDSH----------------------KDSYSSDHKVNSEYTLHRSTLLHEIGMYLHYISIGILVVFMIELILRILCIGERFFKKKVEMFDGTIIVTSFMADIIFVQLKSDQISVMVVFLLWRIVRLINGLMMHEKQRDEFRITLQKKTRRMCQMKVDRLSTEKEL-----------------------LTKHVLTLEELCKELGANEDQLKNCKPRFKKYSKEQTNNALKSIAALTTGFMGGMVGAPSSNQSAINRYSGT-SPS--PSIQSPTSSKKLK 421          
The following BLAST results are available for this feature:
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HVCN18.783e-1135.85hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN19.217e-1135.85hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN11.234e-1035.85hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN11.234e-1035.85hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
HVCN11.234e-1035.85hydrogen voltage gated channel 1 [Source:HGNC Symb... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn11.727e-1232.14hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
tmem2665.138e-731.25transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hvcn11.978e-1433.33hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
hvcn16.480e-1435.42hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
mcf2l21.547e-631.30MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hvcn11.460e-1033.88hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Hvcn11.460e-1033.88hydrogen voltage-gated channel 1 [Source:MGI Symbo... [more]
Tmem2667.971e-729.20transmembrane protein 266 [Source:MGI Symbol;Acc:M... [more]
Tmem2663.254e-628.95transmembrane protein 266 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F4C0|HVCN1_CHICK5.790e-1737.17Voltage-gated hydrogen channel 1 OS=Gallus gallus ... [more]
sp|Q5M7E9|HVCN1_XENLA1.984e-1336.56Voltage-gated hydrogen channel 1 OS=Xenopus laevis... [more]
sp|Q5M8L8|HVCN1_XENTR3.433e-1335.42Voltage-gated hydrogen channel 1 OS=Xenopus tropic... [more]
sp|Q6DHQ1|HVCN1_DANRE1.419e-1132.14Voltage-gated hydrogen channel 1 OS=Danio rerio OX... [more]
sp|Q96D96|HVCN1_HUMAN5.928e-1035.85Voltage-gated hydrogen channel 1 OS=Homo sapiens O... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QF492.512e-7136.29Ion_trans domain-containing protein OS=Hymenolepis... [more]
A0A0R3T0R34.685e-7135.27Ion_trans domain-containing protein OS=Rodentolepi... [more]
A0A564Y6F85.070e-7136.16Ion_trans domain-containing protein OS=Hymenolepis... [more]
G7YBB96.446e-6937.72Voltage-gated hydrogen channel 1 OS=Clonorchis sin... [more]
W6VCQ53.774e-5547.93Voltage-gated hydrogen channel OS=Echinococcus gra... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hvcn11.958e-1330.89hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
tmem2663.514e-731.25transmembrane protein 266 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hvcn13.159e-1436.27hydrogen voltage-gated channel 1 [Source:NCBI gene... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO344011.697e-1441.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376711.433e-934.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hvcn11.486e-1332.46hydrogen voltage gated channel 1 [Source:NCBI gene... [more]
ENSORLT00000015469.29.102e-732.14transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000046304.11.044e-632.14transmembrane protein 266 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Voltage-gated hydrogen channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070756.10.000e+096.34SMESG000070756.1[more]
SMESG000070756.10.000e+095.93SMESG000070756.1[more]
SMESG000070756.10.000e+096.03SMESG000070756.1[more]
SMESG000077167.11.054e-11246.51SMESG000077167.1[more]
SMESG000002770.14.822e-9540.54SMESG000002770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034056 ID=SMED30034056|Name=Voltage-gated hydrogen channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2197bp
TAAATTGAAATTATTTTCTTTGCGAAATATTCAAAAGTATGATTGTCTGT
TGAATTTGTTTTTTTGCAATCCAATATCCTAATAATGGAATGAATTATAT
CGATTTTTGTGATTTGAAGTGATATTGATTTGAAATTTTATCGATCACTT
ATCTCAGACTTTATGGAAGGAATTATTAGAGATGCTGTCATGAATAATAA
CAAAGCCAACAAGGACCAAAATAAGGGAAATAAATATTCTAAAGCCAAGA
CTCATTTAACTATCGATGATACGTTTGCAGAAAGATCATATTCATTTCGA
GTTAATTGGATGAAGGATGAAAAGCTACTAAACCAATTGAAAAAAGATAA
TATAGACATTGAGTTATTTCAATGTGAATTTAAGCAGGAGACAAATCAGA
AAAATCACAAAACAATGAAAAGCAGATTGCTCTTATTCTTACAAAGCAAT
CCTATACAAATAATTATAGCGTTGTTGGTTTTGGTTGACGCTGGGATCGT
TATCGCCGAAATAATTCTGGAAATACATTCATTAAAAAACTCTATAGAAG
CCCATCAGGAACAAATAAGAGAAACGATTGTTTTCGTAAATAAAACATTT
CGATCTCAAATTGCTCATTTAAATCAAGGAGATTCACACGATGAAATCGG
CACAATGGAAACTATTCTCGACACTTTGAATGAATATTCTTTCAATTGTA
CGACTCCAAAATTAAAAAATATATATAATTCAAAGAAAGATTCTCACTTA
AAAATTAAACGAAGTGTCAAAAAGAAATCAAAACCTAAAGCTAATAATAA
TAATCATGGACAAAACTCTACAAGCACAAGCAGTCATAAAGTTTCGGAGA
AAAAGCACACATCTCAGACATTACATGTTGTCTCCGAAACCTTACATTAT
GCTAGTATAATAATATTAGGATTATTTGTTTTGGAAGTCGGTCTCAAAAT
TGCATGTGTTGGATGCAAGTTTTTCAAAGCCAAATTTGAAGTTGTCGATG
CTGTAGTAATTGTTACATCATTTGTAGCAGATATTATTATTGTAAATATC
GGTTCACAGGAAATATCTGTTATGATCATATTTTTATTATGGAGGATTGT
TCGTGTTATAAACGGTTTACTTATGCATGAAAAACAGAGAGATGAATTCC
GAATAGCCTTACAAAAGAAAGCAAGACGTGTTTCTGAAATGAAAGTCGAA
CAATTGACCATTCAAACAGAAATGCAAGAGGTGATTTTCTGTCAATTTTT
AGATATGTTAATAACTGAAATTATTGTACTAAATTGGATTATTTTAAAGA
AACACATAATGGCTTTAGAAGATTGCTCACGCGAGGCAGGAGTGCCCGAG
ATTATTATAAAAAGATGTCGTCCGAAATACATTCAATACACAAAAGATCA
GACCAACAATCCTTTGAAATCCATCGCTGCAATGACAACAGGATTCATGG
GAGGTCTTGTTGGAGCTCAACACAGCAACAAGGAAATAAACAGATTCGCC
GCAAGTTACAGTCCATCATGCACTCCAAGAAATCGAAGTCCTCAATTCCA
TAAAAAATTAAAAGACGATTCTCCTTCATGGACAGATTTAGCTAATTCTA
ATAACAATTATAATAAAGTATCTCATTTAAAAACTCCAATTTTACAACAT
CAGTCGGCTTTCAACTGGTGCTCCAGTGTAAATTCTGTTTTCGATAACTC
AAATGACAAAGAAGAAAATACTGAAGATCAAGACAACGATTCTGACAACG
ATAATTCAATAGATCTTTCAAAAACGATTGATTCGAAGAGACCTATGAAA
GAATGCCTTGAGAATGTACATTCCCCAATTAGAGACTTCACGAATTATTC
TATTTCAAGTCCATATATTGAAGACAGTTTAGTTGATAGTTCAGAGTGTG
CCTCTACCAATTTTTCATTTACCTCAGAACATGAAATTGATAATAAAAAC
ATTTTATTTCGATGTACTCACCACATTGGCAGCGATACTACGTTAGTTCC
ATCGAATGATGAGGATTTTGATTTCGTATCGAAATTCACAGATTATGTCT
AAAATGATCTCATTCTAGCTCAGCTTGCCAAGTTACTACTCGATCTAAAA
GTTTCTTCTTCCTGTGTAGTTTATACAATATTAGATAACTGATACAGTTT
GATCTTAATCTGATTCATATTTTTTATCAGCTGACATTATATATATT
back to top

protein sequence of SMED30034056-orf-1

>SMED30034056-orf-1 ID=SMED30034056-orf-1|Name=SMED30034056-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=630bp
MEGIIRDAVMNNNKANKDQNKGNKYSKAKTHLTIDDTFAERSYSFRVNWM
KDEKLLNQLKKDNIDIELFQCEFKQETNQKNHKTMKSRLLLFLQSNPIQI
IIALLVLVDAGIVIAEIILEIHSLKNSIEAHQEQIRETIVFVNKTFRSQI
AHLNQGDSHDEIGTMETILDTLNEYSFNCTTPKLKNIYNSKKDSHLKIKR
SVKKKSKPKANNNNHGQNSTSTSSHKVSEKKHTSQTLHVVSETLHYASII
ILGLFVLEVGLKIACVGCKFFKAKFEVVDAVVIVTSFVADIIIVNIGSQE
ISVMIIFLLWRIVRVINGLLMHEKQRDEFRIALQKKARRVSEMKVEQLTI
QTEMQEVIFCQFLDMLITEIIVLNWIILKKHIMALEDCSREAGVPEIIIK
RCRPKYIQYTKDQTNNPLKSIAAMTTGFMGGLVGAQHSNKEINRFAASYS
PSCTPRNRSPQFHKKLKDDSPSWTDLANSNNNYNKVSHLKTPILQHQSAF
NWCSSVNSVFDNSNDKEENTEDQDNDSDNDNSIDLSKTIDSKRPMKECLE
NVHSPIRDFTNYSISSPYIEDSLVDSSECASTNFSFTSEHEIDNKNILFR
CTHHIGSDTTLVPSNDEDFDFVSKFTDYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0030171voltage-gated proton channel activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR031846Hvcn1
IPR027359Volt_channel_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 114..134
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 513..537
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 194..229
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..210
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 226..328
e-value: 2.2E-14
score: 55.2
IPR031846Voltage-gated hydrogen channel 1PANTHERPTHR46480FAMILY NOT NAMEDcoord: 46..546