U5 small nuclear ribonucleoprotein 200 kDa helicase

Overview
NameU5 small nuclear ribonucleoprotein 200 kDa helicase
Smed IDSMED30034055
Length (bp)6505
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U5 small nuclear ribonucleoprotein 200 kDa helicase (SMED30034055) t-SNE clustered cells

Violin plots show distribution of expression levels for U5 small nuclear ribonucleoprotein 200 kDa helicase (SMED30034055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U5 small nuclear ribonucleoprotein 200 kDa helicase (SMED30034055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U5 small nuclear ribonucleoprotein 200 kDa helicase (SMED30034055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034055h1SMcG0021969 SmedASXL_019661SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30034055h1SMcG0021969 dd_Smed_v4_3022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034055h1SMcG0021969 dd_Smed_v4_3022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034055h1SMcG0021969 dd_Smed_v4_3022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034055h1SMcG0021969 dd_Smed_v4_3022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034055h1SMcG0021969 Contig39822newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034055h1SMcG0021969 Contig39822uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior sideSMED30034055h1SMcG0021969 dd_Smed_v4_7728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034055h1SMcG0021969 dd_Smed_v4_7728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034055h1SMcG0021969 dd_Smed_v4_3022_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Match: SNRNP200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:HGNC Symbol;Acc:HGNC:30859])

HSP 1 Score: 2326.59 bits (6028), Expect = 0.000e+0
Identity = 1173/2156 (54.41%), Postives = 1570/2156 (72.82%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER+K    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+I+DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  Y +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QNI LF+VD++HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I K SP  PVIVFVP+ KQT   A  ++    +D  ++ F   +E  +  Y+  +S+  L ETL  GVG++HE LS  ER L+ +LFSS +IQ++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH +HDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVE TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV++VFD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV    S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G++ YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEH-IKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP-ATGAHNYTLYFMSDAYMGCDQEYKFSVDV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Match: SNRNP200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:HGNC Symbol;Acc:HGNC:30859])

HSP 1 Score: 1466.44 bits (3795), Expect = 0.000e+0
Identity = 748/1400 (53.43%), Postives = 1011/1400 (72.21%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDAR 4218
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER+K    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+I+DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + R
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGR 1375          

HSP 2 Score: 279.641 bits (714), Expect = 2.306e-75
Identity = 191/696 (27.44%), Postives = 342/696 (49.14%), Query Frame = 1
Query: 3991 ELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFS---------NRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHT-ATYNFNPSVRHRPLDIEIQTF-NITHNAT--RLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK-----NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI---------KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE 5994
            +LL ++KLP       +Y     +     N IQ++ + +   +DEN+ + APTG+GKT  A + ++R            N  D + +Y+  +  L Q     + K     G TV +LTG+  +  + IS   IIV T E WD+++R+  ++   Q ++L I+D++HL+     G  LE + +R        +  +R+IGLS +L N  DV  +L        + F+ S R  PL+   QT+  IT      R   M++ VY+ I++ +  + V+VFV + K+T + A  +    L           G AS  ++        N  L + L  G    H  ++  +R L+ +LF+ + IQ+LV + TL W +   A+ VI+  TQVY+ +   + +  A+D++QM+GRA     D     +++    +  +    L++ LP+ES +  +L D  NAEIV   ++N +DAV++L + +LY RM R+P  Y   G+SH  L      L++   +DL ++  + +         K   +     LG IA+ YYI   T++ ++  LKP      L  +   ++EF+++ +R  E + L ++ + + +P+ E   + +P  K N+LLQA++S++ ++   L  D+  +   + RL++A  +++ +  W       + L +MI +  W     L+Q     E
Sbjct:  460 QLLPVEKLP-------KYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLL-HDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLE---QTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLY---GISHDDLKG--DPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKES--IEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPE 1137          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Match: ASCC3 (activating signal cointegrator 1 complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:18697])

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 764/1928 (39.63%), Postives = 1140/1928 (59.13%), Query Frame = 1
Query:  991 ELENKLL--RIVGVDRF--------------DLVRMLRENKLMIYYCT--------KLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKI---QADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLL--KEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPI-SEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE---------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKS----VSAGGQVSVQIHLA--RDEDNISSVYANN----------------------------FPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            EL  KLL  RI  VDRF              +  ++L EN    Y C         K    Q   E  +I    K   +   +   L   D KE  +  E+     ARS  I   Q D ++E  +    Y S     +K   F  G+ ++      LP+G  R+    Y  V +P  +P PL  +E  V I DL    + AF+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H    G I+K++FKIVY+APMK+L  EM + FS RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +Q+V+LLI+DE+HLLH++RGPVLE+IVART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+ + GLF FD  +RPVP+ Q +LGI     ++++  M+++ YE V+ +    HQV++FVH+R  TV TA ++ E+  N   +  F   +    ++ ++ + + +N  +++L P GF++HHAG+   DRN VE LF++ HI+VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G GI+IT  ++L++YL+LL ++ PIESQ +  LADNLNAEI +GTV N+ E++ W+ YTYLY+RMR NP  YG+ +     DPTL  H   L+      L+KA+MI F++R+G F S ++GR A++YY    T++   +       + ++F + SK  EF  I VREE+  E+  LL N   +    G E+   KIN LLQ YIS+ +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  I  +LE+K +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L+I  DF W  + HG+  + +WI+VED  +++I H EYFL   K+    +  +L F + I++PLP  YYIRAVSD+W+G E    I F +++LPE++ P TELLDLQ LP  AL  + YE++Y+   S FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK VI+LTG+   D KSI+KA +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E P+RI+GLS +L NARD+ +WL+      +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +   +  + +  L  TL+ G+G  H  L   +R  + ELF +  +Q+L+ + TL W +   A+LVI+  T+ Y+GK   Y D+   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YYNL  VSH  ++  LS L+E +L++LE S CI I +D+  +  +  G IA++YY+ + T++MF   LKP      LL ++ +A E+ DLP+RH ED + + + +   LPI S       P TKA++LLQA+LSR  +   +   D   +L +++R+ QA +DV ++  WL   L    L QM+ Q +W +DS L  +P+                              P+L+  C   G   VF  M +E E   A       K +    F    P I++   V  S    V    ++SV    A  RD++    ++A+                             FP  ++E W+L++GE ++  LI++K +         SL+F  P   G Y YTLYFMSD YLG DQ+Y   +NV
Sbjct:  278 ELIEKLLQNRITIVDRFLNSSNDHRFQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDLEVSEGLMCFDPKELRIQREQAL-LNARSVPILSRQRDADVEKIHYPHVYDS-QAEAMKTSAFIAGAKMI------LPEGIQRENNKLYEEVRIPYSEPMPLSFEEKPVYIQDLDEIGQLAFKGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQ-QGVIKKNEFKIVYVAPMKALAAEMTDYFSRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIVRLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNAEIALGTVTNVEEAVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRKLDKAQMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDIFAIVSKAEEFDQIKVREEEIEELDTLLSNFCELSTPGGVENSYGKINILLQTYISRGEMDSFSLISDSAYVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSILPPHILTRLEEKKLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVMMEASIQPITRTVLRVTLSIYADFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVISKEAQLLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYEALYN--FSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERMDDWKVRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNRNYVQQVTILIIDEIHLLGEE-RGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEREMENIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIAGGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSHDSVNKFLSHLIEKSLIELELSYCIEIGEDNRSIEPLTYGRIASYYYLKHQTVKMFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHMNSELAKC--LPIESNPHSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAANQGWLVTVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIESLPELIHAC--GGKDHVFSSM-VESELHAA-------KTKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQEYVLQVSLQRVHFGFHKGKPESCAVTPRFPKSKDEGWFLILGEVDKRELIALKRVGYIRNHHVASLSFYTPEIPGRYIYTLYFMSDCYLGLDQQYDIYLNV 2179          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Match: HFM1 (helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGNC:20193])

HSP 1 Score: 324.709 bits (831), Expect = 1.531e-89
Identity = 256/825 (31.03%), Postives = 430/825 (52.12%), Query Frame = 1
Query: 1336 FTQGSHLMTNKNC----ELPDGSFRKTKPGYNLVCVPAPKPKPLEAD-ENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTYTQLVKX-XXXXXXXXXXXXRGPVLEAIVARTMRAMQS-------SHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGL-FKFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFL----KKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAM--FEVTLSKKWASLTLS-VLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQPITR-STMKVELTIT 3708
            F   +++ T  N     E+ +G F+   P +++   P    +  E    +L  + ++P+  ++ F++    N IQSK +   L +D N ++CAPTG+GKT V  L + R +      +  +   + KIVY+AP+K+L ++  + + E+     L    L+GD+ +    EI    II+ TPEKWD ++RK  + +  QLV+L LI +   +  + RGP LE +V+R M+ +QS       + + I MR V +SAT+PN EDIAE++   +   +  K D S+RPV +++  LG    + +   K    +N  +   +  Y+ +   L+F  +RK     A       L +D   +   ++K     LQ+    V++  L+D+L  G A HHAG+  +DR  VE  FT   + VL +TSTLA GVNLPAH+V+IK T  Y    G + E S  D++QM GRAGRPQ+DT    +++T  +    Y+ +L  +  +ES L   L ++LNAEIV+ T+ +++ +++W+R T LYIR  KNPS YG  + L  D  ++   + L     + L   ++I  D+    F   E GR+ A+YY T ET   +KKF     K+++ D+    + + C EF +I +R  +K  +  L ++     +  P++   +    K+NCL+QA +  + ++ F L+ DTA I +  +R+ R +  F     KK+A L  S +L  C     ++W  S  + +Q +K+   ++  +    +  F ++ +    EL  ++N H   G  I + +  +PK  LK+  + ITR S    E+ +T
Sbjct:  213 FQYSANVFTANNAFSASEIGEGMFKA--PSFSVAFQPHDIQEVTENGLGSLKAVTEIPAKFRSIFKEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLL-----MEVPLPWLNIKIVYMAPIKALCSQRFDDWKEKFGPIGLNCKELTGDTVMDDLFEIQHAHIIMTTPEKWDSMTRKWRDNSLVQLVRLFLIDEVHIVKDENRGPTLEVVVSR-MKTVQSVSQTLKNTSTAIPMRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSNQTEFKFDLTLNYKIASVIQMYSDQKPTLVFCATRKGVQQAASV-----LVKDAKFIMTVEQKQR---LQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYA--GGLFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTRDKYIQMLACRDTVESSLHRHLIEHLNAEIVLHTITDVNIAVEWIRSTLLYIRALKNPSHYGFASGLNKD-GIEAKLQELCLKNLNDLSSLDLIKMDE-GVNFKPTEAGRLMAWYYITFET---VKKFYTISGKETLSDL--VTLIAGCKEFLDIQLRINEKKTLNTLNKDPNRITIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRITRWLSDFVAAQEKKFAVLLNSLILAKC--FRCKLWENSLHVSKQLEKIGITLSNAIVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELKV--EQITRYSDTTAEILVT 1008          

HSP 2 Score: 282.337 bits (721), Expect = 4.571e-76
Identity = 188/653 (28.79%), Postives = 324/653 (49.62%), Query Frame = 1
Query: 4039 EYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQ----DARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNK-SISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLET--------PIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIE--IQTFNITHNATRLA---AMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNL-KGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQ-----SLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAME 5922
            ++ SI+ K+  +FN IQ++ F+ L  +D N  I APTGSGKTV  E+AI RL         + + VY+  +  L   R+ +W + FG +G    +LTG+T MD+   I  AHII++T E WD ++R+W+    +Q ++LF++D++H++  ++ G TLEV+ SR + + S  +T        P+R + +S ++ NA D+ EWL               HRP+ ++  +  F  + N T       ++  +   I   S   P +VF  T K  ++ A +L+  A   K       +  + +Y  ++ +  L + L  G  + H  + +++R ++   F+   + +L  + TL   +   A+LV++  T  Y G   ++++YS  D++QM+GRA     D  A +VIM + + +D   + L     +ES L   L +H NAEIV  TI +   AV+++  T LY R  +NP++Y    G++   +   L EL    L DL +   I + + ++      G +  +YYI + T++ F  ++     +  L+ LI    EF D+ LR  E   L  + +     ++R P+  + R+     K N L+QA L  +PI+   L +D  +I     R+           RWL   +AA E
Sbjct:  270 KFRSIF-KEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLLMEVPLPWLNIKIVYMAPIKALCSQRFDDWKEKFGPIGLNCKELTGDTVMDDLFEIQHAHIIMTTPEKWDSMTRKWRDNSLVQLVRLFLIDEVHIVKDENRGPTLEVVVSRMKTVQSVSQTLKNTSTAIPMRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSNQTEFKFDLTLNYKIASVIQMYSDQKPTLVFCATRKGVQQAASVLVKDA---KFIMTVEQKQRLQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVVEGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGG--LFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTRDKYIQMLACRDTVESSLHRHLIEHLNAEIVLHTITDVNIAVEWIRSTLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIKMDEGVNFKPTEAGRLMAWYYITFETVKKF-YTISGKETLSDLVTLIAGCKEFLDIQLRINEKKTLNTLNKDPNRITIRFPM--EGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRI----------TRWLSDFVAAQE 903          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Match: ASCC3 (activating signal cointegrator 1 complex subunit 3 [Source:HGNC Symbol;Acc:HGNC:18697])

HSP 1 Score: 265.388 bits (677), Expect = 4.141e-74
Identity = 149/315 (47.30%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1321 LKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQV 2259
            +K   F  G+ ++      LP+G  R+    Y  V +P  +P PL  +E  V I DL    + AF+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H    G I+K++FKIVY+APMK+L  EM + FS RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +Q+V+LLI+DE+HLLH++RGPVLE+IVART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+ + GLF FD  +RPVP+ Q +LGI     ++++  M+++ YE V+ +    HQV
Sbjct:  413 MKTSAFIAGAKMI------LPEGIQRENNKLYEEVRIPYSEPMPLSFEEKPVYIQDLDEIGQLAFKGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQ-QGVIKKNEFKIVYVAPMKALAAEMTDYFSRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIVRLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLKQVKAGHQV 718          

HSP 2 Score: 110.153 bits (274), Expect = 2.080e-23
Identity = 73/248 (29.44%), Postives = 123/248 (49.60%), Query Frame = 1
Query: 4036 EEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSN--------RQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAI-QNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCH-HTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILK 4749
            +E   +  K M   N IQ+  FE+ YN++EN+ I APTG+GKT  A + ++             + + + VYV  +  LA      + +    LG  V +LTG+  +    I +  ++V+T E WDV++R+     A+ Q ++L I+D++HL+  +  G  LE I +RT       ++ IRI+GLS +L N  DV  +L  + +   + F+   R  PL          +   +L  M +  Y+ +LK
Sbjct:  464 DEIGQLAFKGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMKALAAEMTDYFSRRLEPLGIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIVRLLILDEVHLL-HEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLK 710          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Match: snrp-200 (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase [Source:UniProtKB/Swiss-Prot;Acc:Q9U2G0])

HSP 1 Score: 2080.45 bits (5389), Expect = 0.000e+0
Identity = 1070/2162 (49.49%), Postives = 1503/2162 (69.52%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKKM--GARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLI-DDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKK-MSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL----KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDK--KNFGRASEA--IVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPIS-EDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKS-VSAGGQVSVQIHLARDEDN---ISSVYANNFPYKR-EESWWLVVGEPNQGHLISIK-LLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD +AR  Q+EY+ NSNLVL+ D  L DRR ++EPTGEVLPI D + +KM  G R +K K       QD++ KR + +     Q   +VL  D  +    Y P+T ETK  YE +L+ + + L +     +     DE+L+ LKN    DKE+KK  + LLG  LTD +   L++LS K++D+   +           +   E D D  E E        D E DDGG+  +              +      +  L   G+L + +  A    L+  DIDA W+QR+L+K+F DP   Q++  +++ +LK A +D++ EN+L+ ++G D+F+ ++ LR+N+LMI YCT L      +ER +IE +M++ P+ + ILA L+  D +  +V  E++++   +S K  A    E  +         MLDL ++TF+QGSHLM+NK CELPDGS+R+ K  Y  + VPA KP+P    E LV +++LP + + AF+  K+LNRIQS++  +AL S E++LLCAPTGAGKTNVALLTM++EIG H+  DG+++ D+FKIVYIAPMKSLV EM  SFS+RL  + + V  ++GD+ +S+E+   TQ+IVCTPEK+D+++RK  E+ Y Q+V+LLIIDEIHLLHD+RGPVLE+IV RT+R M+ +H   + R+VGLSATLPN +D+A F+ V K   L  FD+SYRPVP+EQ+Y+G+ E+KA+KR + MN++VY+K+ME+AGK QVL+FVHSRKET  TAKAI++ CL +DTL  F+R+  AST +L+ + ++ KN DLKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVL ST+TLAWGVNLPAH VIIKGTQ+Y P+KG WTEL ALD+MQM GRAGRPQYD +G GI+ITN +EL YYLSL+N+QLP+ESQ++S+L D LNAE+V+GTV ++ E+ +WL YT+L++RM KNP+LYG+ +     DP L+    +LI+TA  +L+KA +I +DKRSG   + E+GRIA+++YCT E+M    K L ++  DI++F++FS  +EF+ ++VR+E+K+E++K+ E+ P+PIKE  ++   K N LLQAYISQLKLE F L +D  +++QSA RL RA+FE+ L + WA L   VL  CK V QR W    PL QFKK+P E+ + ++KKN  FDRL D   H+LG+L+   KMGK ++K+I Q PKL +   +QPITR+TM++ELTITPDF+W  K HGS++GFWIF+ED   E ILH+E+FLLK+KF +D+H++K  V ++DP+PPLYY+R VSD+WIG ET + I F +++LPEK  P TELLDLQ LP  A+ N+E+++++++     FN IQTQ F +++ S+ENV + AP GSGKT  AE+A++R F N  +A+ VY+T + D+A   Y +W +    A+G T++ LTG   MD K   +  +I+ST E WD +SRRWK++K++QN++LFI DDLH+IG+  NG   EV+CSRTRY+SSQLE+ +R++ LS SLTNARD+G WL C  +AT+NF PS R  PLD+EI++FN++HNA+R AAM +PVYQ I     KL P  P +VFVP  +QT  +A  L+  AL+D   K F R +E        + +I +E L E++SCGVGF+HE  +  + +++ +LF S +IQ+ VV   +C+ I   AYLV+VMDTQ YNGK  +Y+DY   D++ MVG AN   +D DA+ V+MCQT+K+ + +KFL +PLP+ESHLDH LHDHFNAEIVTKTIENKQDA+DYLTWT LY RMT+NPNYYNL+G +HRHLSD LSELVE TL DLENSKCIA+KD++D  ++NLGMIA++YYI Y TIE+FS+SLK  +K R L+E+I  ++EF ++P+RH EDVIL ++ +  RLP   ++++ +DP  K N+L+ A+LSRV +  AEL +D   I++++ RL+QACVDVLSSN WL PA+ AMEL+QM+TQA +  +  LKQ+PH +   LLER +A  V +VF+L+ELE++ +  ++     +L DVARF   YP+I++  E+    V++   + + + L RD D       V A  FP KR EE WWLV+G+     L++IK L+ +    V L+F APR  G +++ L+F+SDSYLG DQE+     V
Sbjct:    1 MADELARIQQYEYRQNSNLVLSVDYNLTDRRGREEPTGEVLPITDKEMRKMKMGDRAIKGKAPV----QDQKKKRKKKDDEKAQQFGRNVLV-DNNELMGAYKPRTQETKQTYEVILSFILDALGDVP-REVLCGAADEVLLTLKNDKFRDKEKKKEVEALLGP-LTDDRIAVLINLSKKISDFSIEE-----------ENKPEGDGDIYENEGVNVQFDSDEEEDDGGMVNEIKGDSEEESEEEEGVDT--DYTATLKGDGHLTEDEQKARG-ILHPRDIDAHWIQRSLAKYFKDPLIAQQKQTEVIGILKNAADDRDAENQLVLLLGFDQFEFIKCLRQNRLMILYCT-LLRQANEKERLQIEDDMRSRPELHPILALLQETD-EGSVVQVEKSKRDAEKSKK-AATAANEAISAGQWQAGRKMLDLNDLTFSQGSHLMSNKRCELPDGSYRRQKKSYEEIHVPALKPRPFAEGEKLVSVSELPKWAQPAFDGYKSLNRIQSRLCDSALRSKEHLLLCAPTGAGKTNVALLTMLQEIGNHLAEDGSVKLDEFKIVYIAPMKSLVQEMVGSFSKRLAPFGITVGEMTGDAQMSKEQFMATQVIVCTPEKYDVVTRKGGERAYNQMVRLLIIDEIHLLHDDRGPVLESIVVRTIRQMEQNHD--ECRLVGLSATLPNYQDVATFLRV-KPEHLHFFDNSYRPVPLEQQYIGVTEKKALKRFQAMNEVVYDKIMEHAGKSQVLVFVHSRKETAKTAKAIRDACLEKDTLSAFMREGSASTEILRTEAEQAKNLDLKDLLPYGFAIHHAGMNRVDRTLVEDLFADRHIQVLFSTATLAWGVNLPAHTVIIKGTQIYNPEKGRWTELGALDIMQMLGRAGRPQYDDRGEGILITNHSELQYYLSLMNQQLPVESQMVSRLTDMLNAEVVLGTVSSVSEATNWLGYTFLFVRMLKNPTLYGITHEQARADPLLEQRRADLIHTACVLLDKAGLIKYDKRSGIIQATELGRIASHFYCTYESMQTYNKLLVETCSDIDLFRIFSMSSEFKLLSVRDEEKLELQKMAEHAPIPIKENLDEASAKTNVLLQAYISQLKLEGFALQADMVFVAQSAGRLFRALFEIVLWRGWAGLAQKVLTLCKMVTQRQWGSLNPLHQFKKIPSEVVRSIDKKNYSFDRLYDLDQHQLGDLIKMPKMGKPLFKFIRQFPKLEMTTLIQPITRTTMRIELTITPDFKWDEKVHGSAEGFWIFIEDTDGEKILHHEFFLLKQKFCSDEHVVKMIVPMFDPMPPLYYVRIVSDRWIGAETVLPISFRHLILPEKYPPPTELLDLQPLPISAVTNKEFQTVFAESGFKVFNPIQTQVFRTVFESNENVIVCAPNGSGKTAIAELAVLRHFENTPEAKAVYITPMEDMATKVYADWKRRLEPAIGHTIVLLTGEQTMDLKLAQRGQLIISTPERWDNISRRWKQRKSVQNVKLFIADDLHMIGAS-NGAVFEVVCSRTRYISSQLESAVRVVALSSSLTNARDLGMWLGCSASATFNFMPSTRPVPLDLEIKSFNLSHNASRFAAMERPVYQAICRHAGKLEPK-PALVFVPVRRQTRPVAVALLTMALADGAPKRFLRLAEHDDTFQALLADIEDESLRESVSCGVGFLHEGTAPKDVHIVQQLFESNAIQVCVVPRGMCYQIEMSAYLVVVMDTQFYNGKYHVYEDYPIADMLHMVGLANRPILDSDAKCVVMCQTSKRAYYKKFLCDPLPVESHLDHCLHDHFNAEIVTKTIENKQDAIDYLTWTLLYRRMTQNPNYYNLQGTTHRHLSDALSELVELTLKDLENSKCIAVKDEMDTVSLNLGMIASYYYISYQTIELFSMSLKEKTKTRALIEIISASSEFGNVPMRHKEDVILRQLAE--RLPGQLKNQKFTDPHVKVNLLIHAHLSRVKL-TAELNKDTELIVLRACRLVQACVDVLSSNGWLSPAIHAMELSQMLTQAMYSNEPYLKQLPHCS-AALLERAKAKEVTSVFELLELENDDRSDILQMEGAELADVARFCNHYPSIEVATELENDVVTSNDNLMLAVSLERDNDIDGLAPPVVAPLFPQKRKEEGWWLVIGDSESNALLTIKRLVINEKSSVQLDFAAPR-PGHHKFKLFFISDSYLGADQEFDVAFKV 2128          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14754622:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 679/1955 (34.73%), Postives = 1077/1955 (55.09%), Query Frame = 1
Query:  925 PNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTK----------------------------LCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKE-DIVTAE--RNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNC---ELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVK-RIELMNDLVYEKVMEYAGK-HQVLIFVHSRKETVNTAKAIKEKCLNRDTLG---LFLRDKKASTLVLQQD--LDKVKNH-DLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKS---------MGDIEVFKVFSKCAEFRNITVRXXXXX-XXXXXXXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKV---PWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSS--QGFWIFVEDVMSENILHYEYFLLKEKFKN--DDHILKFYVSIYD-PLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQ---LETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDK--KNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDV-SAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE------------PKLLERCEAAGVKTVFDLMELEDEQKL-----------------ALMNFP---DDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLAR--DEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS---SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            P+  +  ++++L++L   ++D +L+ +L+ ++GV+ F+L   + E +  I +  K                               SQ  + R   + E +T  + NR++    + ++ E ++   E  R R+ +    K +  +      +   Y  V    L+N+      H M + N     LP+GS R T   +  V VP      +E  ++ V + D+    +  F+  + LN IQS V++ A ++ EN+L+CAPTGAGKTN+A+LT++  I +H N+ G I KDDFKI+YIAPMK+L  EM  SF +RL    LKV  L+GD+ LSR E+ +TQ++V TPEKWD+I+RKS S+ +   +V+LLIIDE+HLLHDERGPV+E +VART+R ++ S S I  RIVGLSATLPN  D+A F+ V+ ++GLF FD  +RPVP+ Q+++G  +    +  + LM+++ Y++V+++  + HQVL+FVH+R  T    +A    C     LG   LFL   +AS+  +Q D  ++  +N   +  L   G  +HHAGL   DR  +E  F + H+ VL  T+TLAWGVNLPAH V+IKGT V+  +KG +T+L  LDV Q+FGRAGRPQ++ +G GI+IT  +++  YL++L  Q PIESQ  ++L DNLNAE+ +GTV  + E ++WL YTY+Y R  KNP  YG+  N +  DP L +H  N+I  AA  L++ +MI FD  +    S ++GRIA+ +Y   ET+ +L +  K           M D  V  + S   EF N+  REE+     + +     + ++ G       K+N LLQ+ IS+       L S+  Y+ Q+A RL RAMFE+ L   W+    + L   K VE++MW   C LRQF ++   P    +K+E+K      L++    +LG + +    G  +Y Y+  +P+++++   +PIT + ++VE+T+TP F W  + HG S  Q F++ +E++    I+H E   + +   N  +   L F + I D  L   + +R  S+ ++  +  + +   N +LP+     T+LLDL+ LP K L+N ++E+IY+    +FN IQ Q F  LY +D++  IGAPTGSGKT+CAE+A+ RL  +    + VY+  L  L + R  +W K F   +G  V++++G+   D + ++ + I+++T E WD +SR W  ++ ++ + L ++D++HL+G    G  LE I SR + ++ +    E P+R++GLS +L NA DV EWL     A YNF PSVR  P+ + IQ F   H   R+  M+KP Y+ IL  SP  PV++FV + +QT   A   +   ++D   K +       + + M  I +E L  TL  G+G  H  LS +ER ++ +LF  + IQ+L+ + TL W I   A+LVIV  T+ ++GK   Y D+   D++QM+GRA     DD A +VI  Q  KK F +KFL+EP P+ES L   L +H NAEI   TI++KQ  V+YL+ T+LY R+  NPNYY L+  S   +   ++++V++++ +L  S+CI +  + DV      G IA+ YY+ + T+     SL     V  +L+++ +  E+ ++P+RH ED+I T +++ LR+  S    +     KA++L QA+  R  +   + + DL  +L + +R++QA  ++     WL   +  + L QM   A+WH D  L  +PH +             P+L    E     ++ D       QKL                 AL N+P      +Q V     C  +ID T +  K V+AG    ++I + R     N SS++   +P  ++  W +VVG  +   +++   ++   S      L+  AP   G++E  +  +SD YLG DQEY   ++V
Sbjct:   82 PDTFETISQNLLQMLCSTRSDMDLQGELIDLLGVELFELAGDILEKRNKIVFEVKSQELAKVEHARQAKAKPAVPGFLQTVSVQSTSQNEKRRELRKEEKRTRRELNRVIHAFGDEEKLELELAQKEIQRQRQLEIDQMKWKPSLVAGGPRIEEIYPYVFDARLQNV-----GHTMFDINGMKFALPEGSKRDTFKTHESVYVPPSNKGDIEKIQH-VYVKDMDELGQKGFKGFEKLNVIQSIVFEQAYKTKENLLICAPTGAGKTNIAMLTILNTIHEHQNSRGDIMKDDFKIIYIAPMKALATEMTESFGKRLAPLGLKVKELTGDTQLSRNEVADTQMLVLTPEKWDVITRKSTSDNSLINVVRLLIIDEVHLLHDERGPVIETLVARTLRQVEMSQSGI--RIVGLSATLPNFIDVARFLRVNPYKGLFFFDGRFRPVPLTQKFIGTRKAGNFRDNLTLMDNVCYDEVVDFVKRGHQVLVFVHTRNGTAKLGEAF---CARASVLGQMDLFLPKDRASSKYIQADKAINICRNRAQISPLFQRGMGIHHAGLCRQDRILMERCFAEGHVSVLFCTATLAWGVNLPAHAVVIKGTDVFDAEKGVFTDLGVLDVQQIFGRAGRPQFENEGHGIIITTRDKIDKYLTMLVHQNPIESQFYARLHDNLNAEVALGTVSTVDEGVEWLTYTYMYTRALKNPMAYGIAYNAIERDPNLRDHFGNVIREAAMQLDQNKMIRFDMATEYLNSTDLGRIASNFYVKYETIQLLNEAEKGVGLPVTFTSFMPDDMVIGLISMSTEFANLKCREEEIGDLEELMSYGCMMNVRGGGLASVAGKVNVLLQSLISRTSTRNSALMSEQLYVQQNAGRLCRAMFEMVLKNGWSQAANAFLGIAKCVEKQMWMNQCALRQFIQIINIPITWIEKIERKKARESDLLELSAKDLGYMFSCD--GDRLYTYLRYLPRMDVQAKFKPITYTIVQVEVTLTPTFIWNDQIHGKSGQQSFYLVLENLNENLIIHQERIGIGKMKVNRQETQNLVFTIPIVDCQLTNNFQLRLASEYFVTDDVVVPMSLHNCILPKSFKSHTDLLDLEPLPIKTLKNSKFEAIYN--FDYFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVTPDPEELAASSILITTPEKWDGISRSWATREYVRRVGLIVLDEVHLLGVDR-GAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLGIPDEACYNFRPSVRPVPISVHIQGFPGQHYCPRMGLMNKPAYKAILTYSPRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSV-MGTSACKAHLLFQAHFMRT-VLPTDYRTDLKSVLDQCIRILQAMREMARLKNWLSATMNIILLQQMCHSARWHDDHPLLCLPHLSHEDARSIGDGMTIPQLQNHLEIEKSTSLDDAKLARRAQKLFRECTKLDEAQSREVLKALCNWPIINMKIMQLVDSRGNCV-DIDETKKPVK-VTAGEVYKLRIVMERVGPGKNNSSMHLPQWPKPKQAGWIIVVGNVSADMILNTTTVTGSHSTRSTAKLDIRAPATKGNHELAVLILSDCYLGIDQEYTLRLDV 2016          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14768462:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 431/1307 (32.98%), Postives = 695/1307 (53.18%), Query Frame = 1
Query: 2740 LLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKS---------MGDIEVFKVFSKCAEFRNITVRXXXXX-XXXXXXXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKV---PWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSS--QGFWIFVEDVMSENILHYEYFLLKEKFKN--DDHILKFYVSIYD-PLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQ---LETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDK--KNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDV-SAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE------------PKLLERCEAAGVKTVFDLMELEDEQKL-----------------ALMNFP---DDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLAR--DEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS---SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            +L  Q PIESQ  ++L DNLNAE+ +GTV  + E ++WL YTY+Y R  KNP  YG+  N +  DP L +H  N+I  AA  L++ +MI FD  +    S ++GRIA+ +Y   ET+ +L +  K           M D  V  + S   EF N+  REE+     + +     + ++ G       K+N LLQ+ IS+       L S+  Y+ Q+A RL RAMFE+ L   W+    + L   K VE++MW   C LRQF ++   P    +K+E+K      L++    +LG + +    G  +Y Y+  +P+++++   +PIT + ++VE+T+TP F W  + HG S  Q F++ +E++    I+H E   + +   N  +   L F + I D  L   + +R  S+ ++  +  + +   N +LP+     T+LLDL+ LP K L+N ++E+IY+    +FN IQ Q F  LY +D++  IGAPTGSGKT+CAE+A+ RL  +    + VY+  L  L + R  +W K F   +G  V++++G+   D + ++ + I+++T E WD +SR W  ++ ++ + L ++D++HL+G    G  LE I SR + ++ +    E P+R++GLS +L NA DV EWL     A YNF PSVR  P+ + IQ F   H   R+  M+KP Y+ IL  SP  PV++FV + +QT   A   +   ++D   K +       + + M  I +E L  TL  G+G  H  LS +ER ++ +LF  + IQ+L+ + TL W I   A+LVIV  T+ ++GK   Y D+   D++QM+GRA     DD A +VI  Q  KK F +KFL+EP P+ES L   L +H NAEI   TI++KQ  V+YL+ T+LY R+  NPNYY L+  S   +   ++++V++++ +L  S+CI +  + DV      G IA+ YY+ + T+     SL     V  +L+++ +  E+ ++P+RH ED+I T +++ LR+  S    +     KA++L QA+  R  +   + + DL  +L + +R++QA  ++     WL   +  + L QM   A+WH D  L  +PH +             P+L    E     ++ D       QKL                 AL N+P      +Q V     C  +ID T +  K V+AG    ++I + R     N SS++   +P  ++  W +VVG  +   +++   ++   S      L+  AP   G++E  +  +SD YLG DQEY   ++V
Sbjct:    1 MLVHQNPIESQFYARLHDNLNAEVALGTVSTVDEGVEWLTYTYMYTRALKNPMAYGIAYNAIERDPNLRDHFGNVIREAAMQLDQNKMIRFDMATEYLNSTDLGRIASNFYVKYETIQLLNEAEKGVGLPVTFTSFMPDDMVIGLISMSTEFANLKCREEEIGDLEELMSYGCMMNVRGGGLASVAGKVNVLLQSLISRTSTRNSALMSEQLYVQQNAGRLCRAMFEMVLKNGWSQAANAFLGIAKCVEKQMWMNQCALRQFIQIINIPITWIEKIERKKARESDLLELSAKDLGYMFSCD--GDRLYTYLRYLPRMDVQAKFKPITYTIVQVEVTLTPTFIWNDQIHGKSGQQSFYLVLENLNENLIIHQERIGIGKMKVNRQETQNLVFTIPIVDCQLTNNFQLRLASEYFVTDDVVVPMSLHNCILPKSFKSHTDLLDLEPLPIKTLKNSKFEAIYN--FDYFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVTPDPEELAASSILITTPEKWDGISRSWATREYVRRVGLIVLDEVHLLGVDR-GAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLGIPDEACYNFRPSVRPVPISVHIQGFPGQHYCPRMGLMNKPAYKAILTYSPRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSV-MGTSACKAHLLFQAHFMRT-VLPTDYRTDLKSVLDQCIRILQAMREMARLKNWLSATMNIILLQQMCHSARWHDDHPLLCLPHLSHEDARSIGDGMTIPQLQNHLEIEKSTSLDDAKLARRAQKLFRECTKLDEAQSREVLKALCNWPIINMKIMQLVDSRGNCV-DIDETKKPVK-VTAGEVYKLRIVMERVGPGKNNSSMHLPQWPKPKQAGWIIVVGNVSADMILNTTTVTGSHSTRSTAKLDIRAPATKGNHELAVLILSDCYLGIDQEYTLRLDV 1298          

HSP 2 Score: 335.109 bits (858), Expect = 7.973e-94
Identity = 223/687 (32.46%), Postives = 361/687 (52.55%), Query Frame = 1
Query: 1444 PKPLEADENLVKIADLP--SYVKAAFEKIKTL---NRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLK-SYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNID-MRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPL 3480
            PK  ++  +L+ +  LP  +   + FE I      N IQ++V+    ++D++ L+ APTG+GKT  A L M R +  H            K+VYIAP+KSLV E  + + ++ +     +V  +SGD     EE+  + I++ TPEKWD ISR  + + Y + V L+++DE+HLL  +RG VLEAIV+R     + SH   + +R++GLS  L N  D+AE++ +      + F  S RPVP+     G   +    R+ LMN   Y+ ++ Y+ +  VLIFV SR++T  TA A     +       +L       L L+  +  +K+ +LK  LP+G  +HHAGL+  +R  VE+LF +K IQVL++T+TLAWG+N PAH+VI+KGT+ +   KG++ +    DV+QM GRAGRPQ+D   V ++   + + T+Y   L E  P+ES L+  L +++NAEI  GT+ +    +++L  TYLY R+  NP+ YG+E     +  +      ++  + + L  +E I+ D           GRIA+ YY  +ET+  L K L        + K+ +   E+  I VR  + +   +L + + +            K + L QA+  +  L      +D   +     R+++AM E+   K W S T++++   +      W    PL
Sbjct:  428 PKSFKSHTDLLDLEPLPIKTLKNSKFEAIYNFDYFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDH---------PGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVTPDPEELAASSILITTPEKWDGISRSWATREYVRRVGLIVLDEVHLLGVDRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLGIPDE-ACYNFRPSVRPVPISVHIQGFPGQHYCPRMGLMNKPAYKAILTYSPRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWL---NMDMLELEDLMAAIKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEE--DSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSVMGTSACKAHLLFQAHFMRTVLPT-DYRTDLKSVLDQCIRILQAMREMARLKNWLSATMNIILLQQMCHSARWHDDHPL 1098          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14773761:14778137:1 gene:WBGene00013189.1 transcript:Y54E2A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 202.601 bits (514), Expect = 1.589e-55
Identity = 145/479 (30.27%), Postives = 238/479 (49.69%), Query Frame = 1
Query: 5146 MVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDV-SAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE------------PKLLERCEAAGVKTVFDLMELEDEQKL-----------------ALMNFP---DDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLAR--DEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS---SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            M+GRA     DD A +VI  Q  KK F +KFL+EP P+ES L   L +H NAEI   TI++KQ  V+YL+ T+LY R+  NPNYY L+  S   +   ++++V++++ +L  S+CI +  + DV      G IA+ YY+ + T+     SL     V  +L+++ +  E+ ++P+RH ED+I T +++ LR+  S    +     KA++L QA+  R  +   + + DL  +L + +R++QA  ++     WL   +  + L QM   A+WH D  L  +PH +             P+L    E     ++ D       QKL                 AL N+P      +Q V     C  +ID T +  K V+AG    ++I + R     N SS++   +P  ++  W +VVG  +   +++   ++   S      L+  AP   G++E  +  +SD YLG DQEY   ++V
Sbjct:    1 MMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSV-MGTSACKAHLLFQAHFMRT-VLPTDYRTDLKSVLDQCIRILQAMREMARLKNWLSATMNIILLQQMCHSARWHDDHPLLCLPHLSHEDARSIGDGMTIPQLQNHLEIEKSTSLDDAKLARRAQKLFRECTKLDEAQSREVLKALCNWPIINMKIMQLVDSRGNCV-DIDETKKPVK-VTAGEVYKLRIVMERVGPGKNNSSMHLPQWPKPKQAGWIIVVGNVSADMILNTTTVTGSHSTRSTAKLDIRAPATKGNHELAVLILSDCYLGIDQEYTLRLDV 475          

HSP 2 Score: 103.99 bits (258), Expect = 1.747e-22
Identity = 71/261 (27.20%), Postives = 124/261 (47.51%), Query Frame = 1
Query: 2650 MFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVL 3429
            M GRAGRPQ+D   V ++   + + T+Y   L E  P+ES L+  L +++NAEI  GT+ +    +++L  TYLY R+  NP+ YG+E     +  +      ++  + + L  +E I+ D           GRIA+ YY  +ET+  L K L        + K+ +   E+  I VR  + +   +L + + +            K + L QA+  +  L      +D   +     R+++AM E+   K W S T++++
Sbjct:    1 MMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPFPVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEE--DSEEAMLKFITKIVDDSVAELLASECIHVDSEQDVIKPTPCGRIASVYYLQHETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSVMGTSACKAHLLFQAHFMRTVLPT-DYRTDLKSVLDQCIRILQAMREMARLKNWLSATMNII 258          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Match: polq-1 (DNA polymerase theta [Source:UniProtKB/Swiss-Prot;Acc:A0FLQ6])

HSP 1 Score: 116.316 bits (290), Expect = 2.034e-25
Identity = 119/454 (26.21%), Postives = 216/454 (47.58%), Query Frame = 1
Query: 1510 AFEKIKTLNRIQSKVYKTALE-SDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKW-DIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQE-YLGINERKA----VKRIELMNDLVYEKVMEYAGKHQVLIFVHSR----KETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDK--VKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLAD----NLNAEIVMG 2820
            A + IK L   Q  V   A +  D++++  APT AGK+ VA L     +   + + G       K++++ P  S+  E  +      +  ++ V    G         NE    VCT EK   + +R  SE  + ++  +++ +   +    RG  +E ++++ +   QS+   +  RI+G+SAT+P    I +++      G   F++ +RP+ ++    +G   RK+    V R    + L+      +    Q L+ + S+    K  +N A    E      +L   L+++    L ++  L++   K+ ++   L +G A HHAGL   +R  +E  F +K+I +LV+TSTLA GVNLPA  V+IK  Q   P     + L++L+  QM GRAGR  + T+G   ++  + +    L ++  + PI+  ++++  D    NL+  I+ G
Sbjct:   21 AEQNIKALFDWQIDVLNEARQFEDQHLIFSAPTSAGKSIVAEL-----LSWKVASTGR------KVLFVLPYISVAREKLHQIQRCWRRDDISVCGFIGPQA---SNPNEWLGAVCTIEKAASLTNRALSEDWFEEIGMIVVDEMHMVFDSSRGAHIEHMLSKVLLWNQSALEKV--RIIGMSATIPELYRIGKWLD-----GAKVFEARFRPIVLQNHIVIGSELRKSGDNKVLREFSEDPLILLTEESFRRNSQTLVMISSKLDAEKTALNIASRFHEINKTDSSLLEILKERANGLLFIKHGLERNGCKDRNVMSTLAWGVAYHHAGLTMEERECIELGFREKNIVILVATSTLASGVNLPAERVLIKA-QPRGP-----SALTSLNYRQMVGRAGRTGHATRGETYLLIKKCDRDAVLKII--ETPIDQGVLTRKRDAERTNLSRFILEG 445          

HSP 2 Score: 63.929 bits (154), Expect = 1.844e-9
Identity = 79/397 (19.90%), Postives = 165/397 (41.56%), Query Frame = 1
Query: 4120 DENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKP-VYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEIL----------------IETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRA---NHASMDDARSVIMCQTNKKDFIQKFLHEPL 5250
            D+++   APT +GK++ AE+   ++ S  +  + ++V     +A+ +  +  + +     +V    G    +      A   V T E    L+ R   +   + I + +VD++H++     G  +E + S+    +      +RIIG+S ++     +G+WLD        F P V    + I  +      N         P +  T      NS  +V + +    E+ A       ++ + +    +++ + E ++  +N +L                + TL+ GV + H  L++ ER  +   F  ++I ILV + TL   +   A  V++       G   +    ++++  QMVGRA    HA+  +  + ++ +   +D + K +  P+
Sbjct:   44 DQHLIFSAPTSAGKSIVAELLSWKVASTGR--KVLFVLPYISVAREKLHQIQRCWRRDDISVCGFIGPQASNPNEWLGA---VCTIEKAASLTNRALSEDWFEEIGMIVVDEMHMVFDSSRGAHIEHMLSKVLLWNQSALEKVRIIGMSATIPELYRIGKWLDGAKVFEARFRPIVLQNHIVIGSELRKSGDNKVLREFSEDPLILLTEESFRRNSQTLVMISSKLDAEKTAL-----NIASRFHEINKTDSSLLEILKERANGLLFIKHGLERNGCKDRNVMSTLAWGVAYHHAGLTMEERECIELGFREKNIVILVATSTLASGVNLPAERVLIKAQP--RGPSAL----TSLNYRQMVGRAGRTGHATRGE--TYLLIKKCDRDAVLKIIETPI 422          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Match: l(3)72Ab (gene:FBgn0263599 transcript:FBtr0075527)

HSP 1 Score: 2276.13 bits (5897), Expect = 0.000e+0
Identity = 1152/2165 (53.21%), Postives = 1556/2165 (71.87%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDY---------KAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSV--DMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVIL----TRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR +Q+EYK NSNLVL AD  LI+R  +DE TGEV   +  +D  +MG R  + KP+  EE++ KR KRD++    +  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L D+ERKK    LLG  +TD ++  LV+L  K+TD+          AP     E  D+T  ++++ ++ +EE ++D+YGE++D ++ D G EA  + TL+    A    +                   N+     L+  DIDA+WLQR LSK + D    Q +  D+L++LK A +D++ EN+L+ ++G D FD ++ L+ N+ M+ YCT L  +QT  ER +I  +M+ +    +IL       R+ D   +E   + +AR +K       +     +   +    +L+L+ + FTQGSH M NK C+LPDGS+RK + GY  V VPA KP P +A+E L  +  LP YV+  FE  KTLNRIQS++YK AL+SDEN+LLCAPTGAGKTNVALLTMMREIGKHIN DGTI   DFKI+Y+APMKSLV EM  +F  RL  YNL V+ L+GD  L+RE+I  TQ+IVCTPEKWDII+RK  E+T+  LV+L+IIDEIHLLHDERGPVLEA+VART+R ++++   +  R+VGLSATLPN +D+A F+ V   +GLF FD+SYRPV +EQ+Y+G+ E+KA+KR ++MN++VYEK ME+AG++QVL+FVHSRKET  TA+A+++ CL +DTLG FL++  AS  VL+ + ++VKN +LK+LLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG W ELSALDV+QM GRAGRPQYDTKG GI+ITN +EL +YLSLLN+QLPIESQ ISKL D LNAEIV+GTV+++ ++++WL YTYLYIRM +NP+LYGV +  I  DP L+ H  +L++TAA  LE++ +I +D+++G F   ++GRIA++YY T+ETM    + LK+++ +IE+F+VFS  +EFR+I+VREE+K+E++KL+E VP+PIKE  E+   K+N LLQAYISQLKLE F L SD  +I+QSAARLMRA+FE+ L++ WA L    L  CK +++RMW    PLRQFKK+P EI KKLEKK+ P+ RL D + HELGEL+   K+GKTI+K++HQ PKL L  H+QPITR T++VELTITPDF+W  K HG S+GFW+ +EDV SE ILH+E+FLLK+K+  D+H LKF+V +++PLPP Y++R VSD+WIG ET++ + F +++LPEKN P TELLDLQ LP  ALR  ++ES YS++   FN IQTQ F ++YNSDENVF+GAPTGSGK   AE AIMRLF+ + DARCVY+ +   LA L + +W   FG+L   V+KLTG T  D K I+K  ++++TA+ WDVLSRRWK++K +Q + LFIVD+L L+G +  G  LE++CSR RY+SSQ+E  IRI+ LS SLT+ARDV +WL C+  AT+NF+PSVR  PL++ IQ +N+THNATR+A MSKPVY  ILK S + PVIVFV + KQ    A  ++ YA SD +   F  A E  +  ++  ++++ L ETL+ GV ++HE LS ++  L+ +LF S ++Q+ V+S  LCW +   A+LVI+MDTQ YNGK+  Y+DY   D++QM+GRAN  + D DA+ V+MCQ++KKDF +KF++EPLP+ESHLDH++HDHFNAE+VTKTIENKQDAVDYLTWTFLY R+T+NPNYYNL+GV+HRHLSDHLSELVENTL DLE SKCI+++DD+D   +NLGMIA +YYI+YTTIE+FSLSL   +KVR LLE+I +A E+ED+ +RH E+ +L     R+   L  P     + +DP  K N+LLQA+LSR+ +   EL+ D  QIL K++RLIQACVDVLSSN WL PA+AAMELAQM+TQA W +DS LKQ+PHF+ P++++RC    ++TVFD+MELEDE +  L+   D ++ DVARF   YPNI+L YEV     +++G  V+V + L R+++    V A  FP KREE WW+V+G+P    L+SIK L+     KV L+F AP   G ++YTLY+MSDSYLGCDQEY+F+I V
Sbjct:    1 MADAAARQLQYEYKANSNLVLQADVRLIERPRRDEATGEVCSLVGKLDGTRMGDRYQRTKPEKTEERKVKRQKRDEAQYDFERMKGATLLSEGIDEMVGIVYRPKTQETRQTYEVLLSFIQEALGDQP-RDILCGAADEILAVLKNDRLKDRERKKDIDSLLGA-VTDERFALLVNLGKKITDFGSDAVNALTAAPN--NEEQIDETYGINVQFEESEEESDNDMYGEIRDDDAQDEGEEARIDHTLHAENLANEEAA------------------NNVKKERSLHPLDIDAYWLQRCLSKFYKDAMVSQSKAADVLKILKDAADDRDCENQLVLLLGYDCFDFIKQLKLNRQMVLYCTMLASAQTDSERQRIREKMRGNSALAKIL-------RQLDTGKSEDQEEGEARGSKRGKGDAEDGGAAAAGQVAGVRQLLELEEMAFTQGSHFMANKRCQLPDGSYRKQRKGYEEVHVPALKPVPFDANEELQPVDKLPKYVQPVFEGFKTLNRIQSRLYKAALDSDENMLLCAPTGAGKTNVALLTMMREIGKHINEDGTINAQDFKIIYVAPMKSLVQEMVGNFGRRLACYNLTVSELTGDHQLTREQIAATQVIVCTPEKWDIITRKGGERTFVSLVRLVIIDEIHLLHDERGPVLEALVARTIRNIETTQEEV--RLVGLSATLPNYQDVATFLRVKPDKGLFYFDNSYRPVSLEQQYIGVTEKKALKRFQVMNEIVYEKTMEHAGRNQVLVFVHSRKETGKTARAVRDMCLEQDTLGSFLKEGSASMEVLRTEAEQVKNTELKELLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELSALDVLQMLGRAGRPQYDTKGEGILITNHSELQFYLSLLNQQLPIESQFISKLPDMLNAEIVLGTVQHLQDAVNWLGYTYLYIRMLRNPTLYGVSHDAIKADPLLEQHRADLLHTAACCLERSGLIKYDRKTGHFQVTDLGRIASHYYLTHETMLTYNQLLKQTLSEIELFRVFSLSSEFRHISVREEEKLELQKLMERVPIPIKESIEEHSAKVNVLLQAYISQLKLEGFALMSDMVFITQSAARLMRAIFEIVLTRGWAQLADKTLTLCKMIDRRMWQSMTPLRQFKKMPDEIAKKLEKKHFPWGRLYDLEPHELGELIRVPKLGKTIHKFVHQFPKLELSTHIQPITRGTLRVELTITPDFQWDEKVHGQSEGFWVLIEDVDSELILHHEFFLLKQKYSQDEHQLKFFVPVFEPLPPQYFLRIVSDRWIGAETQLPVSFRHLILPEKNMPPTELLDLQPLPISALRQPKFESFYSQRFPQFNPIQTQVFNAVYNSDENVFVGAPTGSGKMTIAEFAIMRLFTTQSDARCVYLVSEEALADLVFADWHSKFGSLDIKVVKLTGETGTDLKLIAKGQLVITTADKWDVLSRRWKQRKNVQLVNLFIVDELQLVGGE-EGPVLEIVCSRMRYISSQIEKQIRIVALSASLTDARDVAQWLGCNPNATFNFHPSVRPIPLELHIQGYNVTHNATRIATMSKPVYNAILKYSAHKPVIVFVSSRKQARLTAIDVLTYAASDLQPNRFFHAEEEDIKPFLERMTDKTLKETLAQGVAYLHEGLSASDHRLVEQLFDSGAVQVAVISRDLCWGMSISAHLVIIMDTQFYNGKNHSYEDYPITDVLQMIGRANRPNEDADAKCVLMCQSSKKDFFKKFINEPLPIESHLDHRMHDHFNAEVVTKTIENKQDAVDYLTWTFLYRRLTQNPNYYNLQGVTHRHLSDHLSELVENTLSDLEQSKCISVEDDMDTLPLNLGMIAAYYYINYTTIELFSLSLNSKTKVRGLLEIISSAAEYEDVVVRHHEEQVLRTLSQRLPNKLTGPNETAPKFNDPHIKTNLLLQAHLSRLQL-GPELQGDTEQILSKAIRLIQACVDVLSSNGWLSPAVAAMELAQMVTQAMWSKDSYLKQLPHFS-PEIVKRCTEKKIETVFDIMELEDEDRTRLLQLSDLQMADVARFCNRYPNIELNYEVVDKDRINSGSTVNVVVQLEREDEVTGPVIAPFFPQKREEGWWVVIGDPKTNSLLSIKRLTLQQKAKVKLDFVAP-SPGKHDYTLYYMSDSYLGCDQEYKFSIEV 2130          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Match: obe (gene:FBgn0038344 transcript:FBtr0083147)

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 679/1772 (38.32%), Postives = 1034/1772 (58.35%), Query Frame = 1
Query: 1342 QGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSS-EKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGK-HQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKE--GAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSS-QGFWIFVEDVMSENILHYEYFLLKEKF--KNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF--GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYAL--SDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRL-PISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE-------------------PKLLERCE------AAGVKTVFDLMELE-------DEQKLALMNFPDDK------------LQDVAR--FFQCYPNIDLTYEVS-KSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEKVS--LNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            Q +  +      LPD + R     +  V +PA +P PL      V+I +L    + AF   K LNRIQS V+  A  S+EN+L+CAPTGAGKTNVA+L+++  I  H+   G I +D+FKIVYIAPMK+L  EM ++FS+RLKS  + V  L+GD  L++ E+  TQI+V TPEKWD+++RK S +     LV+LLIIDE+HLLH ERGPV+EA+VART+R ++SS S I  RIVGLSATLPN  D+A F+ V+  +GLF FDS +RPVP++  ++GI   K +++I  M+   Y+K +E   + HQ+++FVH+R  TV TA  I+E     +T  LFL    A+  +  + + + +N  L +L   G A+HHAG+   DR  VE+ F + HI VLV T+TLAWGVNLPAH VII+GT +Y    G + +L  LDV+Q+FGRAGRPQ+D  GVG +IT+ ++L +YLSLL  Q PIES  ++ LADNLNAEI +GT+ N+ E+I+WL YTYL++RMR NP +YG+E + L  DPTL+   R LI +AA  L+KA M+ F++R+ +    ++GR A+Y+Y   +T++   + +K  M   E+  + S+  EF+ + VR +D++E    L+N    IK   G+E+   K+N L+Q Y+S   ++ F+LSSD +YI+ +  R+ RA+F + L +  A L+ ++L+ CK  E+R W   C L+QF  +  E   KLE++ +   RL D +H EL E + ++     + +  H++P L ++  LQPITR+ +++++ I P F W  + HG + Q FW+++ED  S  I H E F +  K         L   + + +PLPP YYIR  SD W+G  T I + F +++LPE + PLTELL L+ LP   L+N  YES+Y  K + FN IQTQ F  LY++D NV +GAPTGSGKT+ AEIAI R  +     + VY+  L  L + R  +W + F   +LG  V++LTG+   D ++I ++ +IV+T E WD +SR W+ ++ +Q++ L ++D++HL+G +  G  +EVI SRT ++SS     IRI+GLS +L NA+D+  WL  +    YNF PSVR  PL + I  F   H   R+A M++P +Q I   SP  P IVFV + +QT   A  L+ +    S+ K F    E  +   ++NI  + L   L+ G+G  H  L   +R  + ELF ++ IQILV + TL W +   A+LV++  T+ ++GK   Y D    D++QM+GRA     D +  +V++    KK+F +KFL++P P+ES L   L +H NAEIV  T+++KQ A+DYLTWT+ + R+ RNP+YY L+ +   ++++ +S LVE  + +L  + C+  +D   +    LG I+++YY+ Y T++ F   L+P    + +L  I ++ EF+ LP+RH ED     + +  R  P S         TK  +LLQA+ +R  +  ++   D    L  + R++QA VD  +   WL   L   +L Q + QA+W   S    +P  NE                   P L E C+      A  ++  F+  E+E       D  ++A+  F + +            L D  R  +   + N D    V+ + ++  GQ        R      +V+   +P  + E+W+L +G      L+++K +S   ++ +  ++F A  + G  + TLY MSD  +G DQ+Y     ++
Sbjct:  424 QHAGFIGGSRITLPDNAQRIDNKQWEEVKIPASEPPPLSVGNKRVQIEELDDVGRLAFANCKELNRIQSVVFPVAYHSNENMLVCAPTGAGKTNVAMLSIVHTIRCHLE-QGVINRDEFKIVYIAPMKALAAEMVDNFSKRLKSLQIAVRELTGDIQLTKAEMAATQILVTTPEKWDVVTRKGSGDVALISLVELLIIDEVHLLHGERGPVVEALVARTLRLVESSQSMI--RIVGLSATLPNYIDVAHFLRVNPMKGLFYFDSRFRPVPLDTNFVGIKSVKQLQQIADMDQCCYQKCVEMVQEGHQIMVFVHARNATVRTANVIRELAQQNNTSALFLPKDSAAHGLATRSIQRSRNKQLVELFSCGLAMHHAGMLRADRQMVEKYFVEGHISVLVCTATLAWGVNLPAHAVIIRGTDIYDAKHGSFVDLGILDVLQIFGRAGRPQFDKSGVGTIITSYDKLNHYLSLLTNQFPIESNFVNCLADNLNAEIGLGTITNVDEAIEWLSYTYLFVRMRINPHVYGIEYSELEKDPTLEARRRALIMSAAMSLDKARMMRFNQRTMDMNITDLGRTASYFYIKYDTVETFNELMKPFMTQAEILAMISQAQEFQQLKVR-DDEMEELDELKNAYCKIKPYGGSENVHGKVNILIQTYLSNGYVKSFSLSSDMSYITTNIGRISRALFSIVLRQNNAVLSGNMLQLCKMFERRQWDFDCHLKQFPTINAETIDKLERRGLSVYRLRDMEHRELKEWLRSNTYADLVIRSAHELPLLEVEASLQPITRTVLRIKVDIWPSFTWNDRVHGKTCQSFWLWIEDPESNYIYHSELFQVTRKLVMSGQSQQLVMTIPLKEPLPPQYYIRVSSDNWLGSTTCIPLSFQHLVLPEHHPPLTELLPLRPLPVSCLKNVVYESLY--KFTHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIVAEIAIFRALNQNPKCKVVYIAPLKALVKERIADWEQRFQRSSLGLKVVELTGDVTPDIQAIRESQLIVTTPEKWDGISRSWQTREYVQHVSLIVIDEIHLLG-EDRGPVIEVIVSRTNFISSHTGRAIRIVGLSTALANAQDLANWLGINKMGLYNFKPSVRPVPLQVHINGFPGKHYCPRMATMNRPTFQAIRTYSPCEPTIVFVSSRRQTRLTALDLITFVAGESNPKQFLHIPEDEIELILQNIREQNLKFCLAFGIGLHHAGLQEQDRKCVEELFLNRKIQILVATATLAWGVNLPAHLVVIKGTEYFDGKVKKYVDMPITDVLQMMGRAGRPQFDNEGVAVVLVHDEKKNFYKKFLYDPFPVESSLLGVLPEHINAEIVAGTVQSKQAALDYLTWTYFFRRLLRNPSYYQLQDIEPENVNNFMSNLVERVVYELSAAACLVERDGCLIPTF-LGRISSYYYLSYRTMKHFLEDLQPGMNTKKVLLAIADSYEFDQLPVRHNEDKHNEEMAEVSRFRPPSSS--WDSSYTKTFLLLQAHFARQSLPNSDYLTDTKSALDNATRVMQAMVDYTAERGWLSTTLVVQQLMQSVIQARWFDGSEFLTLPGVNEDNLDAFLNIPHDDYDYLTLPVLKELCKQEYEVLAKPLRDAFEEHEIEKMYKVIQDLPEIAIQIFVEGRHMENEYAKRPLSLSDDTRGEWMSLHANEDYVLIVNLQRLNVSGQ-------RRGGGQSYTVHCPKYPKPKNEAWFLTLGSQANDELLAMKRVSIRGQRCTNRISFQATPRLGRLQLTLYLMSDCLMGFDQQYDLQFEII 2178          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Match: DNApol-theta (gene:FBgn0002905 transcript:FBtr0082662)

HSP 1 Score: 107.457 bits (267), Expect = 1.411e-22
Identity = 125/456 (27.41%), Postives = 212/456 (46.49%), Query Frame = 1
Query: 1582 NILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXX-XXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKH-----------------QVLIFVHSRKE----TVNTAKAIKEKCLNRDTLGLFLR---DKKASTLVLQQDLDKVKNHD--LKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQL-PIESQLISKLADNLN---AEIVMGTVRNIHESIDWL 2856
            N++  APT AGKT V+ + M++          T+ +   K++ I P  S+V E      + L     +V    G  +          + +CT EK + I  K  E+   + + ++++DE+HL+    RG +LE ++A+ +    S  + + ++++ +SATL N + +  ++  +       + ++YRPV + +E + +       R++L+ D+  +KV+    ++                  V++F  S+       V  A AI  +  +   LG  LR   + +A   V QQ  D     D  +   + Y  A HHAGL   +R+ +E  F    ++VLV+TSTL+ GVNLPA  V+I+      P  G   ++S+L   QM GRAGR   DT G  I+I NE        L+  +L PI S L    + +L     E++   V N  E ID+ 
Sbjct:  251 NLVYSAPTSAGKTLVSEILMLK----------TVLERGKKVLLILPFISVVREKMFYMQDLLTPAGYRVEGFYG-GYTPPGGFESLHVAICTIEKANSIVNKLMEQGKLETIGMVVVDEVHLISDKGRGYILELLLAKIL--YMSRRNGLQIQVITMSATLENVQLLQSWLDAEL------YITNYRPVAL-KEMIKVGTVIYDHRLKLVRDVAKQKVLLKGLENDSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIKSETVLGQRLRTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAGLTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRS-----PLFG-GKQMSSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCLDMDGSTHLKRALLEVISSGVANTKEDIDFF 680          

HSP 2 Score: 85.1149 bits (209), Expect = 7.781e-16
Identity = 92/441 (20.86%), Postives = 185/441 (41.95%), Query Frame = 1
Query: 4126 NVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQ------------TILKLSPNSPVIVFVPTMKQTEEIAFLL-------------MGYALSDKKNFGRASEAIVSEYMRNIS---NEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMC-QTNKKDFIQKFLHEPLPLESHLDHQLHDHFNA---EIVTKTIENKQDAVDYL 5349
            N+   APT +GKT+ +EI +++    R   + + +     + + +           G  V    G            H+ + T E  + +  +  ++  ++ I + +VD++HLI  +  G  LE++ ++  YMS +    I++I +S +L N + +  WLD     T N+ P      + +    ++      R  A  K + +             I  L     VIVF P+    E +A  L             +G  L  + N    + A V + +R+I    + ++ + ++    F H  L+  ER+++   F + ++++LV + TL   +   A  V++  + ++ GK       S++   QM+GRA     D    S+++C + N +      + E  P+ S LD     H      E+++  + N ++ +D+ 
Sbjct:  251 NLVYSAPTSAGKTLVSEILMLKTVLER-GKKVLLILPFISVVREKMFYMQDLLTPAGYRVEGFYGGYTPPG-GFESLHVAICTIEKANSIVNKLMEQGKLETIGMVVVDEVHLISDKGRGYILELLLAKILYMSRRNGLQIQVITMSATLENVQLLQSWLDAELYIT-NYRPVALKEMIKVGTVIYDHRLKLVRDVAKQKVLLKGLENDSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIKSETVLGQRL--RTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAGLTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIR-SPLFGGK-----QMSSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCLDMDGSTHLKRALLEVISSGVANTKEDIDFF 680          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Match: mus301 (gene:FBgn0002899 transcript:FBtr0076689)

HSP 1 Score: 98.5969 bits (244), Expect = 5.067e-20
Identity = 115/443 (25.96%), Postives = 183/443 (41.31%), Query Frame = 1
Query: 1564 ALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSE-----------------------RLKSYNLKVAMLSG-----DSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKH-RGLFKFDSSYRPVPMEQ------EYLGINE-------------------RKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDK---VKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENE 2721
            A+   +N++   PT  GKT VA + M+RE+          R+ +  +++I P  S+V E  ++ S                        R K  +L +A +       DS +  +  +E  ++V   ++  +I  K                        RG  LEA + + M        N +++IVG+SAT+ N  +I+ F++ D + RG       +RPV +++      + L IN                     +AVKR +   D +   + E A +H  L+F  SRK   N A  +            F   +++  L L   LDK   + +  L   LPYG A HH+GL   +R ++E  +    + V+  TSTLA GVNLPA  VII+   V +    E+  L+     QM GRAGR      G  I+I    +
Sbjct:  276 AIRQRKNLIYALPTSGGKTLVAEILMLREL--------LCRERN--VLFILPYVSIVQEKVSAMSPFAIDLDFIVEEYTAGKGKCPPQPRRKRRSLFIASIEKGAVLMDSLIDVQRPHEIGLVVV--DELHLIGEKG-----------------------RGATLEAFLTKVM------FLNANIQIVGMSATIGNLSEISSFLNADVYTRG-------FRPVELKEYIKCGPDLLEINSAGQTLEEIFVPSRSVEYNYSEAVKRAD--PDHLAGLISECAPEHCCLVFCPSRKNCENVALLLSRIVPKHK----FFEHRRSEKLDLMDALDKMCGILSPVLAKTLPYGIAYHHSGLTTDERKYIETAYRFGVVTVICCTSTLAAGVNLPAKRVIIRAPYVGQ----EF--LTLCKYKQMVGRAGRAGLGEAGESILIAQSKD 658          

HSP 2 Score: 84.7297 bits (208), Expect = 8.364e-16
Identity = 92/406 (22.66%), Postives = 171/406 (42.12%), Query Frame = 1
Query: 4123 ENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNM--DNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPS-----VRHRPLDIEI----QTF--------NITHNATRLAAMSKP--VYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAI----VSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKD----CMYDDYSAVDLIQMVGRANHASMDDA-RSVIMCQTNKKDFIQKFLHEPL 5250
            +N+    PT  GKT+ AEI ++R    R+    +++     + Q + +        L   V + T             +  + +++ E   VL       +    I L +VD+LHLIG +  G TLE   ++  ++++     I+I+G+S ++ N  ++  +L+     T  F P      ++  P  +EI    QT         ++ +N +     + P  +   I + +P    +VF P+ K  E +A LL       K    R SE +      + M  I + +L +TL  G+ + H  L+ +ER  +   +    + ++  + TL   +   A  VI+     Y G++    C Y         QMVGRA  A + +A  S+++ Q+     + + L  P+
Sbjct:  281 KNLIYALPTSGGKTLVAEILMLRELLCRE-RNVLFILPYVSIVQEKVSAMSPFAIDLDFIVEEYTAGKGKCPPQPRRKRRSLFIASIEKGAVLMDSLIDVQRPHEIGLVVVDELHLIGEKGRGATLEAFLTKVMFLNAN----IQIVGMSATIGNLSEISSFLNA-DVYTRGFRPVELKEYIKCGPDLLEINSAGQTLEEIFVPSRSVEYNYSEAVKRADPDHLAGLISECAPEHCCLVFCPSRKNCENVALLLSRIVPKHKFFEHRRSEKLDLMDALDKMCGILSPVLAKTLPYGIAYHHSGLTTDERKYIETAYRFGVVTVICCTSTLAAGVNLPAKRVIIRAP--YVGQEFLTLCKYK--------QMVGRAGRAGLGEAGESILIAQSKDNLLVGQMLFSPM 670          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Match: tst (gene:FBgn0039117 transcript:FBtr0334895)

HSP 1 Score: 85.5001 bits (210), Expect = 5.410e-16
Identity = 99/393 (25.19%), Postives = 168/393 (42.75%), Query Frame = 1
Query: 1684 RKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPM----------------------EQEYLGINERKAVKRIELM------------NDLVYEK----------VMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHD--------LKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMI 2706
            ++D  + +Y +P+K+L N+    F +  K     V +++GD  +          ++ T E    +    S+ T   L  ++  +  ++ + ERG V E ++      +   H NI M    LSAT+PNT ++A+++   K R ++   +  RPVP+                      + +YL  N  KAV+R + M            N L  ++           +  +    V+ F  SR    +   A++   LN +      ++K A      Q L K+K  D        LKD L  G  VHH+G+    +  VE LF +  +++L +T T A GVN+PA  V+    + +  D  E   L   + +QM GRAGR  +D  G  I++
Sbjct:  302 KRDLTRTIYTSPIKALSNQKYRDFRKTFKD----VGLITGDLQIE----PTASCLIMTTEILRSMLYCGSDVT-RDLEWVIFDEVHYINNPERGHVWEEVII-----LLPEHVNIIM----LSATVPNTLELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFLLVDAQGKYLQGNYEKAVERKKEMQGKAKGGGGGPRNHLNAKQEQYTWIGLIDFLRRSNMMPVVAFTLSRNRCDSNLAALQSVDLNTE------KEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALERGIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKF--DGLEMRNLKPGEYIQMAGRAGRRGHDETGTAIIM 668          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Match: snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:ZFIN;Acc:ZDB-GENE-081105-64])

HSP 1 Score: 2313.11 bits (5993), Expect = 0.000e+0
Identity = 1179/2157 (54.66%), Postives = 1585/2157 (73.48%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXX--XXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDG-GVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDD----PTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGA-LGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  KMG R  + KP  +EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  + DKER++  ++LLG    DT+Y+ LV+L  K++DY   K   N   N D+T  ++++ + D+EE ++D YGEV+D  SDD  G EAD ++TL  +    G +                     +   + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ KI  +M+ D   +++L  L+  + KEDI+  ER+R+ + R +++  D+E  D +   +  S  +LDL+++TFTQGSH M NK C+LPDGSFRK + GY  V VPA KPKP   +E LV I  LP Y +A FE  K+LNRIQSK++KT +E+DEN+L+CAPTGAGKTNVAL+ M+REIGKHIN DGTI   DFKI+YIAPM+SLV EM  SF +RL SY + V+ L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE+++ART+R ++ +    D+R++GLSATLPN ED+A  + VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYD+KG GI+IT+  EL YYLSLLN+QLPIESQ++ KLAD LNAEIV+G V+N  ++++WL YTYLY+RM +NP+LYGV +   DD    P L+    +L++TAA++LEK  ++ +DKRSG F   ++GRIA+++Y T+E++    + LK ++ +IE+F+VFS  +EFRNITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQAYISQLKLE F L +D  Y++QSA RLMRA+FE+ LS+ WA LT   L  CK +++RMW    PLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+HQ PKL+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE +LH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR  SD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y +   FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K  IIVST + WD+LSRRWK++K +QN+ LFI+D++HLIG   NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY  I+K SP+ PV+VFVP+ +QT   A  ++ +  +D   + F  ++E  +  +M N+S+  L ETLS GVG++HE LS  ER ++  LF+S +IQ++V S +LCW     A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKT+ENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K+VRLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS L+Q+PHF   +L++RC   GV+++FD+ME+EDE +  L+   D ++ DVARF   YPNI+L+YEV     + +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+  V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDRSQRTKPQMLEERRAKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEILLSFIQAALGDQP-RDILCGAADEVLAVLKNDKMRDKERRREVEQLLGPT-DDTRYHVLVNLGKKISDYGGDKELQNMDDNIDETYGVNVQFESDEEEGDEDQYGEVRDEGSDDSEGEEADESSTLTANLGNTGDVM--------------------MTKKKDLHPRDIDAFWLQRQLSRFYNDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRRMILYCTMLASAQSEAEKEKIINKMEADQDLSKVLYQLQETE-KEDIIREERSRRERMRKSRVD-DLESMDIDHGESVSSRQLLDLEDLTFTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFGDEETLVGIEKLPKYAQAGFEGFKSLNRIQSKLFKTTMETDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVADFKIIYIAPMRSLVQEMVGSFGKRLASYGIIVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQE--DVRLIGLSATLPNYEDVATCLRVDPSKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDSKGEGILITSHGELQYYLSLLNQQLPIESQMVGKLADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSH---DDRSIDPLLERRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDKRMWQSMSPLRQFRKLPEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITRSTLKVELTITPDFQWDDKIHGSSEAFWILVEDVDSEVVLHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRIASDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNGAFESLY-QNFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNAEGRCVYITPMEALAEQVFLDWHQKFQENLNKKVVLLTGETSTDLKLLGKGDIIVSTPDKWDILSRRWKQRKNVQNVSLFIIDEVHLIGGD-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMKHSPSKPVLVFVPSRRQTRLTAIDILTFCAADVVPQRFLHSTEKDLVPFMENLSDVTLKETLSNGVGYLHEGLSPTERRIVEHLFTSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLQDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLRQLPHFTS-ELIKRCTDKGVESIFDIMEMEDEDRTGLLQLSDVQVADVARFCNRYPNIELSYEVVDKDDIKSGSPVVVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-VVGVHNYTLYFMSDAYMGCDQEYKFSTEV 2122          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Match: snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:ZFIN;Acc:ZDB-GENE-081105-64])

HSP 1 Score: 2313.11 bits (5993), Expect = 0.000e+0
Identity = 1179/2157 (54.66%), Postives = 1585/2157 (73.48%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXX--XXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDG-GVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDD----PTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGA-LGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  KMG R  + KP  +EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  + DKER++  ++LLG    DT+Y+ LV+L  K++DY   K   N   N D+T  ++++ + D+EE ++D YGEV+D  SDD  G EAD ++TL  +    G +                     +   + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ KI  +M+ D   +++L  L+  + KEDI+  ER+R+ + R +++  D+E  D +   +  S  +LDL+++TFTQGSH M NK C+LPDGSFRK + GY  V VPA KPKP   +E LV I  LP Y +A FE  K+LNRIQSK++KT +E+DEN+L+CAPTGAGKTNVAL+ M+REIGKHIN DGTI   DFKI+YIAPM+SLV EM  SF +RL SY + V+ L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE+++ART+R ++ +    D+R++GLSATLPN ED+A  + VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYD+KG GI+IT+  EL YYLSLLN+QLPIESQ++ KLAD LNAEIV+G V+N  ++++WL YTYLY+RM +NP+LYGV +   DD    P L+    +L++TAA++LEK  ++ +DKRSG F   ++GRIA+++Y T+E++    + LK ++ +IE+F+VFS  +EFRNITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQAYISQLKLE F L +D  Y++QSA RLMRA+FE+ LS+ WA LT   L  CK +++RMW    PLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+HQ PKL+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE +LH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR  SD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y +   FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K  IIVST + WD+LSRRWK++K +QN+ LFI+D++HLIG   NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY  I+K SP+ PV+VFVP+ +QT   A  ++ +  +D   + F  ++E  +  +M N+S+  L ETLS GVG++HE LS  ER ++  LF+S +IQ++V S +LCW     A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKT+ENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K+VRLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS L+Q+PHF   +L++RC   GV+++FD+ME+EDE +  L+   D ++ DVARF   YPNI+L+YEV     + +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+  V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDRSQRTKPQMLEERRAKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEILLSFIQAALGDQP-RDILCGAADEVLAVLKNDKMRDKERRREVEQLLGPT-DDTRYHVLVNLGKKISDYGGDKELQNMDDNIDETYGVNVQFESDEEEGDEDQYGEVRDEGSDDSEGEEADESSTLTANLGNTGDVM--------------------MTKKKDLHPRDIDAFWLQRQLSRFYNDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRRMILYCTMLASAQSEAEKEKIINKMEADQDLSKVLYQLQETE-KEDIIREERSRRERMRKSRVD-DLESMDIDHGESVSSRQLLDLEDLTFTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFGDEETLVGIEKLPKYAQAGFEGFKSLNRIQSKLFKTTMETDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVADFKIIYIAPMRSLVQEMVGSFGKRLASYGIIVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQE--DVRLIGLSATLPNYEDVATCLRVDPSKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDSKGEGILITSHGELQYYLSLLNQQLPIESQMVGKLADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSH---DDRSIDPLLERRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLSRGWAQLTDKTLNLCKMIDKRMWQSMSPLRQFRKLPEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITRSTLKVELTITPDFQWDDKIHGSSEAFWILVEDVDSEVVLHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRIASDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNGAFESLY-QNFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNAEGRCVYITPMEALAEQVFLDWHQKFQENLNKKVVLLTGETSTDLKLLGKGDIIVSTPDKWDILSRRWKQRKNVQNVSLFIIDEVHLIGGD-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMKHSPSKPVLVFVPSRRQTRLTAIDILTFCAADVVPQRFLHSTEKDLVPFMENLSDVTLKETLSNGVGYLHEGLSPTERRIVEHLFTSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLQDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLRQLPHFTS-ELIKRCTDKGVESIFDIMEMEDEDRTGLLQLSDVQVADVARFCNRYPNIELSYEVVDKDDIKSGSPVVVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-VVGVHNYTLYFMSDAYMGCDQEYKFSTEV 2122          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 1264.98 bits (3272), Expect = 0.000e+0
Identity = 695/1798 (38.65%), Postives = 1071/1798 (59.57%), Query Frame = 1
Query:  841 NIANSEKLNVNDIDAFWLQRTLSKHFTDPN----ECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLV-RMLR--------------------------ENKLMIYYCTKLCCSQTPEERNKI---------------------EAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNV-PVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKL--LERCEAAGVKT 6036
             + ++E+L   + D   L++ + K+  + N      ++ +  + E+L   ++D EL+N+L   +G++ F+++ R+L+                          E+ +  Y C     S+  ++  KI                     E+    DP   R+        ++E  + A R+     R    +    +   +V  +YG       K   F  GS ++      LP+G  R     Y  V +P  +P P+  +E  V +++L    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H+   G IRKD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  L++ EI  TQ++V TPEKWD+++RKS  +   +Q+V+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FDS +RPVP+ Q ++GI     V+++  M ++ YEKV+ +    HQV++FVH+R  TV TA ++ E   NR  L  F  D+ A     ++ + + +N  ++++ P GF +HHAG+   DR+ +E +F+  +++VLV T+TLAWGVNLPAH VIIKGT +Y   +G   +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ    LADNLNAEI +GTV N+ E++ WL YTYLY+RMR NP  YG+ +     DP L+ + + L+  +   L+KA MI FD+R+G F S ++GR A+++Y    T++   +       + +V  + SK  EF  I VR+E+  E++K+L N   +P   G E+   KIN LLQ YIS+ +++ F+L SD +Y++Q+AAR+MRA+FE+ L K+W ++T  +L  CK +++R+W  + PLRQF  +P     ++E KN+  D+L D    E+G ++++  +G  + + +HQIP + L+  +QPITR+ ++V L+ITPDF W  + HGS  + +W++VED ++++I H EYFLL++K     +   + F + I++P+P  YYIRAVSD+W+G E    I F +++LPE++ P TELLDLQ LP  AL N EYES+Y  K + +N IQTQ F +LY++D NV +GAPTGSGKT+ AE+AI R+F+    ++ VY+  L  L + R  +W ++    LG+ V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS     +R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A M+KPV+Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  I    L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   T+ +KQDA+DY+TWT+ + R+  NP+YYNL  +SH  ++ +LS LVE +L DLE S C+ I +D+  +  +  G I+++YY+ + TI MF   LKP   V  LL                    IL+  K S  + +                    +S +P   ++   D   +L  ++R+ QA +DV+++  WL  AL+   L QMI QA+W  DS L  +PH  + +L    R  + GV+ 
Sbjct:  213 GVYSAEELEQRNTDGSILRQEVEKYLNEGNMVSSSAEELSTSLFEMLASTRSDDELQNELFEFLGLEGFEMISRLLQRRSDIVDALVSIPADSRHHFTSGLRDESNMPTYGCQVTIQSEQEKQMMKIYRKEEKKERKRERRGDDGESSESAFHFDPMELRL--------QREQALLAARSSPVLGRHRDYE---RIRYPHVYDSYGEAT----KTSAFIGGSKML------LPEGIRRDNNKMYEEVEIPPNEPMPIGFEEKAVFVSELDEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTILHEIRQHLQPGGVIRKDQFKIVYVAPMKALAAEMTNYFSKRLEPLGIAVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQVVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPFIGLFYFDSRFRPVPLGQSFVGIKTTNKVQQLHDMEEVCYEKVLKQIKAGHQVMVFVHARNSTVRTAMSLIEMAKNRGELSFFQVDQGADYGQCEKQIQRSRNKQMREMFPDGFGIHHAGMLRQDRSLMESMFSRGYLKVLVCTATLAWGVNLPAHAVIIKGTNIYDAKRGTLVDLGILDVMQIFGRAGRPQFDKYGEGTIITTHDKLSHYLTLLTQQNPIESQFQQSLADNLNAEIALGTVTNVDEAVRWLSYTYLYVRMRANPLAYGINHKAYQMDPQLELYRKELVVESGRKLDKARMIRFDERTGYFASTDLGRTASHFYIKYNTIESFNELFNAQNTEADVLSIVSKAEEFEQIKVRDEELEELEKMLCNFCELPASGGVENGYGKINILLQTYISRGEVDSFSLISDLSYVAQNAARIMRALFEMALRKRWPAMTYRLLNLCKVMDKRLWGWAHPLRQFNTLPASALARMEDKNLTIDKLRDMGKDEIGHMLHHVNIGLKVKQCVHQIPAILLESSIQPITRTVLRVRLSITPDFRWNDQVHGSVGEPWWLWVEDPINDHIYHSEYFLLQKKQVVSGEPQQVVFTIPIFEPMPSQYYIRAVSDRWLGSEAVCIINFQHLILPERHPPHTELLDLQPLPITALGNREYESLY--KFTHYNPIQTQIFHTLYHTDTNVLLGAPTGSGKTIAAEMAIFRVFNMYPTSKVVYIAPLKALVRERIEDWKIRIEEKLGRKVVELTGDNTPDMRAIAQADLIVTTPEKWDGVSRSWQNRSYVQKVAILIIDEIHLLG-EDRGPVLEVIVSRTNFISSHTSKTVRVVGLSTALANARDLADWLGIGQVGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMATMNKPVFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLATEDDPKQWLHQDEREMTDIIATIRESNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEYYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLSVLSDHLNAEIAAGTVTSKQDAMDYITWTYFFRRLVMNPSYYNLDDISHETINKYLSNLVERSLRDLECSYCMEIQQDEQTIEPLTYGRISSYYYLKHQTIRMFKERLKPELPVHELL-------------------AILSVSKHSFLMHLHP------------------VSALP--CSDYGTDTKTVLDNAIRICQAMLDVVANEGWLVSALSLCNLVQMIIQARWLHDSSLLTLPHIQKQELYVFRRWSSRGVRA 1945          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 271.166 bits (692), Expect = 2.905e-81
Identity = 145/297 (48.82%), Postives = 211/297 (71.04%), Query Frame = 1
Query: 1378 LPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVL 2262
            LP+G  R     Y  V +P  +P P+  +E  V +++L    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H+   G IRKD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  L++ EI  TQ++V TPEKWD+++RKS  +   +Q+V+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FDS +RPVP+ Q ++GI     V+++  M ++ YEKV+ +    HQV+
Sbjct:    3 LPEGIRRDNNKMYEEVEIPPNEPMPIGFEEKAVFVSELDEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTILHEIRQHLQPGGVIRKDQFKIVYVAPMKALAAEMTNYFSKRLEPLGIAVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQVVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPFIGLFYFDSRFRPVPLGQSFVGIKTTNKVQQLHDMEEVCYEKVLKQIKAGHQVM 297          

HSP 2 Score: 115.161 bits (287), Expect = 3.303e-27
Identity = 77/249 (30.92%), Postives = 124/249 (49.80%), Query Frame = 1
Query: 4036 EEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSN--------RQDA-RCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAI-QNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCH-HTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILK 4749
            +E   +  K M   N IQ+  FE+ YN++EN+ I APTG+GKT  A + I+             R+D  + VYV  +  LA      + K    LG  V +LTG+  +    I +  ++V+T E WDV++R+     A+ Q ++L I+D++HL+  +  G  LE + +RT       ++ IRI+GLS +L N  DV  +L  +     + F+   R  PL         T+   +L  M +  Y+ +LK
Sbjct:   41 DEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTILHEIRQHLQPGGVIRKDQFKIVYVAPMKALAAEMTNYFSKRLEPLGIAVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQVVRLLILDEVHLL-HEDRGPVLESLVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHVNPFIGLFYFDSRFRPVPLGQSFVGIKTTNKVQQLHDMEEVCYEKVLK 288          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 272.707 bits (696), Expect = 2.417e-74
Identity = 191/668 (28.59%), Postives = 320/668 (47.90%), Query Frame = 1
Query: 4039 EYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNR----QDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNK-SISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYM-------SSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIE--IQTFNITHNATRLA---AMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYA-----LSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRI-----KQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLS--SNRWLGPALAAMELAQMITQAQW 5952
            ++ S++ K   +FN +Q+Q  + +  S++N    APTGSGKTV  E+AI+RL         + R VY+  +  L   +Y  W + FG LG    +LTG+T +D+   I  AH+I +TAE WD ++RRWK    + +I+LF+VD++H++  +  G TLEV+ SR + M       + + +  +R + +S ++ N +DV EWL               HRP+ +   +  F    N        +++  +   I   S   P +VF  T K  ++ A +L   A     +  K+   + + +++   +R++           G+G+ H  + +++R +    F+   + +L  + TL   +   A+LV++  T  Y G  C  ++YS  DL+QM+GRA     D  A +VIM +   KD    FL     +ES L   L +H NAEIV  TI +   A+D++  TFLY R  +NP +Y               EL    L  L +   I + +DI++     G +   Y + + T++ FS+ +     +  L+E+I  A EF D+ LR  E   L  +     + ++R PI    + +D   K N L+QA L  +PI+   L +D  +I   +VR+ +   + L   S       L A+ LA+      W
Sbjct:  233 KFRSVF-KDFPYFNYVQSQALDDVLYSNKNFVACAPTGSGKTVLFELAIVRLLIEASEPWHNVRAVYMAPIKALCSQQYDNWKQKFGPLGLKCKELTGDTEIDDFFEIQDAHLIFTTAEKWDSMTRRWKDNCLLTSIRLFLVDEVHVVKDKTRGATLEVVVSRMKTMHFYRQAINPESKASVRFVAVSATIPNIQDVSEWLSDESGPATCLEMDESHRPVKLRKVVLGFPCGSNQNEFKFDLSLNYKLANIIQTYSDQKPTLVFCSTRKGVQQSASVLAKDARFIMSIDHKQRLVKYANSLLDAKLRDL--------FVYGIGYHHAGMDVSDRKITENAFTVGDLPVLFTTSTLAMGVNMPAHLVVIKSTMHYVGGAC--EEYSEADLLQMIGRAGRPQFDTTATAVIMTRPQTKDKYMHFLSGLDCIESSLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPKHY---------------ELCLKNLNSLASFNLITMDEDINIKPTETGKLMARYCVAFDTVKQFSM-VTGTETLPELIEMISKAKEFSDMQLRVNERKTLNTLNKDKNRTTIRFPIEGKIKSND--MKVNCLIQAQLGCIPIQEFGLIQDTGKIFRNAVRVSRYLTEFLCHHSKSNFAAQLNALILAKCFRAKLW 871          

HSP 2 Score: 270.396 bits (690), Expect = 1.396e-73
Identity = 215/772 (27.85%), Postives = 377/772 (48.83%), Query Frame = 1
Query: 1471 LVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTY-TQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQ------SSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRG-LFKFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAAS--ILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDI--EVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTL--SKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQP-ITRSTMKVELTI 3705
            L  ++++P+  ++ F+     N +QS+     L S++N + CAPTG+GKT +  L ++R +      + +    + + VY+AP+K+L ++  +++ ++     LK   L+GD+ +    EI +  +I  T EKWD ++R+  +    T +   L+ +   +    RG  LE +V+R M+ M       +  S   +R V +SAT+PN +D++E++  +       + D S+RPV + +  LG    + +   K    +N  +   +  Y+ +   L+F  +RK    +A       L +D   +   D K   +     L   K   L+DL  YG   HHAG+  +DR   E  FT   + VL +TSTLA GVN+PAH+V+IK T  Y    G   E S  D++QM GRAGRPQ+DT    +++T       Y+  L+    IES L + L ++LNAEIV+ T+ +++ ++DW+R T+LYIR  KNP  Y +             C   + + AS  ++   E IN           E G++ A  YC     D +K+F   +  +   E+ ++ SK  EF ++ +R  ++  +  L ++     +  PI+   +    K+NCL+QA +  + ++ F L  DT  I ++A R+ R + E     SK   +  L+ L   K    ++W  S  + +Q +++   +   L    +  F ++      EL  +VN H   G  I + I ++P+  + +   P  + ST ++  T+
Sbjct:  224 LRSVSEIPAKFRSVFKDFPYFNYVQSQALDDVLYSNKNFVACAPTGSGKTVLFELAIVRLL-----IEASEPWHNVRAVYMAPIKALCSQQYDNWKQKFGPLGLKCKELTGDTEIDDFFEIQDAHLIFTTAEKWDSMTRRWKDNCLLTSIRLFLVDEVHVVKDKTRGATLEVVVSR-MKTMHFYRQAINPESKASVRFVAVSATIPNIQDVSEWLSDESGPATCLEMDESHRPVKLRKVVLGFPCGSNQNEFKFDLSLNYKLANIIQTYSDQKPTLVFCSTRKGVQQSASV-----LAKDARFIMSIDHKQRLVKYANSLLDAK---LRDLFVYGIGYHHAGMDVSDRKITENAFTVGDLPVLFTTSTLAMGVNMPAHLVVIKSTMHYV--GGACEEYSEADLLQMIGRAGRPQFDTTATAVIMTRPQTKDKYMHFLSGLDCIESSLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPKHYEL-------------CLKNLNSLASFNLITMDEDINIKP-------TETGKLMA-RYCV--AFDTVKQFSMVTGTETLPELIEMISKAKEFSDMQLRVNERKTLNTLNKDKNRTTIRFPIEGKIKSNDMKVNCLIQAQLGCIPIQEFGLIQDTGKIFRNAVRVSRYLTEFLCHHSKSNFAAQLNALILAKCFRAKLWENSPYISKQLERIGLSLATALVNAGLTTFSKIEQTSPRELELIVNRHPPFGNQIKEAISKLPRCEVSLEQIPRYSPSTAEIVFTV 956          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Match: SNRNP200 (small nuclear ribonucleoprotein, U5 200kDa subunit [Source:NCBI gene;Acc:100145098])

HSP 1 Score: 2184.84 bits (5660), Expect = 0.000e+0
Identity = 1108/2140 (51.78%), Postives = 1517/2140 (70.89%), Query Frame = 1
Query:   88 NSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK--SVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  K KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DK+R++   +LLG    DT+Y+ LV+L  K++DY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  ++G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M++DP+ ++ L  L+  + KED++   R  + + R   +  D+E  ++     +    +LDL+++ F QGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  +DE LV +  LP Y ++ FE  KTLNRIQSK++K ALE+DEN+LLCAPT                                                    RL +Y + VA L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+I+DE+HLLHD+RGPVLE++VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  T++AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG++  DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ+++KL D LNAE+V+G V+N  ++++WL YTYLYIRM ++P+LYG+  + L  DP L+    +LI+TAA +L+K  ++ +DK++G F   E+GRIA+++Y TN+++    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QN+ LFIVD+ HLIG   NG  LEVICSR RY+SSQ+E PIR++ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I+K SP  P+IVFVP+ KQT   A  ++    +D  ++ F   +E  ++ Y+  +S+E L ETL  GVG++HE LS  ER ++ +LF++ ++Q++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKT+ENKQDAVDYLTWTFLY RMT+NPNYYNL+GVSHRHLSDHLSELVE+TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E +P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF+    ++RC   GV++VFD+ME+EDE +  L+   D ++ DVARF   YPNI+L+YEV++  S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G++ YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    8 NSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQKTKPQMQEERRLKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNDRLRDKDRRREVDQLLGQT-DDTRYHVLVNLGKKISDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDIYGEVRDEASDDDMDGDEAVVRCTLSANLASSGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTAGDDRECENQLVLLLGFNTFDFIKVLRQHRMMIMYCTLLASAQSEAEKERIMGKMESDPELSKYLYQLQETE-KEDLIREARGHRDKVRQLNVDMDLENMETEQGEAFAPRQVLDLEDLVFAQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFASDEQLVPVEKLPKYAQSGFEGFKTLNRIQSKLFKAALETDENLLLCAPT----------------------------------------------------RLSTYGITVAELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEVHLLHDDRGPVLESLVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTSRAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMSRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVAKLPDMLNAEVVLGHVQNAKDAVNWLGYTYLYIRMLRSPNLYGISHDDLKIDPLLEQRRLDLIHTAALLLDKNNLMKYDKKTGNFQVTELGRIASHFYITNDSIQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLDLSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTIYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVFMDWFEKFQDRLYKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNVSLFIVDETHLIGGA-NGPVLEVICSRMRYISSQIERPIRVVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAIVKHSPKKPIIVFVPSRKQTRLTAIDILTTCAADVQRQRFLHCTEKDLAPYLEKLSDETLKETLLNGVGYLHEGLSSLERRIVEQLFNTGAVQVIVASRSLCWGLNIAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGYANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGVSHRHLSDHLSELVEHTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYESIPIRHHEDNLLRQLAQKVPHKLT-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFSSEH-IKRCTEKGVESVFDIMEMEDEDRTELLQLSDSQMADVARFCNRYPNIELSYEVAERDSIRSGGAVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDSKSNSLISIKRLTLQQKAKVKLDFVAP-ATGNHNYTLYFMSDAYMGCDQEYKFSVDV 2065          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 1335.09 bits (3454), Expect = 0.000e+0
Identity = 741/1952 (37.96%), Postives = 1146/1952 (58.71%), Query Frame = 1
Query:  955 ILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIY-----YCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQAD----------------IEMEDSNVISNYGSVDMLD---------------------LKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVEN-VLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE----------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS------------KSVSAGGQVSVQIHLARDEDNI------------------SSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            + E+L   K++ EL+N+L  ++G +    + ML + +  I      Y  K+  SQ    RN  E    T P        +++   K+ +    R  K  A+  K   D                + M+  + +SN  ++ +L                      +K   F  G+ L+      LP+G  R+    +  V +P  +P P+  +E  V I DL    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI ++I   G I+KD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +QLV+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FD  +RPVP+ Q ++GI      +++  + ++ YE V+ E     QV++FVH+R  TV TA A++E   N   +  FL ++       ++ + + +N  L++L P GF++HHAG+   DR+ VE LF+  HI+VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ +  LADNLNAE+ +GTV N+ E++ WL YTYLY+RMR NP +YG+ + V   DP L+ H   L+  A   L+KA MI F++R+G F S ++GR ++++Y    T++   +       + ++  + SK  EF  I VR+E+  E++ L+ N   + +  G E+   KIN LLQ YI + +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  +  KLE+K +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L I PDF+W  + HG+  + +WI+VED  +++I H EYFLL++K     +  +L F + I++PLP  YYIRA+SD+W+G E    I F +++LPE++ P TELLDLQ LP  AL +  YE++Y  K + FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E  +R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YYNL+ V H  ++  LS LVE +L+DLE S CI I +D+  +     G IA++YY+ + T+ MF   LK +  V  LL ++ ++ E+ DLP+RH ED + + + + L + ++    +    TK ++LLQA+ SR  +   +   D   +L  ++R+ QA +DV + + WL  AL    L QM+ QA+W  D  L  +P+  +                            P+L+  C   G + +F  +   D Q          ++     F    P ID++  +              +V  G Q    + L  D++ +                  S   A  FP  ++E W+L++GE ++  L+++K +     +  VS+ F  P  +G Y YTLY MSDSYLG DQ+Y   +N+V
Sbjct:  260 LFEMLASTKSNDELQNELFELLGPEGLTFIEMLLQQRQKIVERSLNYDNKMYTSQEQRMRNFGE---NTKPNYG-CQVTVQSEQEKQLMKQYRREEKRNAKREKRLGDDGDISGEGLVGFDPRELRMQREHALSNARTMPILGKERDYWERIKYPHVYDSHAEAMKTSAFIGGAKLL------LPEGIQRENNKIFEEVKIPVSEPMPIGFEEKPVYIKDLDEVGQLVFKGVKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIHQNIE-QGVIKKDAFKIVYVAPMKALAAEMTNYFSKRLEPLGISVKELTGDMQLSKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQLVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVASFLHVNPFIGLFFFDGRFRPVPLGQTFIGIKSTNKTQQLHDVEEVCYENVLKEIKAGRQVMVFVHARNSTVRTAMALRELAKNNGHICYFLPNQGPEYGQAEKQVQRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNELFDAHKTEGDIVAIVSKAEEFEQIKVRDEEIEELEHLIHNYCELHVAGGVENSYGKINILLQTYIGRGEIDNFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPSVLSKLEEKKLTIDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPSITMEATIQPITRTVLRVRLNINPDFKWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLLQKKQVVTKEPQLLVFTIPIFEPLPSQYYIRAISDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGHSHYEALY--KFTHFNPVQTQIFHTLYHTDSNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAEADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDE-RGPVLEVIVSRTNFISSHTEKTVRVVGLSTALANARDLADWLGIGQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATENDPKQWLNMDEREMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLEVLSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVGHESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVRMFKDRLKSDCSVEDLLSVLSDSEEYADLPVRHNEDQMNSELARHLPIEVNP-HSMDSGHTKTHLLLQAHFSRAMLPCPDYATDTKSVLDNAIRICQAMLDVAAHHGWLVTALNIAHLVQMVVQARWVNDPCLITVPNLEKHHLHLFSKWNQGKRKAISGDFTGPIECLPELIAVC--GGREDIFSSILEHDVQV--------TQISQAWNFVSNLPVIDVSLCIKGWWENESQTLPIHTVPPGTQDKKWMMLHADQEYVLQVNLQRIRTGYRKGRQDSKAIAPKFPKAKDEGWFLILGEVDKRELVALKRIGYVRNRNSVSVAFYTPESTGRYIYTLYLMSDSYLGMDQQYDIYLNIV 2184          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 1332.01 bits (3446), Expect = 0.000e+0
Identity = 736/1935 (38.04%), Postives = 1143/1935 (59.07%), Query Frame = 1
Query:  955 ILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQAD----------------IEMEDSNVISNYGSVDMLD---------------------LKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVEN-VLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE----------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLARDEDNI------------------SSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            + E+L   K++ EL+N+L  ++G +    + ML + +  I         ++    NKI     T P        +++   K+ +    R  K  A+  K   D                + M+  + +SN  ++ +L                      +K   F  G+ L+      LP+G  R+    +  V +P  +P P+  +E  V I DL    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI ++I   G I+KD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +QLV+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FD  +RPVP+ Q ++GI      +++  + ++ YE V+ E     QV++FVH+R  TV TA A++E   N   +  FL ++       ++ + + +N  L++L P GF++HHAG+   DR+ VE LF+  HI+VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ +  LADNLNAE+ +GTV N+ E++ WL YTYLY+RMR NP +YG+ + V   DP L+ H   L+  A   L+KA MI F++R+G F S ++GR ++++Y    T++   +       + ++  + SK  EF  I VR+E+  E++ L+ N   + +  G E+   KIN LLQ YI + +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  +  KLE+K +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L I PDF+W  + HG+  + +WI+VED  +++I H EYFLL++K     +  +L F + I++PLP  YYIRA+SD+W+G E    I F +++LPE++ P TELLDLQ LP  AL +  YE++Y  K + FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E  +R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YYNL+ V H  ++  LS LVE +L+DLE S CI I +D+  +     G IA++YY+ + T+ MF   LK +  V  LL ++ ++ E+ DLP+RH ED + + + + L + ++    +    TK ++LLQA+ SR  +   +   D   +L  ++R+ QA +DV + + WL  AL    L QM+ QA+W  D  L  +P+  +                            P+L+  C   G + +F  +   D  K A     +  + DV+   + +   +       +V  G Q    + L  D++ +                  S   A  FP  ++E W+L++GE ++  L+++K +     +  VS+ F  P  +G Y YTLY MSDSYLG DQ+Y   +N+V
Sbjct:  260 LFEMLASTKSNDELQNELFELLGPEGLTFIEMLLQQRQKI-------VERSLNYDNKINFGENTKPNYG-CQVTVQSEQEKQLMKQYRREEKRNAKREKRLGDDGDISGEGLVGFDPRELRMQREHALSNARTMPILGKERDYWERIKYPHVYDSHAEAMKTSAFIGGAKLL------LPEGIQRENNKIFEEVKIPVSEPMPIGFEEKPVYIKDLDEVGQLVFKGVKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIHQNIE-QGVIKKDAFKIVYVAPMKALAAEMTNYFSKRLEPLGISVKELTGDMQLSKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQLVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVASFLHVNPFIGLFFFDGRFRPVPLGQTFIGIKSTNKTQQLHDVEEVCYENVLKEIKAGRQVMVFVHARNSTVRTAMALRELAKNNGHICYFLPNQGPEYGQAEKQVQRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNELFDAHKTEGDIVAIVSKAEEFEQIKVRDEEIEELEHLIHNYCELHVAGGVENSYGKINILLQTYIGRGEIDNFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPSVLSKLEEKKLTIDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPSITMEATIQPITRTVLRVRLNINPDFKWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLLQKKQVVTKEPQLLVFTIPIFEPLPSQYYIRAISDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGHSHYEALY--KFTHFNPVQTQIFHTLYHTDSNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAEADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDE-RGPVLEVIVSRTNFISSHTEKTVRVVGLSTALANARDLADWLGIGQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATENDPKQWLNMDEREMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLEVLSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVGHESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVRMFKDRLKSDCSVEDLLSVLSDSEEYADLPVRHNEDQMNSELARHLPIEVNP-HSMDSGHTKTHLLLQAHFSRAMLPCPDYATDTKSVLDNAIRICQAMLDVAAHHGWLVTALNIAHLVQMVVQARWVNDPCLITVPNLEKHHLHLFSKWNQGKRKAISGDFTGPIECLPELIAVC--GGREDIFSSILEHDVTKSAWNFVSNLPVIDVSLCIKGWWENESQTLPIHTVPPGTQDKKWMMLHADQEYVLQVNLQRIRTGYRKGRQDSKAIAPKFPKAKDEGWFLILGEVDKRELVALKRIGYVRNRNSVSVAFYTPESTGRYIYTLYLMSDSYLGMDQQYDIYLNIV 2171          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 737/1947 (37.85%), Postives = 1143/1947 (58.71%), Query Frame = 1
Query:  955 ILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQAD----------------IEMEDSNVISNYGSVDMLD---------------------LKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVEN-VLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE----------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS------------KSVSAGGQVSVQIHLARDEDNI------------------SSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            + E+L   K++ EL+N+L  ++G +    + ML + +  I         ++    NKI     T P        +++   K+ +    R  K  A+  K   D                + M+  + +SN  ++ +L                      +K   F  G+ L+      LP+G  R+    +  V +P  +P P+  +E  V I DL    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI ++I   G I+KD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +QLV+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FD  +RPVP+ Q ++GI      +++  + ++ YE V+ E     QV++FVH+R  TV TA A++E   N   +  FL ++       ++ + + +N  L++L P GF++HHAG+   DR+ VE LF+  HI+VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ +  LADNLNAE+ +GTV N+ E++ WL YTYLY+RMR NP +YG+ + V   DP L+ H   L+  A   L+KA MI F++R+G F S ++GR ++++Y    T++   +       + ++  + SK  EF  I VR+E+  E++ L+ N   + +  G E+   KIN LLQ YI + +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  +  KLE+K +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L I PDF+W  + HG+  + +WI+VED  +++I H EYFLL++K     +  +L F + I++PLP  YYIRA+SD+W+G E    I F +++LPE++ P TELLDLQ LP  AL +  YE++Y  K + FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E  +R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YYNL+ V H  ++  LS LVE +L+DLE S CI I +D+  +     G IA++YY+ + T+ MF   LK +  V  LL ++ ++ E+ DLP+RH ED + + + + L + ++    +    TK ++LLQA+ SR  +   +   D   +L  ++R+ QA +DV + + WL  AL    L QM+ QA+W  D  L  +P+  +                            P+L+  C   G + +F  +   D Q          ++     F    P ID++  +              +V  G Q    + L  D++ +                  S   A  FP  ++E W+L++GE ++  L+++K +     +  VS+ F  P  +G Y YTLY MSDSYLG DQ+Y   +N+V
Sbjct:   52 LFEMLASTKSNDELQNELFELLGPEGLTFIEMLLQQRQKI-------VERSLNYDNKINFGENTKPNYG-CQVTVQSEQEKQLMKQYRREEKRNAKREKRLGDDGDISGEGLVGFDPRELRMQREHALSNARTMPILGKERDYWERIKYPHVYDSHAEAMKTSAFIGGAKLL------LPEGIQRENNKIFEEVKIPVSEPMPIGFEEKPVYIKDLDEVGQLVFKGVKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIHQNIE-QGVIKKDAFKIVYVAPMKALAAEMTNYFSKRLEPLGISVKELTGDMQLSKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQLVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVASFLHVNPFIGLFFFDGRFRPVPLGQTFIGIKSTNKTQQLHDVEEVCYENVLKEIKAGRQVMVFVHARNSTVRTAMALRELAKNNGHICYFLPNQGPEYGQAEKQVQRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNELFDAHKTEGDIVAIVSKAEEFEQIKVRDEEIEELEHLIHNYCELHVAGGVENSYGKINILLQTYIGRGEIDNFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPSVLSKLEEKKLTIDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPSITMEATIQPITRTVLRVRLNINPDFKWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLLQKKQVVTKEPQLLVFTIPIFEPLPSQYYIRAISDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGHSHYEALY--KFTHFNPVQTQIFHTLYHTDSNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAEADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDE-RGPVLEVIVSRTNFISSHTEKTVRVVGLSTALANARDLADWLGIGQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATENDPKQWLNMDEREMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLEVLSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVGHESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVRMFKDRLKSDCSVEDLLSVLSDSEEYADLPVRHNEDQMNSELARHLPIEVNP-HSMDSGHTKTHLLLQAHFSRAMLPCPDYATDTKSVLDNAIRICQAMLDVAAHHGWLVTALNIAHLVQMVVQARWVNDPCLITVPNLEKHHLHLFSKWNQGKRKAISGDFTGPIECLPELIAVC--GGREDIFSSILEHDVQV--------TQISQAWNFVSNLPVIDVSLCIKGWWENESQTLPIHTVPPGTQDKKWMMLHADQEYVLQVNLQRIRTGYRKGRQDSKAIAPKFPKAKDEGWFLILGEVDKRELVALKRIGYVRNRNSVSVAFYTPESTGRYIYTLYLMSDSYLGMDQQYDIYLNIV 1967          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Match: gipc1 (GIPC PDZ domain containing family member 1 [Source:Xenbase;Acc:XB-GENE-493927])

HSP 1 Score: 1316.6 bits (3406), Expect = 0.000e+0
Identity = 736/1932 (38.10%), Postives = 1135/1932 (58.75%), Query Frame = 1
Query:  955 ILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQAD----------------IEMEDSNVISNYGSVDMLD---------------------LKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVEN-VLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKL-LERCEAAGVKTVFDLMELEDEQKLALMNFPDD-------------KLQDVARFFQCYPNIDLTYEVS------------KSVSAGGQVSVQIHLARDEDNI------------------SSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            + E+L   K++ EL+N+L  ++G +    + ML + +  I         ++    NKI     T P        +++   K+ +    R  K  A+  K   D                + M+  + +SN  ++ +L                      +K   F  G+ L+      LP+G  R+    +  V +P  +P P+  +E  V I DL    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI ++I   G I+KD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +QLV+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+   GLF FD  +RPVP+ Q ++GI           MN   +           V++FVH+R  TV TA A++E   N   +  FL ++       ++ + + +N  L++L P GF++HHAG+   DR+ VE LF+  HI+VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ +  LADNLNAE+ +GTV N+ E++ WL YTYLY+RMR NP +YG+ + V   DP L+ H   L+  A   L+KA MI F++R+G F S ++GR ++++Y    T++   +       + ++  + SK  EF  I VR+E+  E++ L+ N   + +  G E+   KIN LLQ YI + +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  +  KLE+K +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L I PDF+W  + HG+  + +WI+VED  +++I H EYFLL++K     +  +L F + I++PLP  YYIRA+SD+W+G E    I F +++LPE++ P TELLDLQ LP  AL +  YE++Y  K + FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E  +R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YYNL+ V H  ++  LS LVE +L+DLE S CI I +D+  +     G IA++YY+ + T+ MF   LK +  V  LL ++ ++ E+ DLP+RH ED + + + + L + ++    +    TK ++LLQA+ SR  +   +   D   +L  ++R+ QA +DV + + WL  AL    L QM+ QA+W  D  L  +P+  +  L L RC  A        +E   E  +A+    +D             ++     F    P ID++  +              +V  G Q    + L  D++ +                  S   A  FP  ++E W+L++GE ++  L+++K +     +  VS+ F  P  +G Y YTLY MSDSYLG DQ+Y   +N+V
Sbjct:  260 LFEMLASTKSNDELQNELFELLGPEGLTFIEMLLQQRQKI-------VERSLNYDNKINFGENTKPNYG-CQVTVQSEQEKQLMKQYRREEKRNAKREKRLGDDGDISGEGLVGFDPRELRMQREHALSNARTMPILGKERDYWERIKYPHVYDSHAEAMKTSAFIGGAKLL------LPEGIQRENNKIFEEVKIPVSEPMPIGFEEKPVYIKDLDEVGQLVFKGVKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIHQNIE-QGVIKKDAFKIVYVAPMKALAAEMTNYFSKRLEPLGISVKELTGDMQLSKGEILRTQMLVTTPEKWDVVTRKSVGDVALSQLVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVASFLHVNPFIGLFFFDGRFRPVPLGQTFIGIKSTNKAS----MNLKAF----------CVMVFVHARNSTVRTAMALRELAKNNGHICYFLPNQGPEYGQAEKQVQRSRNKQLRELFPDGFSIHHAGMLRQDRSLVENLFSQGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQFLESLADNLNAEVALGTVTNVEEAVKWLSYTYLYVRMRANPLVYGISHKVYQMDPALEKHREQLVIEAGRKLDKARMIRFEERTGFFSSTDLGRTSSHFYIKYNTIETFNELFDAHKTEGDIVAIVSKAEEFEQIKVRDEEIEELEHLIHNYCELHVAGGVENSYGKINILLQTYIGRGEIDNFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPSVLSKLEEKKLTIDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPSITMEATIQPITRTVLRVRLNINPDFKWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLLQKKQVVTKEPQLLVFTIPIFEPLPSQYYIRAISDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGHSHYEALY--KFTHFNPVQTQIFHTLYHTDSNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAEADLIVTTPEKWDGVSRSWQNRSYVQKVSILIIDEIHLLGDE-RGPVLEVIVSRTNFISSHTEKTVRVVGLSTALANARDLADWLGIGQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATENDPKQWLNMDEREMNDIIGTLKDSNLKLTLAFGIGMHHAGLHERDRRTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEFYDGKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLEVLSDHLNAEIAAGTITSKQDAMDYITWTYFFRRLMMNPSYYNLEDVGHESMNKFLSNLVEKSLIDLECSYCIEIAEDNRSIEPQTYGRIASYYYLKHQTVRMFKDRLKSDCSVEDLLSVLSDSEEYADLPVRHNEDQMNSELARHLPIEVNP-HSMDSGHTKTHLLLQAHFSRAMLPCPDYATDTKSVLDNAIRICQAMLDVAAHHGWLVTALNIAHLVQMVVQARWVNDPCLITVPNLEKHHLHLFRCRKAISGDFTGPIECLPEL-IAVCGGREDIFSSILEHDVQVTQISQAWNFVSNLPVIDVSLCIKGWWENESQTLPIHTVPPGTQDKKWMMLHADQEYVLQVNLQRIRTGYRKGRQDSKAIAPKFPKAKDEGWFLILGEVDKRELVALKRIGYVRNRNSVSVAFYTPESTGRYIYTLYLMSDSYLGMDQQYDIYLNIV 2155          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Match: Snrnp200 (small nuclear ribonucleoprotein 200 (U5) [Source:MGI Symbol;Acc:MGI:2444401])

HSP 1 Score: 2325.44 bits (6025), Expect = 0.000e+0
Identity = 1171/2156 (54.31%), Postives = 1569/2156 (72.77%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER++    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+++DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  Y +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QNI LF+VD++HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I K SP  PVIVFVP+ KQT   A  ++    +D  ++ F   +E  +  Y+  +S+  L ETL  GVG++HE LS  ER L+ +LFSS +IQ++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH +HDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVE TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV++VFD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV    S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDMNKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRREIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEKERIVGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIVLDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEH-IKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP-ATGGHNYTLYFMSDAYMGCDQEYKFSVDV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Match: Ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:MGI Symbol;Acc:MGI:1925237])

HSP 1 Score: 1337.78 bits (3461), Expect = 0.000e+0
Identity = 762/1978 (38.52%), Postives = 1162/1978 (58.75%), Query Frame = 1
Query:  889 WLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMI------------YYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKT----------------------------QARSAKI---QADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVM-EYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFL-LKEKFKNDD-HILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE---------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKS----VSAGGQVSVQIHLA--RDEDNISSVYANN----------------------------FPYKREESWWLVVGEPNQGHLISIKLLS--SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            +L  TL K  T+    +     + ++L  AK+  EL+++L  ++G +  DL+  L +N++ I            +   +  C +   E +K     +   +S +    ++   R+E  + A R +K                              AR+A I   Q D+E E       Y S      +   F  G+ ++      LP+G  R+    Y  V +P  +P P+  +E  V I DL    + AF+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H +  G I+K++FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  LS+ EI  TQ++V TPEKWD+++RKS  +   +Q+VKLLI+DE+HLLH++RGPVLE+IVART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+ + GLF FD  +RPVP+ Q +LGI     ++++  M+++ YE V+ +    HQV++FVH+R  TV TA ++ E+  N   +  FL  +        + + K +N  +++L   GF++HHAG+   DRN VE LF++ HI+VLV T+TLAWGVNLPAH V+IKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G GI+IT  ++L++YLSLL +Q PIESQ +  LADNLNAEI +GTV N+ E++ W+ YTYLY+RMR NP  YG+ +     DPTL  H   L+      L+KA+MI F++R+G F S ++GR A+++Y    T++   +       + ++F + SK  EF  I VREE+  E+  LL N   +    G E+   KIN LLQ YIS+ +++ F+L SD+AY++Q+AAR++RA+FE+ L K+W ++T  +L   K +++R+W  + PLRQF  +P  I  +LE+KN+  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V L I PDF W  + HG+  + +WI+VED  +++I H EYFL LK++  N +  +L F + I++PLP  YYIRAVSD+W+G E    I F +++LPE++ P TELLDLQ LP  AL  + YE++Y+   S FN +QTQ F +LY++D NV +GAPTGSGKTV AE+AI R+F+    ++ VY+  L  L + R  +W ++    LGK VI+LTG+   D KSI+KA +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS  E P+RI+GLS +L NARD+ +WL+      +NF PSVR  PL++ IQ F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +   +  + +  L  TL+ G+G  H  L   +R  + ELF +  +Q+L+ + TL W +   A+LVI+  T+ Y+GK   Y D+   D++QM+GRA     DD  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YY+L  VS   ++  LS L+  +L++LE S CI + +D+  +  +  G IA++YY+ + T++MF   LKP      LL ++ +A E+ DLP+RH ED     + + L + ++       P TKA++LLQA+LSR  +   +   D   +L +++R+ QA +DV +S  WL   L    L QM+ Q +W +DS L  IP+  +                           P+L+  CE  G   VF  M +E E + A       K +    F    P I++   V  S    V    ++S+    A  RDE+    ++A+                             FP  ++E W+L++GE ++  L+++K +         S++F  P   G Y +TLY MSD YLG DQ+Y   +NV+
Sbjct:  230 YLNATL-KEMTEAARVEDLCCTLYDMLASAKSGDELQDELFELLGPEGLDLIEKLLQNRITIVDRFLNSSSDHKFQVLQDSCKKILGENSKPNYGCQVTIQSEQEKQLMKQYRREEKRI-ARREKKAGEDGEVSGEGVLPFDPKELRIQREHALLNARNAPILGRQRDVEFEKIRYPHVYDS-QAQARETSAFIAGAKMI------LPEGIQRENTKLYEEVRIPYGEPMPVGFEEKPVYIKDLDEVGQLAFKGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTILHEIRQHFH-QGVIKKNEFKIVYVAPMKALAAEMTNYFSKRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPYIGLFYFDGRFRPVPLGQTFLGIKSTNKMQQLNNMDEVCYESVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNSGQISCFLPTEGPEYGHALKQVQKSRNKQVRELFSDGFSIHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIKGTQIYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLSLLTQQNPIESQFLESLADNLNAEIALGTVTNVEEAVRWMSYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLLIEVGQKLDKAKMIRFEERTGYFSSTDLGRTASHFYIKYNTIETFNELFDAHKTEGDIFAIVSKAEEFDQIKVREEEIEELDALLNNFCELSAPGGVENSYGKINILLQTYISRGEMDSFSLISDSAYVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSVLPPHILTRLEEKNLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRVSLNIHPDFSWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVINKEAQLLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYEALYN--FSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPTSKAVYIAPLKALVRERMDDWKIRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQNRSYVQQVNILIIDEIHLLGEE-RGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEQEMDNIIGTVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIAGGTITSKQDAMDYITWTYFFRRLIMNPSYYSLGDVSQDSINKFLSHLIGQSLVELELSHCIEVGEDNRTIEPLTCGRIASYYYLKHKTVKMFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHTNNELAKCLPIELNP-HSFDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAASQGWLVTVLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWKPPVKSSHAKCRTSIECLPELIHACE--GKDHVFSSM-VEKELQPA-------KTKQAWNFLSRLPVINVGISVKGSWDDLVEGHNELSISTLTADKRDENKWIKLHADQEYVLQVSLQRVHFGLPKGKHENHAVTPRFPKLKDEGWFLILGEVDKRELMAVKRVGFVRTHHDASISFFTPETPGRYIFTLYLMSDCYLGLDQQYDIYLNVI 2181          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 340.117 bits (871), Expect = 1.271e-94
Identity = 254/815 (31.17%), Postives = 422/815 (51.78%), Query Frame = 1
Query: 1468 NLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTYTQLVKX-XXXXXXXXXXXXRGPVLEAIVARTMRAMQS------SHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGL-FKFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGD--IEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAM--FEVTLSKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTIT---------------PDFEWCPKSHGSSQGFWIFVEDVMSENIL 3795
            +L  + ++P+  +  F++    N IQSK +   L +D N ++CAPTG+GKT V  L + R +      +  +   + KIVY+AP+K+L ++  + + E+     L    L+GD+ +    EI    II+ TPEKWD ++RK  + ++ QLV+L LI +   +  + RGP LE +V+R M+ +QS      S S + +R V +SAT+PN EDIAE++   +   +  K D S+RPV +++  LG    + +   K    +N  VY  +  Y+ +   L+F  +RK     A       L +D   +   ++K   L LQ+    +++  LKD L YG   HHAG+  +DR  VE LFT   + VL +TSTLA G+N+PAH+V+IK T  Y    G + E S  D++QM GRAGRPQ+DT    +++T  +    Y+ +L     +ES L   L ++LNAEIV+ T+ +++ ++DW+R T LYIR  KNPS YG  + L  D  ++   + L       L   ++I  D+    F   E GR+ A+YY T ET   +KKF   S  +  +++  + S C EF ++ +R  +K  +  L ++     +  P+ E  +    K+NCL+QA +  + ++ F L+ DT  I ++ +R+ R +  F     KK+A L  SV+ + K  + ++W  S  + +Q  K+   ++  +    +  F ++ +    EL  ++N H   G  I + +  +PK  L++  Q    S +K E+ +T               PDF +     G +    +F   +M   +L
Sbjct:  259 SLKAVTEIPAKFRNIFKEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLL-----MEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSR-MKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSSQTEFKFDLALNYKVYSVIRTYSDQKPTLVFCSTRKGVQQAASV-----LVKDAKFIISVEQK---LRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHY--SGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDTVESSLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKD-GIEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFET---VKKFCAISGKETLLDLISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARWLSDFVAAQEKKFAVLLNSVILT-KCFKCKLWENSKHVSKQLDKIGISLSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVE-QIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYATLIIGDADNQVVFKHKIMDSVLL 1050          

HSP 2 Score: 297.36 bits (760), Expect = 5.560e-81
Identity = 196/646 (30.34%), Postives = 330/646 (51.08%), Query Frame = 1
Query: 4060 KKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQ----DARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNK-SISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSR-------TRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIE--IQTFNITHNATRLA---AMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAI-VSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNL-KGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQ-----SLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAME 5922
            K+  +FN IQ++ F+ L  +D N  I APTGSGKTV  E+AI RL         + + VY+  +  L   R+ +W + FG +G    +LTG+T MD+   I  A+II++T E WD ++R+W+    IQ ++LF++D++H+I  ++ G TLEV+ SR       +R + S    P+R + +S ++ NA D+ EWL               HRP+ ++  +  F  + + T      A++  VY  I   S   P +VF  T K  ++ A +L    + D K      + + + +   +I +  L +TL  GVG+ H  + +++R L+  LF+S  + +L  + TL   +   A+LV++  T  Y+G   ++++YS  D++QM+GRA     D  A +VIM + + ++   + L     +ES L   L +H NAEIV  TI +   A+D++  T LY R  +NP++Y    G++   +   L EL    L DL +   I + +D++      G +  +YYI + T++ F  ++     +  L+ +I +  EF D+ LR  E  IL  + +     ++R P++E  R+     K N L+QA L  +PI+   L +D  +I     R+           RWL   +AA E
Sbjct:  275 KEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLLMEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSRMKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSSQTEFKFDLALNYKVYSVIRTYSDQKPTLVFCSTRKGVQQAASVL----VKDAKFIISVEQKLRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGG--VFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDTVESSLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKDGIEAKLQELCLKNLKDLSSLDLIKMDEDVNFKPTEAGRLMAWYYITFETVKKF-CAISGKETLLDLISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAE--RIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIA----------RWLSDFVAAQE 901          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 340.117 bits (871), Expect = 1.271e-94
Identity = 254/815 (31.17%), Postives = 422/815 (51.78%), Query Frame = 1
Query: 1468 NLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTYTQLVKX-XXXXXXXXXXXXRGPVLEAIVARTMRAMQS------SHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGL-FKFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGD--IEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAM--FEVTLSKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTIT---------------PDFEWCPKSHGSSQGFWIFVEDVMSENIL 3795
            +L  + ++P+  +  F++    N IQSK +   L +D N ++CAPTG+GKT V  L + R +      +  +   + KIVY+AP+K+L ++  + + E+     L    L+GD+ +    EI    II+ TPEKWD ++RK  + ++ QLV+L LI +   +  + RGP LE +V+R M+ +QS      S S + +R V +SAT+PN EDIAE++   +   +  K D S+RPV +++  LG    + +   K    +N  VY  +  Y+ +   L+F  +RK     A       L +D   +   ++K   L LQ+    +++  LKD L YG   HHAG+  +DR  VE LFT   + VL +TSTLA G+N+PAH+V+IK T  Y    G + E S  D++QM GRAGRPQ+DT    +++T  +    Y+ +L     +ES L   L ++LNAEIV+ T+ +++ ++DW+R T LYIR  KNPS YG  + L  D  ++   + L       L   ++I  D+    F   E GR+ A+YY T ET   +KKF   S  +  +++  + S C EF ++ +R  +K  +  L ++     +  P+ E  +    K+NCL+QA +  + ++ F L+ DT  I ++ +R+ R +  F     KK+A L  SV+ + K  + ++W  S  + +Q  K+   ++  +    +  F ++ +    EL  ++N H   G  I + +  +PK  L++  Q    S +K E+ +T               PDF +     G +    +F   +M   +L
Sbjct:  259 SLKAVTEIPAKFRNIFKEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLL-----MEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSR-MKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSSQTEFKFDLALNYKVYSVIRTYSDQKPTLVFCSTRKGVQQAASV-----LVKDAKFIISVEQK---LRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHY--SGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDTVESSLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKD-GIEAKLQELCLKNLKDLSSLDLIKMDEDVN-FKPTEAGRLMAWYYITFET---VKKFCAISGKETLLDLISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAERIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIARWLSDFVAAQEKKFAVLLNSVILT-KCFKCKLWENSKHVSKQLDKIGISLSNTMVNAGLTSFKKIEEANARELELILNRHPPFGTQIKEAVAHLPKYELEVE-QIARYSDIKAEILVTIILRNFEQLQTKRTAPDFHYATLIIGDADNQVVFKHKIMDSVLL 1050          

HSP 2 Score: 297.36 bits (760), Expect = 5.560e-81
Identity = 196/646 (30.34%), Postives = 330/646 (51.08%), Query Frame = 1
Query: 4060 KKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQ----DARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNK-SISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSR-------TRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIE--IQTFNITHNATRLA---AMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAI-VSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNL-KGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQ-----SLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAME 5922
            K+  +FN IQ++ F+ L  +D N  I APTGSGKTV  E+AI RL         + + VY+  +  L   R+ +W + FG +G    +LTG+T MD+   I  A+II++T E WD ++R+W+    IQ ++LF++D++H+I  ++ G TLEV+ SR       +R + S    P+R + +S ++ NA D+ EWL               HRP+ ++  +  F  + + T      A++  VY  I   S   P +VF  T K  ++ A +L    + D K      + + + +   +I +  L +TL  GVG+ H  + +++R L+  LF+S  + +L  + TL   +   A+LV++  T  Y+G   ++++YS  D++QM+GRA     D  A +VIM + + ++   + L     +ES L   L +H NAEIV  TI +   A+D++  T LY R  +NP++Y    G++   +   L EL    L DL +   I + +D++      G +  +YYI + T++ F  ++     +  L+ +I +  EF D+ LR  E  IL  + +     ++R P++E  R+     K N L+QA L  +PI+   L +D  +I     R+           RWL   +AA E
Sbjct:  275 KEFPYFNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLLMEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSRMKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLGFPCSSSQTEFKFDLALNYKVYSVIRTYSDQKPTLVFCSTRKGVQQAASVL----VKDAKFIISVEQKLRLQKSAYSIRDSKLKDTLVYGVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGG--VFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDTVESSLHRHLIEHLNAEIVLHTITDVNIALDWIRSTMLYIRALKNPSHYGFSSGLNKDGIEAKLQELCLKNLKDLSSLDLIKMDEDVNFKPTEAGRLMAWYYITFETVKKF-CAISGKETLLDLISMISSCNEFLDVQLRISEKRILNTLNKDPNRITIRFPMAE--RIKTREMKVNCLIQAQLGCIPIQDFALTQDTVKIFRNGSRIA----------RWLSDFVAAQE 901          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Match: Polq (polymerase (DNA directed), theta [Source:MGI Symbol;Acc:MGI:2155399])

HSP 1 Score: 123.25 bits (308), Expect = 2.922e-27
Identity = 131/461 (28.42%), Postives = 216/461 (46.85%), Query Frame = 1
Query: 1579 ENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWD-IISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVAR---------TMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPM-EQEYLG----------INERKAVKRIELMND----LVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKC--LNRDTLGLFLRDKKASTLVLQQDL----DKVKNHD------LKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQL-PIESQLISKLADNLNAEIVMGTVRNIHESI 2847
            +N++  APT AGKT VA L +++ + +        RK   K ++I P  S+  E         +   LKV    G +  + +  +   I VCT E+ + +++R   E     L  +++ +   L    RG +LE ++ +         + +A  +S  +  ++IVG+SATLPN + +A +++ +    L+  D  +RPVP+ E   +G          + E + + +++   D    L YE + +    H VLIF  S+K     A  I  +   L+    GL    +    ++ Q+ L    D++K         LK+ +P+G A HHAGL + +R+ +E  F    I+VL +TSTL+ GVNLPA  VII+ T ++         L  L   QM GRAGR   DT G  I++   +E +  ++LL   L P+ S L          E+    +R I E I
Sbjct:  108 KNLVYSAPTSAGKTLVAELLILKRVLE-------TRK---KALFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTSPTGQ-FSSLDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYVTRKSASHQAESASTLSNAVQIVGMSATLPNLQLVASWLNAE----LYHTD--FRPVPLLESIKIGNSIYDSSMKLVREFQPLLQVKGDEDHIVSLCYETIQD---NHSVLIFCPSKKWCEKVADIIAREFYNLHHQPEGLVKSSEFPPVILDQKSLLEVMDQLKRSPSGLDSVLKNTVPWGVAFHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIR-TPIF-----SGQPLDILTYKQMVGRAGRKGVDTMGESILVCKNSEKSKGIALLQGSLEPVHSCL------QRQGEVTASMIRAILEII 536          

HSP 2 Score: 98.2117 bits (243), Expect = 1.230e-19
Identity = 116/467 (24.84%), Postives = 210/467 (44.97%), Query Frame = 1
Query: 4123 ENVFIGAPTGSGKTVCAEIAIM-RLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYM-----------SSQLETPIRIIGLSYSLTNARDVGEWLDC--HHTATYNFNPSVRHRPLDIEIQTFNITHNAT-RLAAMSKPVYQT------ILKL-----SPNSPVIVFVPTMKQTEEIAFLLMG--YALSDK-KNFGRASE------------AIVSEYMRNIS--NEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPL-PLESHLDHQLHDHFNAEIVTKTIE--------NKQDAVDYLTWTFL 5364
            +N+   APT +GKT+ AE+ I+ R+   R+ A  +++     +A+ +       F  +G  V    G+T+   +  S   I V T E  + L  R  ++  +  + + +VD+LH++G  H G  LE++ ++  Y+           +S L   ++I+G+S +L N + V  WL+   +HT   +F P     PL   I+  N  ++++ +L    +P+ Q       I+ L       N  V++F P+ K  E++A ++    Y L  + +   ++SE             ++ +  R+ S  + +L  T+  GV F H  L+  ER+++   F    I++L  + TL   +   A  VI+  T +++G+      Y      QMVGRA    +D    S+++C+ ++K      L   L P+ S L  Q      A ++   +E          QD   Y   TFL
Sbjct:  108 KNLVYSAPTSAGKTLVAELLILKRVLETRKKA--LFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTSPTGQ-FSSLDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYVTRKSASHQAESASTLSNAVQIVGMSATLPNLQLVASWLNAELYHT---DFRPV----PLLESIKIGNSIYDSSMKLVREFQPLLQVKGDEDHIVSLCYETIQDNHSVLIFCPSKKWCEKVADIIAREFYNLHHQPEGLVKSSEFPPVILDQKSLLEVMDQLKRSPSGLDSVLKNTVPWGVAFHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIR-TPIFSGQPLDILTYK-----QMVGRAGRKGVDTMGESILVCKNSEKSKGIALLQGSLEPVHSCLQRQ--GEVTASMIRAILEIIVGGVASTSQDMQTYAACTFL 556          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Match: sp|O75643|U520_HUMAN (U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2)

HSP 1 Score: 2326.59 bits (6028), Expect = 0.000e+0
Identity = 1173/2156 (54.41%), Postives = 1570/2156 (72.82%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER+K    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+I+DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  Y +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QNI LF+VD++HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I K SP  PVIVFVP+ KQT   A  ++    +D  ++ F   +E  +  Y+  +S+  L ETL  GVG++HE LS  ER L+ +LFSS +IQ++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH +HDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVE TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV++VFD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV    S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G++ YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEH-IKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP-ATGAHNYTLYFMSDAYMGCDQEYKFSVDV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Match: sp|Q6P4T2|U520_MOUSE (U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus OX=10090 GN=Snrnp200 PE=1 SV=1)

HSP 1 Score: 2325.44 bits (6025), Expect = 0.000e+0
Identity = 1171/2156 (54.31%), Postives = 1569/2156 (72.77%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER++    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+++DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  Y +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QNI LF+VD++HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I K SP  PVIVFVP+ KQT   A  ++    +D  ++ F   +E  +  Y+  +S+  L ETL  GVG++HE LS  ER L+ +LFSS +IQ++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH +HDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVE TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV++VFD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV    S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDMNKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRREIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEKERIVGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIVLDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEH-IKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP-ATGGHNYTLYFMSDAYMGCDQEYKFSVDV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Match: sp|F1LNJ2|U520_RAT (U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus OX=10116 GN=Snrnp200 PE=1 SV=1)

HSP 1 Score: 2321.58 bits (6015), Expect = 0.000e+0
Identity = 1171/2159 (54.24%), Postives = 1570/2159 (72.72%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISN-YGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKS---HGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  +MG +  + KP   EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L DKER++    LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  G EA    TL+ +  A+G +                      +  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR++++MI YCT L  +Q+  E+ +I  +M+ DP+ ++ L  L   + KED++  ER+R+ + R +++  D+E  D +          +LDL+++ FTQGSH M NK C+LPDGSFR+ + GY  V VPA KPKP  ++E L+ +  LP Y +A FE  KTLNRIQSK+Y+ ALE+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL +Y + VA L+GD  L +EEI+ TQIIVCTPEKWDII+RK  E+TYTQLV+L+++DEIHLLHD+RGPVLEA+VAR +R ++ +    D+R++GLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF DKHIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++SKL D LNAEIV+G V+N  ++++WL Y YLYIRM ++P+LYG+  + L  DP LD    +L++TAA +L+K  ++ +DK++G F   E+GRIA++YY TN+T+    + LK ++ +IE+F+VFS  +EF+NITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   L  CK +++RMW   CPLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+H  PKL L +HLQPITRST+KVELTITPDF+W  K+   HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+     + RCVY+T +  LA+  Y +W + F   L K V+ LTG T+ D K + K +II+ST E WD+LSRRWK++K +QNI LF+VD++HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  T+T+NF+P+VR  PL++ IQ FNI+H  TRL +M+KPVY  I K SP  PVIVFVP+ KQT   A  ++    +D  ++ F   +E  +  Y+  +S+  L ETL  GVG++HE LS  ER L+ +LFSS +IQ++V S +LCW +   A+LVI+MDTQ YNGK   Y DY   D++QMVG AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH +HDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVE TL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +KVR L+E+I NA E+E++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV++VFD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV    S+ +GG V V + L R+E+    V A  FP KREE WW+V+G+     LISIK L+     KV L+F AP  +G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKLRDKERRREIDLLLGQT-DDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMS--------------------SKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETE-KEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIVLDEIHLLHDDRGPVLEALVARAIRNIEMTQE--DVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKARLVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEH-IKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP-ATGGHNYTLYFMSDAYMGCDQEYKFSVDV 2129          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Match: sp|Q9VUV9|U520_DROME (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=l(3)72Ab PE=2 SV=4)

HSP 1 Score: 2276.13 bits (5897), Expect = 0.000e+0
Identity = 1152/2165 (53.21%), Postives = 1556/2165 (71.87%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDY---------KAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSV--DMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVIL----TRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR +Q+EYK NSNLVL AD  LI+R  +DE TGEV   +  +D  +MG R  + KP+  EE++ KR KRD++    +  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  L D+ERKK    LLG  +TD ++  LV+L  K+TD+          AP     E  D+T  ++++ ++ +EE ++D+YGE++D ++ D G EA  + TL+    A    +                   N+     L+  DIDA+WLQR LSK + D    Q +  D+L++LK A +D++ EN+L+ ++G D FD ++ L+ N+ M+ YCT L  +QT  ER +I  +M+ +    +IL       R+ D   +E   + +AR +K       +     +   +    +L+L+ + FTQGSH M NK C+LPDGS+RK + GY  V VPA KP P +A+E L  +  LP YV+  FE  KTLNRIQS++YK AL+SDEN+LLCAPTGAGKTNVALLTMMREIGKHIN DGTI   DFKI+Y+APMKSLV EM  +F  RL  YNL V+ L+GD  L+RE+I  TQ+IVCTPEKWDII+RK  E+T+  LV+L+IIDEIHLLHDERGPVLEA+VART+R ++++   +  R+VGLSATLPN +D+A F+ V   +GLF FD+SYRPV +EQ+Y+G+ E+KA+KR ++MN++VYEK ME+AG++QVL+FVHSRKET  TA+A+++ CL +DTLG FL++  AS  VL+ + ++VKN +LK+LLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG W ELSALDV+QM GRAGRPQYDTKG GI+ITN +EL +YLSLLN+QLPIESQ ISKL D LNAEIV+GTV+++ ++++WL YTYLYIRM +NP+LYGV +  I  DP L+ H  +L++TAA  LE++ +I +D+++G F   ++GRIA++YY T+ETM    + LK+++ +IE+F+VFS  +EFR+I+VREE+K+E++KL+E VP+PIKE  E+   K+N LLQAYISQLKLE F L SD  +I+QSAARLMRA+FE+ L++ WA L    L  CK +++RMW    PLRQFKK+P EI KKLEKK+ P+ RL D + HELGEL+   K+GKTI+K++HQ PKL L  H+QPITR T++VELTITPDF+W  K HG S+GFW+ +EDV SE ILH+E+FLLK+K+  D+H LKF+V +++PLPP Y++R VSD+WIG ET++ + F +++LPEKN P TELLDLQ LP  ALR  ++ES YS++   FN IQTQ F ++YNSDENVF+GAPTGSGK   AE AIMRLF+ + DARCVY+ +   LA L + +W   FG+L   V+KLTG T  D K I+K  ++++TA+ WDVLSRRWK++K +Q + LFIVD+L L+G +  G  LE++CSR RY+SSQ+E  IRI+ LS SLT+ARDV +WL C+  AT+NF+PSVR  PL++ IQ +N+THNATR+A MSKPVY  ILK S + PVIVFV + KQ    A  ++ YA SD +   F  A E  +  ++  ++++ L ETL+ GV ++HE LS ++  L+ +LF S ++Q+ V+S  LCW +   A+LVI+MDTQ YNGK+  Y+DY   D++QM+GRAN  + D DA+ V+MCQ++KKDF +KF++EPLP+ESHLDH++HDHFNAE+VTKTIENKQDAVDYLTWTFLY R+T+NPNYYNL+GV+HRHLSDHLSELVENTL DLE SKCI+++DD+D   +NLGMIA +YYI+YTTIE+FSLSL   +KVR LLE+I +A E+ED+ +RH E+ +L     R+   L  P     + +DP  K N+LLQA+LSR+ +   EL+ D  QIL K++RLIQACVDVLSSN WL PA+AAMELAQM+TQA W +DS LKQ+PHF+ P++++RC    ++TVFD+MELEDE +  L+   D ++ DVARF   YPNI+L YEV     +++G  V+V + L R+++    V A  FP KREE WW+V+G+P    L+SIK L+     KV L+F AP   G ++YTLY+MSDSYLGCDQEY+F+I V
Sbjct:    1 MADAAARQLQYEYKANSNLVLQADVRLIERPRRDEATGEVCSLVGKLDGTRMGDRYQRTKPEKTEERKVKRQKRDEAQYDFERMKGATLLSEGIDEMVGIVYRPKTQETRQTYEVLLSFIQEALGDQP-RDILCGAADEILAVLKNDRLKDRERKKDIDSLLGA-VTDERFALLVNLGKKITDFGSDAVNALTAAPN--NEEQIDETYGINVQFEESEEESDNDMYGEIRDDDAQDEGEEARIDHTLHAENLANEEAA------------------NNVKKERSLHPLDIDAYWLQRCLSKFYKDAMVSQSKAADVLKILKDAADDRDCENQLVLLLGYDCFDFIKQLKLNRQMVLYCTMLASAQTDSERQRIREKMRGNSALAKIL-------RQLDTGKSEDQEEGEARGSKRGKGDAEDGGAAAAGQVAGVRQLLELEEMAFTQGSHFMANKRCQLPDGSYRKQRKGYEEVHVPALKPVPFDANEELQPVDKLPKYVQPVFEGFKTLNRIQSRLYKAALDSDENMLLCAPTGAGKTNVALLTMMREIGKHINEDGTINAQDFKIIYVAPMKSLVQEMVGNFGRRLACYNLTVSELTGDHQLTREQIAATQVIVCTPEKWDIITRKGGERTFVSLVRLVIIDEIHLLHDERGPVLEALVARTIRNIETTQEEV--RLVGLSATLPNYQDVATFLRVKPDKGLFYFDNSYRPVSLEQQYIGVTEKKALKRFQVMNEIVYEKTMEHAGRNQVLVFVHSRKETGKTARAVRDMCLEQDTLGSFLKEGSASMEVLRTEAEQVKNTELKELLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELSALDVLQMLGRAGRPQYDTKGEGILITNHSELQFYLSLLNQQLPIESQFISKLPDMLNAEIVLGTVQHLQDAVNWLGYTYLYIRMLRNPTLYGVSHDAIKADPLLEQHRADLLHTAACCLERSGLIKYDRKTGHFQVTDLGRIASHYYLTHETMLTYNQLLKQTLSEIELFRVFSLSSEFRHISVREEEKLELQKLMERVPIPIKESIEEHSAKVNVLLQAYISQLKLEGFALMSDMVFITQSAARLMRAIFEIVLTRGWAQLADKTLTLCKMIDRRMWQSMTPLRQFKKMPDEIAKKLEKKHFPWGRLYDLEPHELGELIRVPKLGKTIHKFVHQFPKLELSTHIQPITRGTLRVELTITPDFQWDEKVHGQSEGFWVLIEDVDSELILHHEFFLLKQKYSQDEHQLKFFVPVFEPLPPQYFLRIVSDRWIGAETQLPVSFRHLILPEKNMPPTELLDLQPLPISALRQPKFESFYSQRFPQFNPIQTQVFNAVYNSDENVFVGAPTGSGKMTIAEFAIMRLFTTQSDARCVYLVSEEALADLVFADWHSKFGSLDIKVVKLTGETGTDLKLIAKGQLVITTADKWDVLSRRWKQRKNVQLVNLFIVDELQLVGGE-EGPVLEIVCSRMRYISSQIEKQIRIVALSASLTDARDVAQWLGCNPNATFNFHPSVRPIPLELHIQGYNVTHNATRIATMSKPVYNAILKYSAHKPVIVFVSSRKQARLTAIDVLTYAASDLQPNRFFHAEEEDIKPFLERMTDKTLKETLAQGVAYLHEGLSASDHRLVEQLFDSGAVQVAVISRDLCWGMSISAHLVIIMDTQFYNGKNHSYEDYPITDVLQMIGRANRPNEDADAKCVLMCQSSKKDFFKKFINEPLPIESHLDHRMHDHFNAEVVTKTIENKQDAVDYLTWTFLYRRLTQNPNYYNLQGVTHRHLSDHLSELVENTLSDLEQSKCISVEDDMDTLPLNLGMIAAYYYINYTTIELFSLSLNSKTKVRGLLEIISSAAEYEDVVVRHHEEQVLRTLSQRLPNKLTGPNETAPKFNDPHIKTNLLLQAHLSRLQL-GPELQGDTEQILSKAIRLIQACVDVLSSNGWLSPAVAAMELAQMVTQAMWSKDSYLKQLPHFS-PEIVKRCTEKKIETVFDIMELEDEDRTRLLQLSDLQMADVARFCNRYPNIELNYEVVDKDRINSGSTVNVVVQLEREDEVTGPVIAPFFPQKREEGWWVVIGDPKTNSLLSIKRLTLQQKAKVKLDFVAP-SPGKHDYTLYYMSDSYLGCDQEYKFSIEV 2130          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Match: sp|Q9U2G0|U520_CAEEL (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans OX=6239 GN=snrp-200 PE=3 SV=1)

HSP 1 Score: 2080.45 bits (5389), Expect = 0.000e+0
Identity = 1070/2162 (49.49%), Postives = 1503/2162 (69.52%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKKM--GARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLI-DDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKK-MSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL----KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDK--KNFGRASEA--IVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPIS-EDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKS-VSAGGQVSVQIHLARDEDN---ISSVYANNFPYKR-EESWWLVVGEPNQGHLISIK-LLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD +AR  Q+EY+ NSNLVL+ D  L DRR ++EPTGEVLPI D + +KM  G R +K K       QD++ KR + +     Q   +VL  D  +    Y P+T ETK  YE +L+ + + L +     +     DE+L+ LKN    DKE+KK  + LLG  LTD +   L++LS K++D+   +           +   E D D  E E        D E DDGG+  +              +      +  L   G+L + +  A    L+  DIDA W+QR+L+K+F DP   Q++  +++ +LK A +D++ EN+L+ ++G D+F+ ++ LR+N+LMI YCT L      +ER +IE +M++ P+ + ILA L+  D +  +V  E++++   +S K  A    E  +         MLDL ++TF+QGSHLM+NK CELPDGS+R+ K  Y  + VPA KP+P    E LV +++LP + + AF+  K+LNRIQS++  +AL S E++LLCAPTGAGKTNVALLTM++EIG H+  DG+++ D+FKIVYIAPMKSLV EM  SFS+RL  + + V  ++GD+ +S+E+   TQ+IVCTPEK+D+++RK  E+ Y Q+V+LLIIDEIHLLHD+RGPVLE+IV RT+R M+ +H   + R+VGLSATLPN +D+A F+ V K   L  FD+SYRPVP+EQ+Y+G+ E+KA+KR + MN++VY+K+ME+AGK QVL+FVHSRKET  TAKAI++ CL +DTL  F+R+  AST +L+ + ++ KN DLKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVL ST+TLAWGVNLPAH VIIKGTQ+Y P+KG WTEL ALD+MQM GRAGRPQYD +G GI+ITN +EL YYLSL+N+QLP+ESQ++S+L D LNAE+V+GTV ++ E+ +WL YT+L++RM KNP+LYG+ +     DP L+    +LI+TA  +L+KA +I +DKRSG   + E+GRIA+++YCT E+M    K L ++  DI++F++FS  +EF+ ++VR+E+K+E++K+ E+ P+PIKE  ++   K N LLQAYISQLKLE F L +D  +++QSA RL RA+FE+ L + WA L   VL  CK V QR W    PL QFKK+P E+ + ++KKN  FDRL D   H+LG+L+   KMGK ++K+I Q PKL +   +QPITR+TM++ELTITPDF+W  K HGS++GFWIF+ED   E ILH+E+FLLK+KF +D+H++K  V ++DP+PPLYY+R VSD+WIG ET + I F +++LPEK  P TELLDLQ LP  A+ N+E+++++++     FN IQTQ F +++ S+ENV + AP GSGKT  AE+A++R F N  +A+ VY+T + D+A   Y +W +    A+G T++ LTG   MD K   +  +I+ST E WD +SRRWK++K++QN++LFI DDLH+IG+  NG   EV+CSRTRY+SSQLE+ +R++ LS SLTNARD+G WL C  +AT+NF PS R  PLD+EI++FN++HNA+R AAM +PVYQ I     KL P  P +VFVP  +QT  +A  L+  AL+D   K F R +E        + +I +E L E++SCGVGF+HE  +  + +++ +LF S +IQ+ VV   +C+ I   AYLV+VMDTQ YNGK  +Y+DY   D++ MVG AN   +D DA+ V+MCQT+K+ + +KFL +PLP+ESHLDH LHDHFNAEIVTKTIENKQDA+DYLTWT LY RMT+NPNYYNL+G +HRHLSD LSELVE TL DLENSKCIA+KD++D  ++NLGMIA++YYI Y TIE+FS+SLK  +K R L+E+I  ++EF ++P+RH EDVIL ++ +  RLP   ++++ +DP  K N+L+ A+LSRV +  AEL +D   I++++ RL+QACVDVLSSN WL PA+ AMEL+QM+TQA +  +  LKQ+PH +   LLER +A  V +VF+L+ELE++ +  ++     +L DVARF   YP+I++  E+    V++   + + + L RD D       V A  FP KR EE WWLV+G+     L++IK L+ +    V L+F APR  G +++ L+F+SDSYLG DQE+     V
Sbjct:    1 MADELARIQQYEYRQNSNLVLSVDYNLTDRRGREEPTGEVLPITDKEMRKMKMGDRAIKGKAPV----QDQKKKRKKKDDEKAQQFGRNVLV-DNNELMGAYKPRTQETKQTYEVILSFILDALGDVP-REVLCGAADEVLLTLKNDKFRDKEKKKEVEALLGP-LTDDRIAVLINLSKKISDFSIEE-----------ENKPEGDGDIYENEGVNVQFDSDEEEDDGGMVNEIKGDSEEESEEEEGVDT--DYTATLKGDGHLTEDEQKARG-ILHPRDIDAHWIQRSLAKYFKDPLIAQQKQTEVIGILKNAADDRDAENQLVLLLGFDQFEFIKCLRQNRLMILYCT-LLRQANEKERLQIEDDMRSRPELHPILALLQETD-EGSVVQVEKSKRDAEKSKK-AATAANEAISAGQWQAGRKMLDLNDLTFSQGSHLMSNKRCELPDGSYRRQKKSYEEIHVPALKPRPFAEGEKLVSVSELPKWAQPAFDGYKSLNRIQSRLCDSALRSKEHLLLCAPTGAGKTNVALLTMLQEIGNHLAEDGSVKLDEFKIVYIAPMKSLVQEMVGSFSKRLAPFGITVGEMTGDAQMSKEQFMATQVIVCTPEKYDVVTRKGGERAYNQMVRLLIIDEIHLLHDDRGPVLESIVVRTIRQMEQNHD--ECRLVGLSATLPNYQDVATFLRV-KPEHLHFFDNSYRPVPLEQQYIGVTEKKALKRFQAMNEVVYDKIMEHAGKSQVLVFVHSRKETAKTAKAIRDACLEKDTLSAFMREGSASTEILRTEAEQAKNLDLKDLLPYGFAIHHAGMNRVDRTLVEDLFADRHIQVLFSTATLAWGVNLPAHTVIIKGTQIYNPEKGRWTELGALDIMQMLGRAGRPQYDDRGEGILITNHSELQYYLSLMNQQLPVESQMVSRLTDMLNAEVVLGTVSSVSEATNWLGYTFLFVRMLKNPTLYGITHEQARADPLLEQRRADLIHTACVLLDKAGLIKYDKRSGIIQATELGRIASHFYCTYESMQTYNKLLVETCSDIDLFRIFSMSSEFKLLSVRDEEKLELQKMAEHAPIPIKENLDEASAKTNVLLQAYISQLKLEGFALQADMVFVAQSAGRLFRALFEIVLWRGWAGLAQKVLTLCKMVTQRQWGSLNPLHQFKKIPSEVVRSIDKKNYSFDRLYDLDQHQLGDLIKMPKMGKPLFKFIRQFPKLEMTTLIQPITRTTMRIELTITPDFKWDEKVHGSAEGFWIFIEDTDGEKILHHEFFLLKQKFCSDEHVVKMIVPMFDPMPPLYYVRIVSDRWIGAETVLPISFRHLILPEKYPPPTELLDLQPLPISAVTNKEFQTVFAESGFKVFNPIQTQVFRTVFESNENVIVCAPNGSGKTAIAELAVLRHFENTPEAKAVYITPMEDMATKVYADWKRRLEPAIGHTIVLLTGEQTMDLKLAQRGQLIISTPERWDNISRRWKQRKSVQNVKLFIADDLHMIGAS-NGAVFEVVCSRTRYISSQLESAVRVVALSSSLTNARDLGMWLGCSASATFNFMPSTRPVPLDLEIKSFNLSHNASRFAAMERPVYQAICRHAGKLEPK-PALVFVPVRRQTRPVAVALLTMALADGAPKRFLRLAEHDDTFQALLADIEDESLRESVSCGVGFLHEGTAPKDVHIVQQLFESNAIQVCVVPRGMCYQIEMSAYLVVVMDTQFYNGKYHVYEDYPIADMLHMVGLANRPILDSDAKCVVMCQTSKRAYYKKFLCDPLPVESHLDHCLHDHFNAEIVTKTIENKQDAIDYLTWTLLYRRMTQNPNYYNLQGTTHRHLSDALSELVELTLKDLENSKCIAVKDEMDTVSLNLGMIASYYYISYQTIELFSMSLKEKTKTRALIEIISASSEFGNVPMRHKEDVILRQLAE--RLPGQLKNQKFTDPHVKVNLLIHAHLSRVKL-TAELNKDTELIVLRACRLVQACVDVLSSNGWLSPAIHAMELSQMLTQAMYSNEPYLKQLPHCS-AALLERAKAKEVTSVFELLELENDDRSDILQMEGAELADVARFCNHYPSIEVATELENDVVTSNDNLMLAVSLERDNDIDGLAPPVVAPLFPQKRKEEGWWLVIGDSESNALLTIKRLVINEKSSVQLDFAAPR-PGHHKFKLFFISDSYLGADQEFDVAFKV 2128          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Match: A0A1S3IYW6 (U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Lingula unguis OX=7574 GN=LOC106168771 PE=4 SV=1)

HSP 1 Score: 2367.81 bits (6135), Expect = 0.000e+0
Identity = 1173/2154 (54.46%), Postives = 1593/2154 (73.96%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXX--XXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEK-LNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDA-RSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK--SVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR +Q+EYK NSNLVL  DR+LIDRR++DE TGEV+  +  +   KMG + ++ KP  MEE++ KR KRD++ R +   K +S+L+  + +     Y PKT ET+  YE +L+I+ + L +    ++     DE+L  LKN  + DKERKK  + LLG  + + ++  LV+L  K++D+ + +    +++ +T  ++++ D+ +EE+E+D       +  + DD GVEA  + TL  S    G                        A +EK L+  DIDAFWLQR+L K++ DP   Q +  ++LE+LK + +D+E EN+L+ ++G ++FD +++LR+++ MI +CT L  +Q+ EER KIE +M +D   ++IL  L+  D KED+V  ER R+   R  ++ AD+E  D++   + G+V +LDL+++ F  GSHLM NK C+LPDGSFRK + GY  V VPA KPKP E +E  V I  LP Y + AFE  K+LNRIQS++   ALESDEN+L+CAPTGAGKTNVALLT++REIGKHIN DGTI  D+FKI+Y+APM+SLV EM  SF++RL SY ++V+ LSGD  LSRE+I  TQ+IVCTPEKWDII+RK  ++ YTQLV+L+IIDEIHLLHDERGPVLE +V+RT+R ++++    D+R+VGLSATLPN ED+A F+ VD  +GLF FD+S+RPVP+EQ+Y+G+ E+KA+KR ++MND+VYEKVME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTL  FL++  AST +L+++ ++VKN +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG W EL ALDVMQM GRAGRPQYDTKG GI+ITN +EL YYLSL+N+QLPIESQ I+KLADNLNAE+V+GTV+ + +++ WL YTYLYIRM + P+LYG+  + L DDP L+   ++L++TAA +++K  ++ +DK+SG F   E+GRIA+YYYCTN++M    + LK ++ +IE+F+VFS  +EFRNITVREE+K+E+ KLLE VP+PIKE  E+P  K+N LLQAYISQLKLE F L +D  YI+QSA RLMRA+FE+ L + WA L    L  CK +++RMW    PLRQFKK+P E+ KK+EKKN P++R  D  H+E+GEL+   K+GKTI+KY+HQ PKL L +H+QPITRST+KVELTITPDF+W  K HG S+ FWI VEDV SE ILH+EYFLLK K+  D+HI+KF+V +++PLPP Y+IR VSD+WIG ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +E +Y +K  FFNAIQTQ F ++YN D+NVFIGAPTGSGKT+ AE AI+R+ +   + RCVYVT  + LA   Y +W   F   LGK V++LTG T  D K ++K +IIVST E WDVLSRRWK++K +QN+ LFIVD+LHLIG + +G  LEV+CSR RY+SSQ+E  IRI+ LS SL+NA+D+ +WL C  T T+NF+P+VR  PL++ IQ FNI+HNA+RL AM+KP YQ I + SP  P +VFVP+ KQT   A  ++ +A +D++   F    E  +  ++  ++++ L ET+S GV ++HE L+  ER ++ +LF+S +IQ++VVS +LCW++   ++LV+VMD+Q Y+GK   Y+DY   D++QMVGRAN  + DDA ++VI+CQ++KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTFLY RM +NPNYYNL+GVSHRHLSDHLSELVENTL DLE SKCI+I+D++DVS +NLGMIA +YYI+YTTIE+FS+SL   +K++ L+E+I NA E++ +P+RH E  IL ++   L   I+ + + +DP  K N+LLQA+LSR+ +  AEL+ D   IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF   ++++RC+   + TVFD+ME+ED+++  L++  + ++ DVARF   YPNI++TYEV +  +V +G  V+V + L R+++    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + Y LY+MSDSY+GCDQEY+F+I+V
Sbjct:    1 MADAAARQLQYEYKANSNLVLQVDRSLIDRRARDEATGEVMSLVGKLVGTKMGDKSMRTKPPQMEERKAKRRKRDEAQRDMLKMKGQSLLSEGIDEMVGILYRPKTPETRQTYEVLLSIMQSALGDQP-RDVLCGAADEVLAVLKNDRMKDKERKKEVEALLGE-MQEERFALLVNLGKKISDWGSEEKMQTDDSMETFGVNVQFDESEEEDEEDAFGEARGESEDEDDEGVEAHVDATLVSSLSVEGG-----------------------AKAEKELHPRDIDAFWLQRSLRKYYDDPMVAQAKAGEVLEILKSSSDDREAENQLVVLLGFNQFDFIKVLRQHRQMILFCTMLAQAQSQEERAKIEEKMSSDANLSKILHTLQETD-KEDLVREERERRQAKRQTRVDADLEAMDTDERQDVGNVQLLDLEDLVFGMGSHLMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPYENNETRVPIDRLPKYAQPAFEGFKSLNRIQSRLSNAALESDENLLVCAPTGAGKTNVALLTILREIGKHINPDGTINTDEFKIIYVAPMRSLVQEMTGSFTKRLSSYGIQVSELSGDHQLSREQIMATQVIVCTPEKWDIITRKGGDRIYTQLVRLMIIDEIHLLHDERGPVLECLVSRTIRNIETTQE--DVRLVGLSATLPNYEDVATFLRVDPEKGLFYFDNSFRPVPLEQQYVGVTEKKAIKRFQVMNDIVYEKVMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLSAFLKEGSASTEILRREAEQVKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELGALDVMQMMGRAGRPQYDTKGEGILITNHSELQYYLSLMNQQLPIESQFIAKLADNLNAEVVLGTVQTVKDAVQWLGYTYLYIRMLRAPTLYGIAHDDLKDDPWLEQRRKDLVHTAAMMIDKNNLMKYDKKSGHFQVTELGRIASYYYCTNDSMSTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELAKLLERVPIPIKESIEEPSAKVNVLLQAYISQLKLEGFALVADMVYITQSAGRLMRALFEIVLHRGWAQLADKALALCKMIDKRMWQSMSPLRQFKKIPEEVIKKIEKKNFPWERFYDLGHNEIGELIRMPKLGKTIHKYVHQFPKLELAVHIQPITRSTLKVELTITPDFQWEEKVHGHSEAFWILVEDVDSEVILHHEYFLLKNKYAQDEHIVKFFVPVFEPLPPQYFIRVVSDRWIGAETQLPVSFRHLILPEKVPPPTELLDLQPLPVSALRNPHFEQLYQEKFQFFNAIQTQVFNTVYNGDDNVFIGAPTGSGKTISAEFAILRMLTQSPEGRCVYVTPKDALADQIYADWHNKFALQLGKKVVQLTGETATDLKLLAKGNIIVSTPEKWDVLSRRWKQRKNVQNVNLFIVDELHLIGGE-DGPVLEVVCSRMRYISSQIERNIRIVALSSSLSNAKDIAQWLGCSTTGTFNFHPNVRPVPLELHIQGFNISHNASRLMAMAKPAYQAINRHSPKKPALVFVPSRKQTRLTAIDILTFAAADRQPSRFLHVKEEDLEPFLEKLTDKTLKETISNGVAYLHEGLTEVERRVVEQLFTSGAIQVVVVSRSLCWALQVVSHLVVVMDSQFYDGKIHAYEDYPVTDVLQMVGRANRPNEDDAGKAVILCQSSKKDFFKKFLYEPLPVESHLDHFLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMAQNPNYYNLQGVSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVSPLNLGMIAAYYYINYTTIELFSMSLNNKTKIKGLIEIISNAAEYDSIPIRHREANILKQLGSRLPNKIN-NPKYTDPHVKTNLLLQAHLSRMQL-PAELQSDTEDILTKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWGKDSYLKQLPHFT-AEIIKRCQEKNIDTVFDVMEMEDDERNTLLSLSETEMADVARFCNRYPNIEMTYEVEEKDNVKSGSPVNVAVTLEREDEIAGPVVAPFFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-SPGKHSYVLYYMSDSYMGCDQEYKFSIDV 2121          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Match: A0A087TVN5 (U5 small nuclear ribonucleoprotein helicase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_25475 PE=4 SV=1)

HSP 1 Score: 2343.15 bits (6071), Expect = 0.000e+0
Identity = 1179/2158 (54.63%), Postives = 1570/2158 (72.75%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNL-SDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSES---DDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEK-LNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMED--SNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPIS-EDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS--KSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++QFEYK NSNLVL AD  LI+RR +DE TGEV+  +  ++  +MG R  + KP   EEK+ KR+KRD+S       K +++L+  +       Y PKTAETK  YE +L+ +   L +    +I     DE+L  LKN  +  DK+R++  + LLG  L   +Y  LV+L  K+TDY           +      + +  ++ +EE++        E    ++ G EA  ++TL+ +   +                     Q  +  S K L+  DIDA+WLQR LSK + DP   Q R  ++LE+LK A +D+++EN+L+ ++G ++F+ +++LR+++  I YCT L   Q+  E+ K++ +M++DP+  +IL  L N + KEDI+  ER R+ Q R A++ AD+E  D     +       +LDL+++TF QGSH M NK C+LPDGSFRK + GY  + VPA KPKP E+ E+L+ I  LP YV+ AFE  K+LNRIQS++ KTALE+DEN+LLCAPTGAGKTNVALL MMREIGKHIN+DGTI  D+FKI+YIAPM+SLV EM  +FS+RLKSYN++V+ L+GD  L+RE+IN TQ+IVCTPEKWDI++RK  E+TYTQLV+L+I DEIHLLHDERGPVLEA+VART+R ++ +   +  R+VGLSATLPN ED+A F+ V +  GLF FD+S+RPVP+EQ+Y+GI E+K +KR  LM +++YEKVME+AGK+QVLIFVHSRKET  TA+ I++ CL +DTLG FLR   AST VL+ + D VKNH+LK+LLPYGFA+HHAG++  DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQ+Y P+KG W EL ALDV+QM GRAGRPQYDTKG GI+ITN +EL YYLSL N+QLPIESQLISKL D LNAEIV+G ++++ E++ WL YTYLYIRM ++P+LYGV+ V  +DP L+ H  +LIYTAA++L+K+ ++ FDK++G F   E+GRIA++YYCT ETM    + LK+++ +IE+F+VFS   EF+ + +REE+K+E++KL+E VP+PIKE  E+   K+N LLQAYISQLKLE   L +D  YI+QSA RLMRA+FE+ L + WA LT   L  CK +++RMW    PLRQFKK+P E+ KK+EKKN P++RL D   +E+GEL+   K+GKT++KY+HQ PKL+L  H+QP+TR+T++VELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK KF  D+HI+KF+V +++PLPP Y+IR VSD+WIG ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  +FN IQTQ F S+YNSD+NVF+GAPTGSGKT+CAE AI+RL S   D RCVYVT    LA++ Y +W   F   + K V+ LTG T+ D K ++K +II+ST E WDVLSRRWK+++ +QNI LFIVD+L LIG + +G  LEVICSR RY+SSQ E PIRI+ LS SL NA+DV +WL     +T+NF P+VR   L++ IQ FNITHNA+RL AMSKPVYQ I +LSP  PVIVFVP+ KQ+   A  ++ Y  S+ +   F   +++ +  ++  I ++ L ET+S GV ++HE L+ ++  ++ +LF S +IQ++VVS  LCW +   A+LV++MDTQ YNGK   Y+DYS  D++QMVGRAN    D D + V++CQ++KKDF  KFL+EPLP+ESHLDH LHDHFNAEIVTKTI+NKQDAVDYLTWTFLY RMT+NPNYYNL+GV+HRHLSDHLSELVENTL DLE S+CI+I+D++DVS +NLGMIA +YYI+YTTIE+FS+SL   +KVR LLE+I +A E+E +P+RH ED +L ++    RLP    + + SDP  K N+LLQA+LSR+ + +AEL+ D   IL K+VRLIQACVDVLSSN WL PALAAMELAQM+TQ  W++DS LKQ+PHF  P++++RC   GV+TVFD+MELEDE +  L+   D ++ DVARF   YPNI+L+YEV   +S+ +G  V+V + L R+++    V A  FP +REE WW+V+G+P    LISIK L+     KV L+F AP  +G + YTLYFMSDSY+GCDQEY+F I V
Sbjct:    1 MADAAARSLQFEYKANSNLVLQADTRLIERRPRDEATGEVVSLVGKLEGSRMGDRYQRTKPAKAEEKKAKRMKRDESRYDFSKLKGQTLLSEGIEDMVGILYRPKTAETKQTYEVLLSFIQEALGDQP-RDILCGAADEVLAVLKNEKIRDDKDRRRETEALLGQ-LAQERYAVLVNLCKKITDYGVDDKVQTTEENIDETYGVNVQFEESDEEEEDMCGEVREEDSNDENEGDEAIVDSTLHATNLDSS--------------------QDTMGKSGKSLHPRDIDAYWLQRKLSKFYDDPVVAQTRAGEVLEILKTAVDDRDVENQLVLLLGYNQFEFIKILRQHRQTILYCTLLASLQSGAEKTKLKEKMQSDPELEKILRQLENTE-KEDIIQEERERRAQVRQARVDADLEAMDIDGESVPQLQQCRVLDLEDLTFAQGSHFMANKRCQLPDGSFRKQRRGYEEIHVPALKPKPFESSESLMPIEKLPKYVQHAFEGYKSLNRIQSRLCKTALETDENLLLCAPTGAGKTNVALLCMMREIGKHINSDGTINADEFKIIYIAPMRSLVQEMVGNFSKRLKSYNIQVSELTGDHQLTREQINATQVIVCTPEKWDIVTRKGGERTYTQLVRLMIFDEIHLLHDERGPVLEALVARTIRNIEMTQEEV--RLVGLSATLPNYEDVASFLRVTQATGLFYFDNSFRPVPLEQQYIGITEKKPIKRFMLMKEILYEKVMEHAGKNQVLIFVHSRKETGKTAREIRDMCLEKDTLGQFLRGGSASTAVLETEADHVKNHELKNLLPYGFAIHHAGMSRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQIYSPEKGRWVELGALDVLQMLGRAGRPQYDTKGEGILITNHSELQYYLSLFNQQLPIESQLISKLPDMLNAEIVLGNIQSMKEAVTWLGYTYLYIRMLRSPALYGVQ-VNSEDPLLEKHRADLIYTAATLLDKSNLLKFDKKAGIFQVTEVGRIASHYYCTYETMTTYTQLLKQTLSEIELFRVFSLSGEFKYLNIREEEKLELQKLMERVPIPIKESIEESSAKVNVLLQAYISQLKLEGLALMADMVYITQSADRLMRAIFEIVLHRGWAQLTDKALSLCKMIKRRMWQSMTPLRQFKKIPDEVVKKIEKKNFPWERLYDLGPNEIGELLRMPKLGKTVHKYVHQFPKLDLSAHIQPVTRATLRVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKSKFCQDEHIVKFFVPVFEPLPPQYFIRIVSDQWIGSETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNPFFESLYKDKFPYFNPIQTQVFNSVYNSDDNVFVGAPTGSGKTICAEFAILRLLSQNPDGRCVYVTPKESLAEIIYADWTAKFSTVMNKKVVLLTGETSTDLKLLAKGNIIISTPEKWDVLSRRWKQRRNVQNINLFIVDELQLIGGE-DGPILEVICSRMRYISSQTEKPIRIVALSSSLANAKDVAQWLGASPNSTFNFPPNVRPVQLELHIQGFNITHNASRLLAMSKPVYQAITRLSPRKPVIVFVPSRKQSRLTAIDILTYCASEAQPARFLHCTDSDIQPFVDKIVDKTLKETISNGVAYLHEGLNSSDSKIIGQLFESGAIQVVVVSRNLCWGLSLAAHLVVIMDTQYYNGKIHTYEDYSITDVLQMVGRANRPKYDEDGKCVLLCQSSKKDFFTKFLYEPLPVESHLDHCLHDHFNAEIVTKTIDNKQDAVDYLTWTFLYRRMTQNPNYYNLQGVTHRHLSDHLSELVENTLNDLEQSRCISIEDEMDVSPLNLGMIAAYYYINYTTIELFSMSLNSKTKVRGLLEIISSAAEYEGVPIRHREDNLLKQLAN--RLPHKLANPKFSDPHVKTNLLLQAHLSRMQL-SAELQSDTEDILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQGMWNKDSYLKQLPHFT-PEIVKRCTEMGVETVFDVMELEDEDRNKLLQLNDAQMADVARFCNRYPNIELSYEVQDKESIMSGQTVNVSVQLEREDEVTGPVIAPLFPQRREEGWWVVIGDPKTNSLISIKRLTLQQKAKVKLDFVAP-NAGEHTYTLYFMSDSYMGCDQEYRFNIRV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Match: A0A3S3P5W2 (Antiviral helicase Slh1-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_04062 PE=4 SV=1)

HSP 1 Score: 2335.84 bits (6052), Expect = 0.000e+0
Identity = 1180/2162 (54.58%), Postives = 1588/2162 (73.45%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKD-IDPKKMGARVLKRKP-DCMEEKQDKRIKRDQSNRTLDYQ----KTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDY---KAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDD-GGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHIN-TDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFS-NRQDARCVYVTALNDLAQLRYTEWMKTFGA-LGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS--KSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL AD  LI++R +DE TGEV+ +   ++  +MG R  + KP   ++  + K+  +  ++ T  Y+    K +S+L+  +       Y PKT ET+ +YE +L+ +   L +    ++     DE+L  LKN  L +KER+K   ELLGN+LT+ +Y+ LV+L  K+TDY   + P+  T E+ D+T  ++++ ++  EE ++ +     D + DD  G EA   +TL+ S     T   + G+ T  P  G             L+  +IDA+WLQR LSK + DP   Q +  ++L +LK A +D+++EN+L+ ++G + FD +++L +N+ MI YCT L  +Q+  E+NKI  +M +D + +RIL  L N D K   VT ER RK++++ ++ +A+    D   ++      +LDL ++ F QGSH M NK C+LPDGSFRK + GY  + VPA KPKP + +ENLV I  LP Y + AFE  KTLNRIQS +YK+ALE DEN+L+CAPTGAGKTNVALL+MMREIGKHIN  DG+I  DDFKI+YIAPM+SLV EM N+FS+RL SYN+KVA L+GD  LSRE+INETQ+IVCTPEKWDII+RK  ++TYTQ+V+L+I DEIHLLHD+RGPVLE +VAR +R+++++    D+R++GLSATLPN ED+A F+ V K  GLF FD+S+RPVP+EQ+++GI E+KA+KR +LMN+++YEKV+E AGK+QVLIFVHSRKET  TA+ +++ CL +DTLGLFLR+  AST VL+ + ++VKN +LKDLLPYGFA+HHAG+   DR  VE+LFTD+HIQVLVST+TLAWGVNLPAH VIIKGTQVY PDKG WTEL ALDV+QM GRAGRPQYDTKG GI+IT  +EL YYLSLLN+QLPIESQ+++KL D LNAE+++G V+N+ E+I+WL YTYLYIRM +NP+LYG+  +   +DP L+ H  NLI+TAAS+L+K+ ++ F+++SG F   E+GRIA++YYCT++TM    + LK ++ +IE+F+VFS   EFRNIT+REE+K+E++KL+E VP+P+KE  ++P  K+N LLQAYISQLKLE   L +D  YI+QSAARLMRA+ E+ L + WA L    L  CK +++RMW    PLRQFKK+P E+ KK+EKKN P++RL D   +E+GEL+   K+GKT++KY+HQ PKL L  H+QPITRST+KVELTI PDF+W  K H +S+ FWI VEDV  E ILH+EYFLLK K+  D+HI+KF+V I+DPLPP Y+IR VSD+WIG ET + + F +++LPEK  P TELLDLQ LP  ALRN  YE++Y  K  +FN IQTQ F +LYN+D+NVF+GAPTGSGKTVCAE AI RLF+ + Q+ +CVYVT    LA++ + +W   FG+ LGK V+ LTG T  D K ++K +IIV+T E WD+LSRRWK++K +QNI LFIVD+L LIG    G  LEV+CSR RY+SSQ+E PIRI+ LS SL NA+DV +WL C+   T+NF+P+VR  PL++ I+ FN THN++RL AMSKPVYQ IL  SP  PVI+FVPT KQT+  A  ++ Y  +D +   F   +E  +  +++ +S+  L +T+S GV +IHE LS  +R L+ +LF+S +IQ++V+S TLC+SI    +LVI+MDTQ YNGK   Y+DY   D+IQMVGRAN   +D D + V+ CQ++KKDF +KFL++PLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+GV+HRHLSDHLSELVENTL DLE SKCI+I++D+DVS +NLGMIA +YYI+Y+TIE+FS+SL   +K+R L+E+I +A E+E +P+RH ED IL +I + +   I +  + SDP  K N+L+QA+LSR+ +   EL+ D  +IL KS+RLIQACVDVLSSN WL PALAAMELAQM+TQ+ W++DS LKQ+PHF   ++++RC   GV+T+FD+MEL+DE +  L+   D K+ DVA+F   YPNI+LTYEV     + +G  V+V + L R+++ +  V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F I+V
Sbjct:    1 MADAAARSLQYEYKANSNLVLQADTRLIEKRPRDEATGEVISLAGKLEGSRMGDRYQRTKPSSALKSDEKKKKSKKAASETSKYELSKLKAQSLLSEGIESMVGILYRPKTPETRQIYEVLLSFIQESLGDQP-RDVLCGAADEVLAVLKNDKLKEKERRKDCSELLGNSLTEERYSVLVNLCKKITDYGVEEKPQHITEESIDETYGVNVQFEESDEENDELMGEIRDDQDEDDFEGEEAPFESTLHASNL--DTNMPLTGSQTGAPSKG-----------AALHPREIDAYWLQRKLSKTYDDPVVAQSKAAEVLNILKTATDDRDVENQLIYLLGCNIFDFIKVLLQNRQMILYCTLLASAQSVAEKNKIREKMLSDSELSRILRMLENTDEKA--VTEERERKSRSKESRTKAEDADFDEESVAQLSRCKILDLDDLAFAQGSHFMANKRCQLPDGSFRKQRKGYEEIHVPALKPKPFDPNENLVSIEKLPRYAQPAFEGFKTLNRIQSHIYKSALEKDENLLICAPTGAGKTNVALLSMMREIGKHINPNDGSINVDDFKIIYIAPMRSLVQEMVNNFSKRLSSYNIKVAELTGDHQLSREQINETQVIVCTPEKWDIITRKGGDRTYTQVVRLVIFDEIHLLHDDRGPVLETLVARMVRSIETTQE--DIRLIGLSATLPNYEDVAAFLRV-KKSGLFHFDNSFRPVPLEQQFIGITEKKALKRYQLMNEILYEKVIEQAGKNQVLIFVHSRKETGKTARTVRDMCLEKDTLGLFLREGSASTEVLRTEAEQVKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFTDRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPDKGRWTELGALDVLQMLGRAGRPQYDTKGEGILITQHSELQYYLSLLNQQLPIESQMVAKLPDLLNAEVILGNVQNVKEAINWLGYTYLYIRMLQNPALYGISHDAAKEDPLLEKHRANLIFTAASLLDKSNLVKFERKSGTFQVTELGRIASHYYCTHQTMATYNQLLKPTLSEIELFRVFSLSGEFRNITIREEEKLELQKLMERVPIPVKESIDEPSAKVNVLLQAYISQLKLEGLALMADMVYITQSAARLMRAIHEIVLHRGWAQLADKALSLCKMIDKRMWQSMSPLRQFKKIPEEVVKKIEKKNFPWERLYDLGPNEIGELLRMPKLGKTVHKYVHQFPKLELSAHIQPITRSTLKVELTIIPDFQWDEKVHRTSEAFWILVEDVDQEVILHHEYFLLKAKYAQDEHIVKFFVPIFDPLPPQYFIRIVSDRWIGSETILPVSFRHLILPEKYPPPTELLDLQPLPVSALRNPAYEALYKDKFPYFNPIQTQVFNALYNTDDNVFVGAPTGSGKTVCAEFAIFRLFTQSAQEPKCVYVTPKEQLAEIIFNDWSHKFGSQLGKKVVLLTGETATDLKLLAKGNIIVATPEKWDILSRRWKQRKNVQNINLFIVDELQLIGGDE-GPVLEVVCSRMRYISSQIERPIRIVTLSSSLANAKDVAQWLGCNSAMTFNFHPNVRPVPLELHIRGFNQTHNSSRLLAMSKPVYQAILHHSPKKPVIIFVPTRKQTKITAVDIITYTAADSQVNRFLHCTENDIEPFIQRLSDSTLKQTISNGVAYIHEGLSAQDRRLVEQLFNSGAIQVVVISRTLCFSISVCGHLVIIMDTQYYNGKIHAYEDYPITDVIQMVGRANRPLLDEDGKCVLFCQSSKKDFFKKFLYDPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGVTHRHLSDHLSELVENTLNDLEQSKCISIEEDVDVSPLNLGMIAAYYYINYSTIELFSMSLNSKTKIRGLIEIISSAAEYEQIPIRHHEDTILKQILEKVPNKI-QSPKFSDPHVKTNLLIQAHLSRMSL-PPELQSDTEEILSKSIRLIQACVDVLSSNGWLSPALAAMELAQMVTQSVWNKDSYLKQLPHFTS-EIIKRCSERGVETIFDIMELDDEDRNNLLQLDDAKMADVAKFCNRYPNIELTYEVQDKHKIESGSSVNVIVQLEREDEVVGPVIAPFFPQKREEGWWVVIGDPKTSSLISIKRLTLQQKAKVKLDFTAP-APGDHTYTLYFMSDAYMGCDQEYKFNIHV 2138          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Match: A0A3S1AA11 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005773 PE=4 SV=1)

HSP 1 Score: 2332.75 bits (6044), Expect = 0.000e+0
Identity = 1162/2160 (53.80%), Postives = 1568/2160 (72.59%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTD-PNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK---------NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPIS-EDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL+ DRTLIDRR +DE TGEV+  +  +   +MG + LK KP  MEE++ KR KRD++   +   K  ++L+  + +     Y PKT ET+  YE +LN +   L +    ++     DE+LI LKN    D+E+KK  + LLGN L + ++  LV+L  K+TD+   +             H     D +E         +  + D G V  +     ++ +   G  +    T         L ++        L+  +IDAFW+QR +SK + D PN  Q + KD+LE+LK A +D+E E KL+ ++ V  F+ ++ LR+++ MI YCT L  +QT  E+ KI+ +M  D + + IL  L+  D ++DIV+ ER R+ QAR  ++ ADIE  D       G V  L L+++ F+QGSHLM NK C+LPDGS+RK + GY  V VPA KPKP + DE LV I  LP Y + AFE+ K+LNRIQS++   A+E+D+N+LLCAPTGAGKTNVALLT+MREIGKH+N DGTI  DDFKI+YIAPMKSL  EM  +FS+RL SYNL+V  L+GD  L+RE+I  TQ+IVCTPEKWDII+RK  EKTYTQ V+LLI DEIHLLHD+RGPVLE++VART+R ++S+    D+R+VGLSATLPN ED+A F+ VD   GLF FD+S+RPVP++Q+++GI E+KA+KR +LMND+VYEKV+E+AGK+QVL+FVHSRKET  TA+ I++ CL +DTLGLF+++  AST+VL+Q+ ++VK+ +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVL+STSTLAWGVNLPAH VIIKGTQ+Y P+KG W ELSALDV+QM GRAGRPQYDTKG GIMITN +EL YYLSL+N+QLPIESQ ISK+ADNLNAE+V+GTV NI E++DWL YTYLYIRM +NP+LYGV  + L +DP L    ++L++TAA IL+K  ++ +D+++G     E+GRI+++YY T+E+M    + LK ++ +IE+F+VFS  +EF+ +TVREE+K+E+ KLLE VP+PIKE  E+P  K+N LLQAYISQLKLE F L  D  +I+QSA RLMRA+FE+ L   WA L    L  CK V++RMW    PLRQF+K+P ++ KK+EKKN PF+RL D  H+E+GEL+   KMGK I+K+I Q P+L L +H+QPITRST+KVELTITPDF+W  K HG S+ FWI VEDV SE +LH+EYFLLK KF  D+H++KF+V +++PLPP Y+IR VSD+WIG ET++ + F +++LPE+  P TELLDLQ LP  ALRN ++E++YSKK + FN IQTQ F S+YNSD+NVF+GAPTGSGK++C E A++R+FS   + RCVYV  L+ LAQ  Y +W   F G LGK V+ LTG T  D K ++K +I++ST + WDVLSRRWK++K +QN+ LFIVD+LHLI S   G  LEVICSR RY+SSQLE  IRI+ LS SL+NA+D+ +WL C  +A +NF+P+VR  PL++ IQ FN++HNA+R+ AM+KP YQ ++K S   PV+VFVP+ KQT+  A  ++  A ++ +          F   +E  +  ++  IS+  L ETL+ GVG++HE L+  ER L+ +LFSS ++Q+LVV+ +L W I   A+LVIVMDTQ Y+GK   Y+DY   D++QM+G+AN   +D + ++VIMCQ++KK+F +KFL+EPLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTF+Y RMT+NPNYYNL+GV+HRHLSDHLSE+VENT+ DLE SKCI I+DD DV  +NLGMIA +YYI+YTTIE+FS+SL   +K++ L+E++ NA E+E+LP+RHGE  IL ++    RLP    + + +DP  K N+LLQA+LSR+P+ +AEL+ D   IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF    +++RC+   ++++FD+ME+ED+ +  L+   + ++ DVARF   YPNI+LTYEV   +S+ +G  ++V + L R+++ I  V A  FP KREE WW+V+G+P    L+SIK L+     KV L+F AP   G Y Y ++FMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADATARSLQYEYKANSNLVLSVDRTLIDRRGRDEATGEVMSLVGKLAGSRMGDKALKSKPPLMEERKIKRRKRDEAQHDMVKMKGATLLSEGIDEMVGILYRPKTTETRQTYEVLLNFIQAALGDQP-RDVLCGAADEVLIVLKNDRKKDREKKKEVESLLGN-LAEERFALLVNLGKKITDWSQEE-----------KTHTNETIDFDETYGVNVQFEESDDEDTGDVYGEVQEEGDVEEEEEGEEAAFDAT-----LHANLSEEDRNKGDVGLHPREIDAFWIQRKISKFYPDDPNMAQSKAKDVLEILKTAGDDREAETKLVMLLDVSHFEFIKTLRQHRQMILYCTMLAQAQTSNEKKKIDKQMSADAELSVILKMLQATD-QDDIVSEERARRQQARQTRVAADIEAMDVEEEEEVGPVQNLYLEDLVFSQGSHLMANKICQLPDGSYRKQRKGYEEVHVPALKPKPFDNDETLVSIDRLPKYAQPAFERFKSLNRIQSRLVNAAIETDQNLLLCAPTGAGKTNVALLTIMREIGKHVNADGTINSDDFKIIYIAPMKSLAQEMVGTFSQRLASYNLRVQELTGDHQLTREQIASTQVIVCTPEKWDIITRKGGEKTYTQFVRLLIFDEIHLLHDDRGPVLESLVARTIRTIESTQE--DVRLVGLSATLPNYEDVAVFLRVDPKEGLFFFDNSFRPVPLDQQFIGITEKKAIKRFQLMNDIVYEKVIEHAGKNQVLVFVHSRKETGKTARTIRDMCLEKDTLGLFMKEGSASTIVLRQEAEQVKSSELKDLLPYGFAIHHAGMNTVDRKLVEDLFNDRHIQVLISTSTLAWGVNLPAHTVIIKGTQIYSPEKGRWVELSALDVLQMLGRAGRPQYDTKGEGIMITNHSELRYYLSLMNQQLPIESQFISKMADNLNAEVVLGTVHNIKEAVDWLGYTYLYIRMLRNPTLYGVSHDALKEDPLLQQRRKDLVHTAACILDKNGLLKYDRKTGNLQVTELGRISSHYYITHESMATYNQLLKPTLSEIELFRVFSLSSEFKYLTVREEEKLELMKLLERVPIPIKESIEEPSAKVNVLLQAYISQLKLEGFALMVDMVFITQSAGRLMRALFEICLHYGWAQLVDKSLALCKMVDKRMWQSMTPLRQFRKIPEQVIKKIEKKNFPFERLYDLNHNEIGELLRLPKMGKPIHKHIRQFPRLELSVHIQPITRSTLKVELTITPDFQWEEKLHGHSEAFWILVEDVDSEAVLHHEYFLLKSKFATDEHLVKFFVPVFEPLPPQYFIRVVSDRWIGAETQLPVSFRHLILPERYPPPTELLDLQPLPISALRNPKFETLYSKKFAIFNPIQTQVFNSIYNSDDNVFVGAPTGSGKSICGEFAVLRMFSQNPEGRCVYVAPLDALAQQIYNDWHTKFAGVLGKKVVLLTGETGTDLKLLAKGNIVISTPDKWDVLSRRWKQRKNVQNVNLFIVDELHLI-SGEIGPVLEVICSRMRYISSQLERNIRIVALSSSLSNAKDIAQWLGCPTSAFFNFHPNVRPVPLELHIQGFNVSHNASRIMAMAKPTYQAVMKHSSKRPVLVFVPSRKQTKMTAIDILTCAAAEMQVGADDKPISRFLHVTEEDLGPFLEKISDLTLKETLANGVGYLHEGLTETERKLVEQLFSSGAVQVLVVARSLAWGINVAAHLVIVMDTQYYDGKMHSYEDYPVTDVLQMIGKANRPMLDKEGKAVIMCQSSKKEFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFIYRRMTQNPNYYNLQGVTHRHLSDHLSEVVENTINDLEQSKCINIEDDFDVHPLNLGMIAAYYYINYTTIELFSMSLNNKTKIKGLIEIVANAAEYENLPIRHGETAILKQLGS--RLPNKLTNAKFNDPHVKTNLLLQAHLSRMPL-SAELQSDTEDILNKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSPLKQLPHF-AADIIKRCQEKNLESIFDIMEMEDKDRTELLALNESEMADVARFCNRYPNIELTYEVLDKESIHSGSNINVTVTLEREDEIIGPVIAPMFPQKREEGWWVVIGDPKSNSLLSIKRLTLQQKAKVKLDFMAP-AHGRYNYVIFFMSDAYMGCDQEYKFSVDV 2133          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Match: A0A3B3T081 (Small nuclear ribonucleoprotein 200 (U5) OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 2332.37 bits (6043), Expect = 0.000e+0
Identity = 1168/2157 (54.15%), Postives = 1579/2157 (73.20%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXX----XXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV---ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS--KSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  KMG R  + +P  +EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  + DKER++  ++LLG    DT+Y+ LV+L  K+TDY   K   N +         ++  E D+++ +E+       + S+ D  GVEAD   TL  +  AAG +                      A  + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ +I  +M+ D   +++L  L+  + KEDI+  ER+R+ + R +++  D+E  D +   +     +LDL+++ F+QGSH M NK C+LPDGSFRK + GY  V VPA KPKP   DE L+    LP Y +AAFE  K LNRIQSK++K A+E+DEN+LLCAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SFS+RL SY + VA L+GD  L +EEIN TQ+IVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE++VART+R ++ +    D+R++GLSATLPN ED+A  + VD  RGLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++ KLAD LNAEIV+G V+N  ++++WL YTYLY+RM +NP+LYGV   +  L  DP L+    +L++TA  +L+K  ++ +DKR+G F   ++GRIA+++Y T++++    + LK ++ +IE+F+VFS  +EFRNITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQAYISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   +  CK +++RMW    PLRQF+K+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+HQ PKL+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR  SD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K  IIVST + WD+LSRRWK++K +QN+ LFIVD+ HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY +I++ SP  PV+VFVP+ +QT   A  ++ +  +D   + F   +E  ++ ++  +++  L ETL+ GVG++HE LS  ER ++ +LFSS ++Q++V S +LCW     A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKT+ENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K+VRLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+PHF     ++RC   GV+++FD+ME+EDE++  L+   D ++ DVARF   YPNI+L+YEV+  +S+ +GG V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP  +G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDRSQRTRPQMLEERRAKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEVLLSFIQAALGDQP-RDILCGAADEVLAVLKNEKMRDKERRREVEQLLGPA-DDTRYHVLVNLGKKITDYGGDKELQNMDDNIDETYGVNVQFESDEEEGDEDQFGEVRDEGSDEDSEGVEADIGLTLTANLGAAGDVMS--------------------AKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRRMILYCTMLASAQSEAEKKRITEKMEADQDLSKVLYQLQETE-KEDIIREERSRRERVRKSRVDNDLEAMDLDAGESLAPRQLLDLEDLAFSQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFAEDEVLLATEKLPKYAQAAFEGFKNLNRIQSKLFKAAMETDENLLLCAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFSKRLASYGITVAELTGDHQLCKEEINATQVIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLVARTIRNVELTQE--DVRLLGLSATLPNYEDVATCLRVDPARGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVGKLADMLNAEIVLGNVQNAKDAVNWLGYTYLYVRMLRNPTLYGVSHDDRAL--DPLLERRRLDLVHTAGCLLDKNSLVKYDKRTGSFQVTDLGRIASHFYVTHDSIHTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLARGWAQLTDKTMNLCKMIDKRMWLSMSPLRQFRKLPEEVIKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITRSTLKVELTITPDFQWDDKVHGSSEAFWILVEDVDSEVILHHEYFLLKSKYAQDEHLVTFFVPVFEPLPPQYFIRISSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNAEGRCVYITPMEALAEQVFVDWHQKFQDTLNKKVVLLTGETSTDLKLLGKGDIIVSTPDKWDILSRRWKQRKNVQNVSLFIVDETHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHSIIRHSPTKPVLVFVPSRRQTRLTAIDILTFCAADVVAQRFLHCAEKDLAPFLEKLTDNTLKETLANGVGYLHEGLSATERRIVEQLFSSGAVQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTCDH-IKRCTDKGVESIFDIMEMEDEERSVLLQLSDGQMADVARFCNRYPNIELSYEVAEKESIKSGGPVLVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-ATGIHNYTLYFMSDAYMGCDQEYKFSVDV 2125          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:103030392])

HSP 1 Score: 2313.88 bits (5995), Expect = 0.000e+0
Identity = 1162/2154 (53.95%), Postives = 1573/2154 (73.03%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSE--SDDG-GVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKS--VSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  KMG +  + KP  +EE++ KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ +   L +    +I     DE+L  LKN  + DKER++  ++LLG    DT+Y+ LV+L  K++DY   K   N + +      + +  + +EEE D     +  E  SDD  G EAD   TL+ +   AG +                         + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ KI A+M+ D   +++L  L+  + KEDI+  ER+R+ + R +++  D+E  D +   +  +  +LDL+++ FTQGSH M NK C+LPDGSFRK + GY  V VPA KPKP   DE LV +  +P Y +AAFE  KTLNRIQSK++KT +E+D N+L+CAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SF +RL SY + V+ L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE+++ART+R ++ +   +  R++GLSATLPN ED+A  + VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ++ KL D LNAE+V+G V+N+ ++++W+ YTYLY+RM +NP+LY V  +    DP L+    +L++TAA++LEK  ++ +DKRSG F   ++GRIA+++Y T+E++    + LK ++ +IE+F+VFS  +EFRNITVREE+K+E++KLLE VP+P+KE  E+P  KIN LLQAYISQLKLE F L +D  Y++QSA RLMRA+FE+ L + WA LT   +  CK +++RMW    PLRQF+K+P E+ KK+EKK+ PF+RL D  H+E+GEL+   KMGKTI+KY+HQ PKL+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +ES+Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F  AL K V+ LTG T+ D K + K  II+ST + WD+LSRRWK++K +QN+ LFIVD+ HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+DV  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY +I+K SP+ P +VFVP+ +QT   A  ++ +  +D   + F   +E  ++ ++  +S+  L ETLS GVG++HE LS  E  ++ +LF+S +IQ++V S +LCW     A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN    DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKT+ENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+++D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I NA E++++P+RH ED +L ++ Q +   ++   + +DP  K N+LLQA+LSR+ + +AEL+ D   IL K+VRLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS L+Q+PHF     ++RC   GV+++FD+ME+EDE++ AL+   D ++ DVARF   YPNI+L+YEV+    + +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKSQRTKPQMLEERRAKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEILLSFIQAALGDQP-RDILCGAADEVLAVLKNEKMRDKERRREVEQLLGPT-DDTRYHVLVNLGKKISDYGGDKELQNMDENIDETYGVNVQFESDEEEGDEDQYGEVREEGSDDSEGEEADVGCTLSANLGTAGDVM--------------------TTKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRRMILYCTMLASAQSEAEKEKIIAKMEADQDLSKVLYQLQETE-KEDIIREERSRRERLRKSRVD-DMESMDIDRSESVAARQLLDLEDLAFTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKPFSDDETLVAVEKMPKYAQAAFEGFKTLNRIQSKLFKTTMETDGNLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLASYGITVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQEEV--RLIGLSATLPNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVGKLPDMLNAEVVLGNVQNVKDAVNWIGYTYLYVRMLRNPTLYAVSHDERSTDPYLEQRRMDLVHTAATVLEKNNLVKYDKRSGSFQVTDLGRIASHFYITHESIMTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAYISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLGRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFRKLPEEVIKKIEKKSFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPKLDLAVHLQPITRSTLKVELTITPDFQWDDKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNAAFESLYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNTEGRCVYITPMEALAEQVFVDWHQKFQEALNKKVVILTGETSTDLKLLGKGDIIISTPDKWDILSRRWKQRKNVQNVSLFIVDETHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHSIMKHSPSKPTLVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLAPFLEKLSDATLRETLSNGVGYLHEGLSSTECKIVEQLFNSGAIQVVVASRSLCWGTNISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTVENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLQDLEQSKCISVEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLNSP-KFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEDILSKAVRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLRQLPHFTTEH-IKRCTDKGVESIFDIMEMEDEERTALLQLSDVQMADVARFCNRYPNIELSYEVADKDYIKSGSPVLVQVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-VVGVHNYTLYFMSDAYMGCDQEYKFSVDV 2123          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 691/1789 (38.62%), Postives = 1063/1789 (59.42%), Query Frame = 1
Query: 1324 KNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEY--AGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNV-PVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALS--DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIK-DDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSD-PRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNE----------------------------PKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK---------------------------SVSAGGQVSVQIHLAR------DEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            K   F  GS ++      LP+G  R+    +  V +P  +P P+   E  V I++L    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H+   G IRKD FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  L++ EI  TQ++V TPEKWD+++RKS  +   +Q+V+L+I+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+ + GLF FDS +RPVP+ Q ++G+     ++++  M ++ Y+KV+E   AG HQV++FVH+R  TV TA ++ E   NR     F  D+       ++ + + +N  L+++ P GF +HHAG+   DR  +E +F+  +++VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G   +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ  + LADNLNAE+                                       DP L+ + + L+  A   L+KA MI F++R+G F S ++GR A+++Y    T++   +       D ++  + SK  EF  + VR+E++ E++ LL N   +P   G E+   KIN LLQ Y+S+ +++ F+L SD +Y++Q+AAR+MRA+FE+ L K+W ++T  +L  CK +++R+W  + PLRQF  +P  +  +LE++ +  D+L D +  E+G ++++  +G  + + +HQIP + ++  +QPITR+ ++V LTITPDF W  + HGS  + +W++VED ++++I H EYFLL++K     +   + F + I++P+P  YYIRAVSD+W+G E    I F +++LPE++ P TELLDLQ LP  AL N EYES+Y  K + FN IQTQ F +LY++D NV +GAPTGSGKT+ AE+AI R+F+    A+ VY+  L  L + R  +W ++    LG+ V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS    P+R++GLS +L NARD+ +WL       +NF PSVR  PL++ IQ F   H   R+A+M+KPV+Q I   SP  PV++FV + +QT   A  L+ +  +  D K +    E  +++ +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVIV  T+ Y+GK   Y DY       + G            +++    KKDF +KFL+EP P+ES L   L DH NAEI   T+ +KQDA+DY+TWT+ + R+  NP+YYNL  ++H  ++  LS LVE +L DLE S C+ I+ D+  +  +  G IA++YY+ + T+ MF   LKP+  V+ LL ++ +A E+ +LP+RH ED + + + Q  RLP+  +    D   TK ++LLQA+ SR  +  ++   D   +L  ++R+ QA +DV ++  WL  AL+   L QMI QA+W  DS L  +PH  +                            P+L+  C+  G + +F  M  E+ Q          ++     F    P ++++ +V                              V A  +  +Q+ L R           S   A  FP  ++E W+LV+GE  +  L++IK +     +  VSL F  P ++G   YTLY MSDSYLG DQ+Y   +NV
Sbjct:  413 KTSAFIGGSKML------LPEGIRRENNKMFEQVEIPPNEPMPIGFQEKPVYISELDEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTVLHEIRQHLQPGGVIRKDQFKIVYVAPMKALAAEMTNYFSKRLEPLGISVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVGLSQIVRLIILDEVHLLHEDRGPVLESLVARTLRQVESTQSMI--RILGLSATLPNYLDVASFLHVNPYIGLFFFDSRFRPVPLGQTFVGVKTTSKIQQLHDMEEVCYDKVLEQIRAG-HQVMVFVHARNSTVRTAMSLIEMAKNRGESSFFQVDQGPDYGHCEKQVQRSRNKQLREMFPDGFGIHHAGMLRQDRTLMENMFSRGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAMVDLGILDVMQIFGRAGRPQFDKYGEGTIITTHDKLSHYLTLLTQQNPIESQFHASLADNLNAEM---------------------------------------DPGLELYRKELVVEAGRKLDKARMIRFEERTGYFASTDLGRTASHFYIKYNTIETFNELFNAQKTDADILSIVSKAEEFEQVKVRDEEQEELEALLYNFCQLPAAGGVENGYGKINILLQTYVSRGEVDNFSLISDLSYVAQNAARIMRALFEIALRKRWPAMTYRLLNLCKVIDKRLWGWAHPLRQFTTLPTSVLSRLEERKLTVDKLKDMRKDEIGHMLHHVNIGLKVKQCVHQIPAILMEASIQPITRTVLRVRLTITPDFRWNDQVHGSVGEPWWLWVEDPINDHIYHSEYFLLQKKQVVSGEPQQVVFTIPIFEPMPSQYYIRAVSDRWLGSEAVCIINFQHLILPERHPPHTELLDLQPLPVLALGNREYESLY--KFTHFNPIQTQIFHTLYHTDTNVLLGAPTGSGKTIAAEMAIFRVFNKYPTAKAVYIAPLKALVRERIEDWKIRIEEKLGRKVVELTGDVTPDMRAIAQADLIVTTPEKWDGVSRSWQNRSYVQKVAILIIDEIHLLG-EDRGPVLEVIVSRTNFISSHTSKPVRVVGLSTALANARDLADWLGIGQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPVFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAFLATEDDPKQWLHQDEREMTDIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEYYDGKTHRYVDYPITGSEVLAG------------LMLLHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIAAGTVTSKQDAMDYITWTYFFRRLVMNPSYYNLDDINHETINKFLSNLVEKSLRDLECSYCMEIQEDERTIEPLTYGRIASYYYLKHQTVRMFKERLKPDLPVQELLSILTDAEEYAELPVRHNEDQLNSELAQ--RLPLQVNPHSYDSAHTKTHLLLQAHFSRAQLPCSDYGTDTKTVLDNAIRVCQALLDVAANEGWLVSALSICNLVQMIVQARWLHDSSLITLPHIEKQSLYLFRRWSSKGGQGGGRGYQGPIEALPELIAACD--GREEIFTAMVKEELQP--------HQISQAWAFLSHLPVVEVSLKVKGWWEGCEEQTERALPTNVTSFREQSSWLPVHADQEYVLQVSLQRINMGRQRRKQDSKAQAPRFPKPKDEGWFLVLGEVEKKELLAIKRVGYVRNRSVVSLAFYTPEQTGKCIYTLYLMSDSYLGLDQQYDIHLNV 2126          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 292.738 bits (748), Expect = 1.218e-79
Identity = 226/765 (29.54%), Postives = 383/765 (50.07%), Query Frame = 1
Query: 1492 PSYVKAA-----FEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTYTQLVKX-XXXXXXXXXXXXRGPVLEAIVAR-----TMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRG-LFKFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTL--SKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQP-ITRSTMKVELTI 3705
            P +++AA     F++    N +QSK     L + +N + CAPTG+GKT +  L ++R +      + T    + K VY+AP+K+L ++   ++  +     L    L+GD+ +    EI +  +I+ TPEKWD ++RK       Q V+L LI +   +    RGP LE +V+R     +    +S  ++  MR V +SAT+PN  DIA+++  D+      + D S+RPV + +  LG    N +   K    +N  +   +  Y+ +   L+F  +RK    +A       L +D   +   D +     L +    + +  L+DL+  G   HHAG++ +DR  VE+ FT   + VL +TSTLA GVNLPAH+V+IK T  Y    G   E S  D++QM GRAGRPQ+DT    +++T       YL  ++    IES L + L ++LNAEIV+ T+ +++ ++DW+R T+LYIR  KNP+ YG  + L D   ++   + L     + L   ++I  D+        E G++ A Y    +TM    K L  +    E+ ++ SK  EF ++ +R  +K  +  L  +     +  P++   +    K+NCL+QA +  L ++ F L+ DT  I +S  R+ + + E     SK+  S  L+ L   K    ++W  S  + +Q  K+   +   +    +  F ++      EL  +VN H   G  I + + ++PK  +++   P  + ST ++ +T+
Sbjct:  224 PIHIQAAKFRGVFKEFPYFNYVQSKALDDILYTSKNFVACAPTGSGKTVLFELAIIRLL-----METTEPWHNVKAVYMAPIKALCSQQYENWKLKFGPLGLNCKELTGDTEIEDVFEIQDAHLIMTTPEKWDSMTRKWKNNCLLQSVQLFLIDEVHVVKDSTRGPTLEVVVSRMKTIHSYTVAESPDASTRMRFVAVSATIPNICDIADWLSNDQGPATCLEMDESHRPVKLRKVVLGFPFGNSQNEFKFDLSLNYKMASVIQTYSDQKPTLVFCSTRKGVQQSATV-----LAKDARFIMSIDHRQR---LMKYASSILDAKLRDLIMCGVGYHHAGVSLSDRKVVEDAFTAGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYA--GGSCEEYSEADMLQMIGRAGRPQFDTSATAVIMTRIQTREKYLQFISGSETIESSLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPTHYGFSSEL-DKCGIETKLQELCLKNLNSLASYQLITMDEDIN-IKPTESGKLMARYCVAFDTMKQFSK-LTGTENLAELIEMMSKGKEFSDVQLRVNEKRTLNTLNIDKNRVTIRYPMEGKIKSKDMKVNCLIQAQLGNLPIQEFGLTQDTGKIFRSGVRISKCLAEFLSHHSKQNFSAQLNSLILAKCFRAKLWEDSPYVSKQLDKIGLSLATAMVNAGLTSFSKIEATNPRELELIVNRHPPFGNQIKEAVSKLPKYEIRLEQLPKYSVSTAEILVTV 970          

HSP 2 Score: 271.552 bits (693), Expect = 5.461e-73
Identity = 180/662 (27.19%), Postives = 323/662 (48.79%), Query Frame = 1
Query: 4060 KKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNR----QDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNK-SISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYM-------SSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQT----FNITHNATRL-AAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYA-----LSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKG-VSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRI-----KQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLS--SNRWLGPALAAMELAQMITQAQW 5952
            K+  +FN +Q++  + +  + +N    APTGSGKTV  E+AI+RL         + + VY+  +  L   +Y  W   FG LG    +LTG+T +++   I  AH+I++T E WD ++R+WK    +Q++QLF++D++H++     G TLEV+ SR + +       S    T +R + +S ++ N  D+ +WL               HRP+ +        F  + N  +   +++  +   I   S   P +VF  T K  ++ A +L   A     +  ++   + + +I+   +R++        + CGVG+ H  +S+++R ++ + F++  + +L  + TL   +   A+LV++  T  Y G  C  ++YS  D++QM+GRA     D  A +VIM +   ++   +F+     +ES L   L +H NAEIV  TI +   A+D++  TFLY R  +NP +Y     +    +   L EL    L  L + + I + +DI++     G +   Y + + T++ FS  L     +  L+E++    EF D+ LR  E   L  +     + ++R P+  + ++     K N L+QA L  +PI+   L +D  +I    VR+ +   + LS  S +     L ++ LA+      W
Sbjct:  237 KEFPYFNYVQSKALDDILYTSKNFVACAPTGSGKTVLFELAIIRLLMETTEPWHNVKAVYMAPIKALCSQQYENWKLKFGPLGLNCKELTGDTEIEDVFEIQDAHLIMTTPEKWDSMTRKWKNNCLLQSVQLFLIDEVHVVKDSTRGPTLEVVVSRMKTIHSYTVAESPDASTRMRFVAVSATIPNICDIADWLSNDQGPATCLEMDESHRPVKLRKVVLGFPFGNSQNEFKFDLSLNYKMASVIQTYSDQKPTLVFCSTRKGVQQSATVLAKDARFIMSIDHRQRLMKYASSILDAKLRDL--------IMCGVGYHHAGVSLSDRKVVEDAFTAGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGSC--EEYSEADMLQMIGRAGRPQFDTSATAVIMTRIQTREKYLQFISGSETIESSLHTNLVEHLNAEIVLHTISDVNMALDWIRSTFLYIRALKNPTHYGFSSELDKCGIETKLQELCLKNLNSLASYQLITMDEDINIKPTESGKLMARYCVAFDTMKQFS-KLTGTENLAELIEMMSKGKEFSDVQLRVNEKRTLNTLNIDKNRVTIRYPM--EGKIKSKDMKVNCLIQAQLGNLPIQEFGLTQDTGKIFRSGVRISKCLAEFLSHHSKQNFSAQLNSLILAKCFRAKLW 885          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Match: polq (DNA polymerase theta [Source:NCBI gene;Acc:103039702])

HSP 1 Score: 119.013 bits (297), Expect = 5.343e-26
Identity = 133/474 (28.06%), Postives = 224/474 (47.26%), Query Frame = 1
Query: 1579 ENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSE---RLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWD-IISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTM--------RAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINE----------RKAVKRIELMND------LVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLV---------LQQDLDKVK------NHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQL-PIESQLISKLADNLNA-------EIVMGTVRNIHESI 2847
            +N++  APT AGKT V+ L +++ + +      T RK  F + +++  +  +  + N F E   R++ Y    +   G S L         + VCT EK + +I+R   E     L  +++ +   L    RG +LE ++ +          R    ++++  ++IVG+SATLPN + +A ++  +    L+  D  YRPVP+  E++ I            R+    + +  D      L +E V  +AG H  L+F  S+      A +I      R+   L+ ++K++ + V         LQ  + ++K      +  L+  +P+G A HHAGL + +R+ +E  F    I+VL +TSTL+ GVNLPA  VII+ T V+    G    L  L   QM GRAGR   DT G  +++  E E    +SL+   L PI S L+ +  + +         EI++G V +  E +
Sbjct:  286 KNLVYSAPTSAGKTLVSELLILKRVLE------TRRKAIFILPFVSVAREKMFYLQNVFQEAGVRVEGYMGSTSAAGGFSALD--------VAVCTIEKANGLINRLIEEDRMDLLGIVVVDELHMLGDSGRGYLLELLLTKIQYIATKTKERCTDKAYTD-GVQIVGMSATLPNLDLLARWLSAE----LYHTD--YRPVPL-MEWVKIGTQIYDGSMTLIRQFTPALPVKGDDDHIVSLCFETV--HAG-HSALLFCPSKNWCEKLADSIA-----REFYNLYHKEKQSESGVQSVSLNLEGLQDVVAQLKRSPAGLDQVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGFIRVLAATSTLSSGVNLPARRVIIR-TPVF---NGHL--LDILTYKQMVGRAGRKGVDTIGESVLVCKEAERMKGVSLIQGSLKPISSCLVKREGEGVTTSMLRAILEIIVGGVASTPEEV 723          

HSP 2 Score: 85.5001 bits (210), Expect = 7.017e-16
Identity = 102/447 (22.82%), Postives = 200/447 (44.74%), Query Frame = 1
Query: 3994 LLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFE-SLYNSDENVFIGAPTGSGKTVCAEIAIM-RLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLET---------PIRIIGLSYSLTNARDVGEWL--DCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPV-----------YQTILKLSPNSPVIVFVPTMKQTEEIAFLLMG--YALSDKKNFGRAS-----------EAIVSEYMRNIS--NEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLI---QMVGRANHASMDD-ARSVIMCQ 5205
            LL    LP   L  E+Y+S+  K+M  +   Q +C         +N+   APT +GKT+ +E+ I+ R+   R+ A  +++     +A+ +       F   G  V    G+T+      S   + V T E  + L  R  ++  +  + + +VD+LH++G    G  LE++ ++ +Y++++ +           ++I+G+S +L N   +  WL  + +HT   ++ P      + I  Q ++ +    R    + PV           ++T+         ++F P+    E++A  +    Y L  K+    +            + +V++  R+ +  +++L  T+  GV F H  L+ +ER+++   F    I++L  + TL   +   A  VI+  T V+NG          +D++   QMVGRA    +D    SV++C+
Sbjct:  247 LLSSWGLPKPVL--EKYQSLGVKQMFEW---QAECLTLGKVLEGKNLVYSAPTSAGKTLVSELLILKRVLETRRKA--IFILPFVSVAREKMFYLQNVFQEAGVRVEGYMGSTSAAG-GFSALDVAVCTIEKANGLINRLIEEDRMDLLGIVVVDELHMLGDSGRGYLLELLLTKIQYIATKTKERCTDKAYTDGVQIVGMSATLPNLDLLARWLSAELYHT---DYRPVPLMEWVKIGTQIYDGSMTLIRQFTPALPVKGDDDHIVSLCFETV---HAGHSALLFCPSKNWCEKLADSIAREFYNLYHKEKQSESGVQSVSLNLEGLQDVVAQLKRSPAGLDQVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGFIRVLAATSTLSSGVNLPARRVIIR-TPVFNGH--------LLDILTYKQMVGRAGRKGVDTIGESVLVCK 670          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 98.5969 bits (244), Expect = 4.983e-20
Identity = 83/278 (29.86%), Postives = 122/278 (43.88%), Query Frame = 1
Query: 1960 RGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFK----------FDSSYRPVPMEQEYLGINERKAVKRIELMN----DLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLL----PYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVM------QMFGRAGRPQYDTKGVGIMITNENE 2721
            RG +LE  +A+ +      + N   +I+G+SATL N  D+  F+  + +   F+           DS Y   P E+E    +   A K    M     D +   V E   K   LIF  ++K   N A  I  K L+ D    FL  ++     L  +L    N  L  +L    P+G A HH+GL   +R  VEE ++   + +L  TSTLA G+NLPA  VI++   V             +D +      QM GRAGR   D+ G  I+I  + +
Sbjct:  346 RGAILEMTLAKVL------YINKSTQIIGMSATLGNIGDLQSFLRAENYTNDFRPVELKEYVKLRDSIYEVKPKEEECFRFSRLLAFKYSSGMQKMDPDHIIALVTEVIPKQSCLIFCATKKNCENVAGMIC-KYLHTD----FLMHREGEKATLLAELRNSGNGSLCPVLQRTVPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLACTSTLAAGINLPARRVILRSPYV------------GIDFLKRSQYKQMVGRAGRAGIDSVGESILILQDRD 600          

HSP 2 Score: 97.8265 bits (242), Expect = 8.581e-20
Identity = 106/421 (25.18%), Postives = 180/421 (42.76%), Query Frame = 1
Query: 4123 ENVFIGAPTGSGKTVCAEIAIMR-LFSNRQDARCV--YVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNM--DNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNP-------SVRH-----RPLDIEIQTFNITHNATRLAAMSK--P--VYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISN----EILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLI------QMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHD 5286
            +N+    PT  GKT+ AEI I + L   R+DA  +  YV  + +         + +FG  L   V +  G+       K  S   + ++T E    L     +   + NI L +VD+LH++G    G  LE+  ++  Y++       +IIG+S +L N  D+  +L   +  T +F P        +R      +P + E   F+        + M K  P  +   + ++ P    ++F  T K  E +A ++  Y  +D        +A +   +RN  N     +L  T+  G+ + H  L+ +ER L+ E +SS  + +L  + TL   I   A  VI            +   Y  +D +      QMVGRA  A +D    S+++ Q   KD ++K +    P+E    + LHD
Sbjct:  226 KNLIYSLPTSGGKTLVAEILIFKELLCRRKDALLILPYVALVQE-----KVRGLASFGIELDFMVEEYAGSKGRFPPVKRRSSNSLYITTIEKGHSLVNSLIEANRLDNIGLVVVDELHMLGDGSRGAILEMTLAKVLYINKS----TQIIGMSATLGNIGDLQSFLRAENY-TNDFRPVELKEYVKLRDSIYEVKPKEEECFRFSRLLAFKYSSGMQKMDPDHIIALVTEVIPKQSCLIFCATKKNCENVAGMICKYLHTDFLMHREGEKATLLAELRNSGNGSLCPVLQRTVPFGLAYHHSGLTSDERKLVEEAYSSGVLCLLACTSTLAAGINLPARRVI------------LRSPYVGIDFLKRSQYKQMVGRAGRAGIDSVGESILILQDRDKDMVRKLVSA--PMEKCYSNLLHD 622          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 468/1134 (41.27%), Postives = 706/1134 (62.26%), Query Frame = 1
Query: 2032 MRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYA-GKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLL--KEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGK-----TVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNP 5388
            +RIVGLSATLPN  D+A F+HV+ + GLF FDS +RPVP+ Q ++G+     ++++  M+++ Y+KV+E     HQV++FVH+R  TV TA A++E   N    G F   + A      + +++ +N  +++L P GF+ HHAG+   DR+ VE LF+   ++VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L ALDVMQ+FGRAGRPQYDT G+GI+IT+ ++L  YL+LL +Q PIESQ  + L DNLNAE   G      E++ WL YTYLY+RMR NP  YG+ +     DP+L      ++  A   L+KA MI FD+R+G F   + GR A+++Y    T++    +    + + +V  +  K  EF  I VRE++  E+++L +    +P+  G E+   K+N LLQ YIS+  ++ F+L SD +YI+Q+AAR++R++FE  L K+W ++T  +L   K +++R+W  + PLRQF  +P    +KLE + +  D+L D   H++G ++++  MG+ I + + QIP L L+  +QPITR+ ++V L+IT DF WC + HGS  + +WI+VED  +++I H E F++  K+    +   + F + I++PLP  YY+RAVSD+W+G E    I F  ++LPE++ P TELLDLQ LP  AL +   E++Y  + + FN +QTQ F +LY+ D NV +GAPTGSGKTV AE+AI R+F+    A+ VY+  L  L + R  +W ++     GK      V++LTG+   D ++I+ A +IV+T E WD +SR W  +  ++ + L ++D++HL+G    G  LEVI SRT ++SS  E P+R++GLS +L NARD+ +WL       +NF PSVR  PL+  I  F   H   R+A M+KP +Q I   SP  PV++FV + +QT   A  L+ +   +   K +    E  +   +  + +  L   L+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVI+  T+ ++GK   Y D+   D++QM+GRA     DD  ++VI     KKDF +KFL+EP P+ES L   L DH NAEI + TI +KQDA+DY+TWT+ + R+  NP
Sbjct:    9 IRIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMAKNNGEAGFFTPPQSAEYGTAFKQVERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPIESQFQASLQDNLNAEDEAGLATAAFEAVRWLSYTYLYVRMRANPLAYGINHSHYQADPSLHKFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVCKAEEFEQIKVREDELGELEQLADGYCLLPVAGGVENGYGKVNILLQTYISRGDVDCFSLVSDLSYIAQNAARIVRSLFETALRKRWPTMTSRLLALSKAIDRRLWGWAHPLRQFSALPHTTLEKLEARKMTVDKLRDMSSHDIGHMIHHVAMGQKIKQCVQQIPTLALEASIQPITRTVLRVRLSITADFTWCDQVHGSVGEPWWIWVEDPTNDHIYHSENFMILKKQVLSQEAQCVTFTIPIFEPLPSQYYVRAVSDRWLGSEAVCAINFQQLILPERHPPHTELLDLQPLPVSALGDARLEALY--RFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERMEDWKVRLEPEAGKECAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDD-RGPVLEVIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLAIKQVILFNFRPSVRPVPLEAHIHGFPGQHYCPRMATMNKPTFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETEMEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPVESSLLEVLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1139          

HSP 2 Score: 300.056 bits (767), Expect = 9.459e-84
Identity = 182/468 (38.89%), Postives = 263/468 (56.20%), Query Frame = 1
Query: 1510 AFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKS------YNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNP 2895
            A  +    N +Q++++ T    D N+LL APTG+GKT  A L + R    H            K VYIAP+K+LV E    +  RL+          +V  L+GD       I    +IV TPEKWD +SR    ++Y + V LL+IDEIHLL D+RGPVLE IV+RT     SSH+   +R+VGLS  L N  D+A+++ + K   LF F  S RPVP+E    G   +    R+  MN   ++ +  ++    VLIFV SR++T  TA  +       D    +L   +     ++  +  VK+ +LK  L +G  +HHAGL   DR  VEELF +  IQVL++TSTLAWGVN PAH+VIIKGT+ +      + +    DV+QM GRAGRPQ+D +G  ++  ++ +  +Y   L E  P+ES L+  LAD+LNAEI  GT+ +  +++D++ +TY + R+  NP
Sbjct:  687 ALYRFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGA---------KAVYIAPLKALVRERMEDWKVRLEPEAGKECAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDDRGPVLEVIVSRT--NFISSHTEKPVRVVGLSTALANARDLADWLAI-KQVILFNFRPSVRPVPLEAHIHGFPGQHYCPRMATMNKPTFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETE---MEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPVESSLLEVLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1139          

HSP 3 Score: 162.54 bits (410), Expect = 2.694e-40
Identity = 167/662 (25.23%), Postives = 281/662 (42.45%), Query Frame = 1
Query: 4546 IRIIGLSYSLTNARDVGEWLDCH-HTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL-KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRA---SEAIVSEY------MRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRH------LSDHLSELVENTLMDLENSKCIAIKDDID-VSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSL-RLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQ---IPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGH--------LISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCD 6438
            IRI+GLS +L N  DV  +L  + +   + F+   R  PL         T+   ++  M +  Y  +L ++     V+VFV     T   A  L   A    KN G A   +    +EY      +    N+ + E    G    H  +   +R+L+  LFS   +++LV + TL W +   A+ VI+  TQ+Y+ K   + D  A+D++Q+ GRA     D     +I+   +K       L +  P+ES     L D+ NAE          +AV +L++T+LY RM  NP  Y   G++H H      L     ++V +    L+ ++ I   +     S  + G  A+ +YI Y TIE F+    P+     +L ++C A EFE + +R  E   L ++      LP++    + +   K NILLQ Y+SR  +    L  DL+ I   + R++++  +     RW       + L++ I +  W     L+Q   +PH      LE+ EA   K   D +       +  M       Q + +  Q  P + L  E S        + V++ +  D      V+ +       E WW+ V +P   H        ++  ++LS   + V+          S +Y +  +SD +LG +
Sbjct:    9 IRIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMA----KNNGEAGFFTPPQSAEYGTAFKQVERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPIESQFQASLQDNLNAEDEAGLATAAFEAVRWLSYTYLYVRMRANPLAY---GINHSHYQADPSLHKFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVCKAEEFEQIKVREDELGELEQLADGYCLLPVAGG--VENGYGKVNILLQTYISRGDVDCFSLVSDLSYIAQNAARIVRSLFETALRKRWPTMTSRLLALSKAIDRRLWGWAHPLRQFSALPH----TTLEKLEAR--KMTVDKLRDMSSHDIGHMIHHVAMGQKIKQCVQQIPTLAL--EASIQPITRTVLRVRLSITADFTWCDQVHGSV-----GEPWWIWVEDPTNDHIYHSENFMILKKQVLSQEAQCVTFTIPIFEPLPS-QYYVRAVSDRWLGSE 647          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 472/1143 (41.29%), Postives = 710/1143 (62.12%), Query Frame = 1
Query: 2005 MQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYA-GKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMG--TVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLL--KEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF----GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNP 5388
            ++S+ S I  RIVGLSATLPN  D+A F+HV+ + GLF FDS +RPVP+ Q ++G+     ++++  M+++ Y+KV+E     HQV++FVH+R  TV TA A++E   N    G F   + A      + +++ +N  +++L P GF+ HHAG+   DR+ VE LF+   ++VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L ALDVMQ+FGRAGRPQYDT G+GI+IT+ ++L  YL+LL +Q PIESQ  + L DNLNAE   G  T   I E++ WL YTYLY+RMR NP  YG+  N L   P ++     ++  A   L+KA MI FD+R+G F   + GR A+++Y    T++    +    + + +V  +  K  EF  I VRE++  E+++L +    +P+  G E+   K+N LLQ YIS+  ++ F+L SD +YI+Q+AAR++R++FE  L K+W ++T  +L   K +++R+W  + PLRQF  +P    +KLE + +  D+L D   H++G ++++  MG+ I + + QIP L L+  +QPITR+ ++V L+IT DF WC + HGS  + +WI+VED  +++I H E F++  K+    +   + F + I++PLP  YY+RAVSD+W+G E    I F  ++LPE++ P TELLDLQ LP  AL +   E++Y  + + FN +QTQ F +LY+ D NV +GAPTGSGKTV AE+AI R+F+    A+ VY+  L  L + R  +W        G     V++LTG+   D ++I+ A +IV+T E WD +SR W  +  ++ + L ++D++HL+G    G  LEVI SRT ++SS  E P+R++GLS +L NARD+ +WL       +NF PSVR  PL+  I  F   H   R+A M+KP +Q I   SP  PV++FV + +QT   A  L+ +   +   K +    E  +   +  + +  L   L+ G+G  H  L   +R  + ELF +  IQ+L+ + TL W +   A+LVI+  T+ ++GK   Y D+   D++QM+GRA     DD  ++VI     KKDF +KFL+EP P+ES L   L DH NAEI + TI +KQDA+DY+TWT+ + R+  NP
Sbjct:    1 VESTQSMI--RIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMAKNNGEAGFFTPPQSAEYGTAFKQVERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPIESQFQASLQDNLNAEDEAGLATAAYIFEAVRWLSYTYLYVRMRANPLAYGINYNELWRSPNVEWFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVCKAEEFEQIKVREDELGELEQLADGYCLLPVAGGVENGYGKVNILLQTYISRGDVDCFSLVSDLSYIAQNAARIVRSLFETALRKRWPTMTSRLLALSKAIDRRLWGWAHPLRQFSALPHTTLEKLEARKMTVDKLRDMSSHDIGHMIHHVAMGQKIKQCVQQIPTLALEASIQPITRTVLRVRLSITADFTWCDQVHGSVGEPWWIWVEDPTNDHIYHSENFMILKKQVLSQEAQCVTFTIPIFEPLPSQYYVRAVSDRWLGSEAVCAINFQQLILPERHPPHTELLDLQPLPVSALGDARLEALY--RFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERMEDWKVRLEPEAGCAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDD-RGPVLEVIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLAIKQVILFNFRPSVRPVPLEAHIHGFPGQHYCPRMATMNKPTFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETEMEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPVESSLLEVLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1138          

HSP 2 Score: 300.827 bits (769), Expect = 5.684e-84
Identity = 182/466 (39.06%), Postives = 263/466 (56.44%), Query Frame = 1
Query: 1510 AFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKS----YNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNP 2895
            A  +    N +Q++++ T    D N+LL APTG+GKT  A L + R    H            K VYIAP+K+LV E    +  RL+        +V  L+GD       I    +IV TPEKWD +SR    ++Y + V LL+IDEIHLL D+RGPVLE IV+RT     SSH+   +R+VGLS  L N  D+A+++ + K   LF F  S RPVP+E    G   +    R+  MN   ++ +  ++    VLIFV SR++T  TA  +       D    +L   +     ++  +  VK+ +LK  L +G  +HHAGL   DR  VEELF +  IQVL++TSTLAWGVN PAH+VIIKGT+ +      + +    DV+QM GRAGRPQ+D +G  ++  ++ +  +Y   L E  P+ES L+  LAD+LNAEI  GT+ +  +++D++ +TY + R+  NP
Sbjct:  688 ALYRFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGA---------KAVYIAPLKALVRERMEDWKVRLEPEAGCAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRSWHSRSYVKQVALLVIDEIHLLGDDRGPVLEVIVSRT--NFISSHTEKPVRVVGLSTALANARDLADWLAI-KQVILFNFRPSVRPVPLEAHIHGFPGQHYCPRMATMNKPTFQAIRTHSPAKPVLIFVSSRRQTRLTALDLIAFLAGEDNPKQWLHTDETE---MEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFVHDLKKDFYKKFLYEPFPVESSLLEVLADHLNAEITSGTITSKQDAMDYITWTYFFRRLIMNP 1138          

HSP 3 Score: 155.606 bits (392), Expect = 4.328e-38
Identity = 168/664 (25.30%), Postives = 284/664 (42.77%), Query Frame = 1
Query: 4546 IRIIGLSYSLTNARDVGEWLDCH-HTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL-KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRA---SEAIVSEY------MRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAE--IVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHL--SDHLSELVENTLMD----LENSKCIAIKDDID-VSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSL-RLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQ---IPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGH--------LISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCD 6438
            IRI+GLS +L N  DV  +L  + +   + F+   R  PL         T+   ++  M +  Y  +L ++     V+VFV     T   A  L   A    KN G A   +    +EY      +    N+ + E    G    H  +   +R+L+  LFS   +++LV + TL W +   A+ VI+  TQ+Y+ K   + D  A+D++Q+ GRA     D     +I+   +K       L +  P+ES     L D+ NAE      T     +AV +L++T+LY RM  NP  Y   G+++  L  S ++    E  ++D    L+ ++ I   +     S  + G  A+ +YI Y TIE F+    P+     +L ++C A EFE + +R  E   L ++      LP++    + +   K NILLQ Y+SR  +    L  DL+ I   + R++++  +     RW       + L++ I +  W     L+Q   +PH      LE+ EA   K   D +       +  M       Q + +  Q  P + L  E S        + V++ +  D      V+ +       E WW+ V +P   H        ++  ++LS   + V+          S +Y +  +SD +LG +
Sbjct:    8 IRIVGLSATLPNYLDVARFLHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQMHDMDEVCYDKVLEQVKAGHQVMVFVHARNATVRTAMALREMA----KNNGEAGFFTPPQSAEYGTAFKQVERSRNKPMRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIIITSHDKLGRYLTLLTQQNPIESQFQASLQDNLNAEDEAGLATAAYIFEAVRWLSYTYLYVRMRANPLAY---GINYNELWRSPNVEWFREQMVVDAGRKLDKARMIRFDERTGYFSPTDTGRTASHFYIKYNTIETFNDYFGPHLTESDVLSMVCKAEEFEQIKVREDELGELEQLADGYCLLPVAGG--VENGYGKVNILLQTYISRGDVDCFSLVSDLSYIAQNAARIVRSLFETALRKRWPTMTSRLLALSKAIDRRLWGWAHPLRQFSALPH----TTLEKLEAR--KMTVDKLRDMSSHDIGHMIHHVAMGQKIKQCVQQIPTLAL--EASIQPITRTVLRVRLSITADFTWCDQVHGSV-----GEPWWIWVEDPTNDHIYHSENFMILKKQVLSQEAQCVTFTIPIFEPLPS-QYYVRAVSDRWLGSE 648          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005265.1 (pep scaffold:Pmarinus_7.0:GL487662:5509:13814:-1 gene:ENSPMAG00000004793.1 transcript:ENSPMAT00000005265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 383.259 bits (983), Expect = 4.123e-120
Identity = 191/355 (53.80%), Postives = 263/355 (74.08%), Query Frame = 1
Query: 5413 SHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPIS-EDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVS--KSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            SHRHLSDHLSELVE+TL DLE+SKCI+++D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L++++ NA+E+  +P+RH EDV+L R + + ++P    + + +DP  KAN+LLQA+LSR+ +  AEL+ D   IL +++RLIQACVDVLSSN WL PALAAMELAQM TQA W +DS LKQ+PHF     ++RC   GV++VFD++E+ED  + AL+   D K+ DVARF   YPNI+L+YE+S   +V +G  V V + L R+++    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G++ YTLYFMSD+Y+GCDQEY+F++ V
Sbjct:    1 SHRHLSDHLSELVESTLGDLEHSKCISLEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIDIVSNASEYAAIPIRHHEDVLL-RQQLAQKVPNKLTNPKFNDPHAKANLLLQAHLSRMQLN-AELQSDTEDILTQAIRLIQACVDVLSSNGWLSPALAAMELAQMCTQAMWSKDSYLKQLPHFTADH-VKRCTEQGVESVFDVLEMEDAARSALLQLDDSKMADVARFCNRYPNIELSYELSDKDNVHSGSAVVVMVQLEREDEVTGPVIAPFFPQKREEGWWVVIGDPKTNSLISIKRLTLQQKAKVKLDFVAP-APGTHHYTLYFMSDAYMGCDQEYRFSVEV 351          

HSP 2 Score: 67.781 bits (164), Expect = 1.041e-11
Identity = 78/349 (22.35%), Postives = 149/349 (42.69%), Query Frame = 1
Query: 2938 LDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXX-XXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIP--FD--RLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS----------SQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETE 3936
            L +H   L+ +    LE ++ I+ +        N +G IAAYYY    T+++    L        +  + S  +E+  I +R  + + +++   + VP  +      DP  K N LLQA++S+++L    L SDT  I   A RL++A  +V  S  W S  L+ +E  +   Q MW+    L+Q      +  K+  ++ +   FD   + D     L +L ++ KM   + ++ ++ P + L   L           + +    E   +  G            +G+W+ + D  + +++  +   L++K K     +K       P    Y +  +SD ++G + E
Sbjct:    5 LSDHLSELVESTLGDLEHSKCISLEDEMDVAPLN-LGMIAAYYYINYTTIELFSMSLNAKTKIRGLIDIVSNASEYAAIPIRHHEDVLLRQQLAQKVPNKLTNPKFNDPHAKANLLLQAHLSRMQLNA-ELQSDTEDILTQAIRLIQACVDVLSSNGWLSPALAAMELAQMCTQAMWSKDSYLKQLPHFTADHVKRCTEQGVESVFDVLEMEDAARSALLQL-DDSKMAD-VARFCNRYPNIELSYELSDKDNVHSGSAVVVMVQLEREDEVTGPVIAPFFPQKREEGWWVVIGDPKTNSLISIKRLTLQQKAK-----VKLDFVAPAPGTHHYTLYFMSDAYMGCDQE 344          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003190.1 (pep scaffold:Pmarinus_7.0:GL480029:355:29241:-1 gene:ENSPMAG00000002910.1 transcript:ENSPMAT00000003190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 1.257e-51
Identity = 162/589 (27.50%), Postives = 282/589 (47.88%), Query Frame = 1
Query: 1960 RGPVLEAIVARTMR-------AMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLF-KFDSSYRPVPMEQEYLGI---NERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRP-QYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXX----XXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLES---CKEVEQRMWACSCPLRQ--FKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKI 3657
            RG  LEA+V+R          A+Q  H+   +RI+ ++AT+PN EDIAE++       +F K D  +RP  + +  LG    + + A K   ++N  +   +  Y+ +   LIF  +R+     A  + +          F+ D +      ++    +K+  L+DLL  G A HHAG+A +DR  +E++F    ++VL STSTLA GVNLPAH+VI+K T  Y    G   E    + +QM GRAGRP Q+D     +++T +     Y  +L+    +ES L   L ++LNAEIV+ T+ +++ ++DW+R T+LYIR  KNP  Y     L  +         L   + + L   ++     ++G+    ++GR+ A YY   +T+ +    L+ S    ++  + + C E++ I +R  +K  +          +  P+    +    K+NCL+Q  +  + L+ F L  D A I ++  RL + + E    K   +   +VL +    K    ++W  S   +Q     V + ++  L    +  F+++          +VN H   G  I + +  +PK  +++
Sbjct:   10 RGATLEAVVSRMKTLIFLPRDALQPLHTCRGVRIIAVAATIPNIEDIAEWLSDRDGTAIFIKLDGKHRP-KLRKIVLGFPFYSVQTAFKFYLILNYKLARVIQTYSEQKPTLIFCATRRSVQQAAATLAK-------YAKFMIDFQHRQSHCRKHASHLKDIKLRDLLMKGIAYHHAGMAASDRRNIEDVFLQGELRVLFSTSTLAIGVNLPAHLVIVKSTMRY-TRGGMLQEYG--ETLQMIGRAGRPQQFDVSATAVILTRKK----YERMLSGTQELESSLHINLTEHLNAEIVLHTITDVNVALDWIRSTFLYIRALKNPKHYKFPAGLSKEDIEKKLLSELCLESLNSLATFKLNCM--QNGDIKPTDVGRLMASYYIAFDTIKLFGT-LQGSEAMQDLVNLVAHCREYKYIALRVNEKKTLNTFNMAKNHTIRFPMPGKIKTIEMKVNCLIQPQLGCV-LQDFALIQDIAKIFRTGIRLTKCLAEFLQQKDKQNNFQAVLNAVHLAKCFRAKLWKNSPVFKQQNVSAVSFSLSSALVNAGLTSFEKIYTVNAIGPVVIVNRHPPFGNQIKEAVQHLPKYQVRV 579          

HSP 2 Score: 125.946 bits (315), Expect = 1.543e-29
Identity = 121/533 (22.70%), Postives = 232/533 (43.53%), Query Frame = 1
Query: 4456 LHLIGSQHNGTTLEVICSRTR---YMSSQLETP------IRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRP----LDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYA-----LSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNL-KGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRI----KQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSS---NRWLGPALAAMELAQMITQAQWHRDSLLKQ 5976
            +H +  +  G TLE + SR +   ++      P      +RII ++ ++ N  D+ EWL              +HRP    + +    +++         ++  + + I   S   P ++F  T +  ++ A  L  YA        +++  R      + ++++I    L + L  G+ + H  ++ ++R  + ++F    +++L  + TL   +   A+LVIV  T  Y  +  M  +Y   + +QM+GRA      D  +  +  T KK   ++ L     LES L   L +H NAEIV  TI +   A+D++  TFLY R  +NP +Y    G+S   +   L   +    ++   +  +    + D+   ++G +   YYI + TI++F  +L+ +  ++ L+ L+ +  E++ + LR  E   L         ++R P+    ++     K N L+Q  L  V ++   L +D+ +I    +RL +   + L            L A+ LA+      W    + KQ
Sbjct:    2 VHTVEDESRGATLEAVVSRMKTLIFLPRDALQPLHTCRGVRIIAVAATIPNIEDIAEWLSDRDGTAIFIKLDGKHRPKLRKIVLGFPFYSVQTAFKFYLILNYKLARVIQTYSEQKPTLIFCATRRSVQQAAATLAKYAKFMIDFQHRQSHCRKH----ASHLKDIK---LRDLLMKGIAYHHAGMAASDRRNIEDVFLQGELRVLFSTSTLAIGVNLPAHLVIVKSTMRYT-RGGMLQEYG--ETLQMIGRAGRPQQFDVSATAVILTRKK--YERMLSGTQELESSLHINLTEHLNAEIVLHTITDVNVALDWIRSTFLYIRALKNPKHYKFPAGLSKEDIEKKLLSELCLESLNSLATFKLNCMQNGDIKPTDVGRLMASYYIAFDTIKLFG-TLQGSEAMQDLVNLVAHCREYKYIALRVNEKKTLNTFNMAKNHTIRFPMPG--KIKTIEMKVNCLIQPQLGCV-LQDFALIQDIAKIFRTGIRLTKCLAEFLQQKDKQNNFQAVLNAVHLAKCFRAKLWKNSPVFKQ 518          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 103.219 bits (256), Expect = 3.115e-22
Identity = 108/407 (26.54%), Postives = 183/407 (44.96%), Query Frame = 1
Query: 1564 ALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHL--SREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXX--XXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYL-------GINERKAVKR-----IELMN-----DLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENE 2721
            ++   +N++   PT  GKT VA + M+RE+          R+D   I+   P  ++V E   S S       + +   +G       R++  +  + + T EK   +     E+   Q + L+++    +      RG  LE  +A+        +++   +I+G+SATL N  D+ +F++ +       + + +RPV + +EY+       G+N +          I L++     D +   V E    H  L+F  ++K   N A+ I  K L +    L  R+++   L+ +   D      L+  +PYG A HH+GL   +R  +EE ++   + +L  TSTLA GVNLPA  VI++      P  G  + LS     QM GRAGR   D+ G  I I N  +
Sbjct:   33 SVRQGKNLIYSLPTSGGKTLVAEILMLRELL-------CKRRDALLIL---PYVAIVQEKVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLVNSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKV------QYTSKTTQIIGMSATLSNINDLQKFLNAEL------YTNDFRPVEL-REYIKLGDSIYGVNNKALCPEEQFDFIRLLSYKMDPDHIVALVTEVIPAHSCLVFCPTKKNCENVAEMIC-KYLAKTRHTLHHREEEKRALLAELQADGELCPVLRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRS-----PYIGN-SFLSRSQYKQMVGRAGRAGIDSSGESITIVNSRD 409          

HSP 2 Score: 83.5741 bits (205), Expect = 3.092e-16
Identity = 91/382 (23.82%), Postives = 162/382 (42.41%), Query Frame = 1
Query: 4120 DENVFIGAPTGSGKTVCAEIAIMR-LFSNRQDARCV--YVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMD---NKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIG-SQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNA---------TRLAAMSKP---VYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASE---AIVSEYMRNIS-NEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVI 5196
             +N+    PT  GKT+ AEI ++R L   R+DA  +  YV  + +         +  FG   +  I+    +       K   K  + ++T E    L     ++  +Q I L +VD+LH++G     G TLE   ++ +Y S       +IIG+S +L+N  D+ ++L+     T +F P      + +    + + + A          RL +       +   + ++ P    +VF PT K  E +A ++  Y    +       E   A+++E   +     +L  T+  G+ + H  L+  ER L+ E +S+ ++ +L  + TL   +   A  VI+    + N         S     QMVGRA  A +D +   I
Sbjct:   37 GKNLIYSLPTSGGKTLVAEILMLRELLCKRRDALLILPYVAIVQE-----KVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLVNSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKVQYTSK----TTQIIGMSATLSNINDLQKFLNA-ELYTNDFRPVELREYIKLGDSIYGVNNKALCPEEQFDFIRLLSYKMDPDHIVALVTEVIPAHSCLVFCPTKKNCENVAEMICKYLAKTRHTLHHREEEKRALLAELQADGELCPVLRRTVPYGLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSPYIGN------SFLSRSQYKQMVGRAGRAGIDSSGESI 402          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Match: BRR2 (RNA-dependent ATPase RNA helicase (DEIH box); required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis; homologous to human U5-200kD [Source:SGD;Acc:S000000974])

HSP 1 Score: 1255.35 bits (3247), Expect = 0.000e+0
Identity = 734/1916 (38.31%), Postives = 1127/1916 (58.82%), Query Frame = 1
Query:  847 ANSEKLNVNDIDAFWLQRTLSKH--FTDPNECQKRTKDIL-EVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSN-----VISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKT--LNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGT-IRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGK-HQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPF-DRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSI----YDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQD-ARCVYVTALNDLAQLRYTEWMKTFGAL--GKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTF-NITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDID-----------------VSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARD-EDNISSVYANNFPYKREESWWLVVGEPNQGHLISIK--LLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            +N E + +  ID F+LQR L     + D +  Q  ++ IL ++  +  N   LE KL+ ++  +   L   + +N+  I++  +L  S   E  N IE          +++A   N     D+V   + R+T     ++ +  +   S+       SN     ++DL+ I F + S LMT     LP+GSF++ KP Y+ + +PAP  KP+  D  L +I  LP + + AF   +T  LN IQSKV+  A E D N+L+CAPTG+GKTN+ALLT+++ +  H N     +    FKIVYIAP+K+LV E    F  RL    +KVA L+GDS LSR++I+ETQ++V TPEKWDI +R S+     +LV+LLIIDEIHLLHD+RGPVLE+IVART  A  S +     RI+GLSATLPN ED+  F+ V K  GLF FDSS+RP P+ Q++ GI ER ++K+++ MND  YEKV+E   + +Q+++FVHSRKET  TA  +K K    +      ++   S  +L+ +   V +  L+ L+  G   HHAGL  +DR+  E+LF D  +QVLV T+TLAWGVNLPAH VIIKGT VY P+KG W +LS  DV+QM GRAGRP+YDT G GI+IT+++ + YYLS+LN+QLPIESQ +SKL DNLNAE+V G ++  +++++WL YTYLY+RM  +P LY V ++   D  L     +L+++A  IL++ E++ +D  +    + ++G IA+ +Y  + +MDV  + L +    I++F++FS   EF+ ++VR E+K E+K+LLE  P+PI+E  +DP  K+N LLQ+Y SQLK E F L+SD  +I Q+A RL+RAMFE+ L + W   T  +L  CK    +MW  +CPLRQFK  P E+ K+LE   +P+ D L  +   E+G  + + K GK +Y  + + PK+++  + QPITRS M+  + I  D+ W    HGS + F + +ED   ++IL+Y+   +       +  L F   +     + LPP +++  +S+ W   E EI + F    LP+K  P T LL+   +    L N+++  ++  K   FN IQ+Q FESLYNS+++VF+G+  G+GKT  AE+A++  +  RQ+  R VY+    +      ++W K F  L  GK + KL  + +++ K ++K+H++++T   +++LSRRW+++K IQ+++L I DD H I     G   E + SR  ++++QLE  IR + LS  L NARD GEW     +  YNF+PS R  PL+I IQ+F ++ H +   + +      +       +   VF+P+ K   E+A   M ++ + + +     E  +  Y+  +++  L   L  GVG +++ ++ N+  ++  L+   ++ +L++S   C +       VI++ T +Y+G +  Y  Y+  +L++MVG A+       + +I+   N K + +KFL EPLP ES+L + +HD  N EI    I++KQD VD+ T+++ Y R+  NP+YY ++  S   +S  LS LVE  L DL  S  I I DD +                 +S ++ G+IA+ Y + + TI+ F  SL   S ++ +L ++  A EFE +PLR G+  +L ++ + L L   E         K  +LLQAY SR+ +   + + DL  IL K V LI   VD+LS+N +L  A  AM+LAQM+ Q  W  D+ L+QIPHFN  K+LE+C+   V+TV+D+M LEDE++  ++   D +L  VA F   YPN++LTY +  S S+ +G +  + I L RD E     V +  +P+ + ESWWLV+GE ++  L +IK   L+  T++  L FD P  SG +  T++ + DSYL  D+E  F INV
Sbjct:  278 SNIESVPIYSIDEFFLQRKLRSELGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGIRLAKSTENEIPNLIE----------KMVAKGLN-----DLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSNPAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPS-KPV-IDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWA--SKYGQEYPRIIGLSATLPNYEDVGRFLRVPKE-GLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDI-SSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNRELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPPTPLLENISISTSELGNDDFSEVFEFKT--FNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHW--RQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFEASAAAAGNRNSSSVFLPSRKDCMEVASAFMKFSKAIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKD-CSAFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKAYYKKFLIEPLPTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGISVFLSNLVETCLNDLVESSFIEI-DDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAYFSRLEL-PVDFQNDLKDILEKVVPLINVVVDILSANGYLN-ATTAMDLAQMLIQGVWDVDNPLRQIPHFNN-KILEKCKEINVETVYDIMALEDEERDEILTLTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWWLVLGEVSKKELYAIKKVTLNKETQQYELEFDTP-TSGKHNLTIWCVCDSYLDADKELSFEINV 2162          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Match: SLH1 (Putative RNA helicase related to Ski2p; involved in translation inhibition of non-poly(A) mRNAs; required for repressing propagation of dsRNA viruses [Source:SGD;Acc:S000003503])

HSP 1 Score: 1061.98 bits (2745), Expect = 0.000e+0
Identity = 657/1828 (35.94%), Postives = 1049/1828 (57.39%), Query Frame = 1
Query:  988 QELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERN--KIEAEMKTDPKSNRILADLRN--IDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNY--GSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADEN-----LVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGT----IRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRI-ELMNDLVYEKVMEYAGK-HQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFL-----RDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDT-KGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXX-XNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGAL-GKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTF--NITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLM---GYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLK-GVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISE------DRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPH----------FNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDD------KLQDVARFF----QCYPNID-LTYEVSKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLV 6288
            QELE +LL  +G    DLV +L +++ MI          TP E     I+  + + P+      D+RN  +   ED     +NRK    +  I+        +V   Y  GS   +      FT            LP G+ R +   +  + +PA       +++N     L+KI+DL  + K  F   +TLN+IQS VY  A +++EN+L+CAPTGAGKT++ALLT++  I +    +G     I+ DDFK++Y+AP+K+L  E+ + FS++L  +N++V  L+GD  L++ EI  TQ+IV TPEKWD+++RK+  +      VKLLIIDE+HLLH++RG V+E +VART+R ++SS S I  RI+GLSATLPN  D+A+F+ V++  G+F FD S+RP P+EQ+ LG   +   ++  E ++ + Y+K+ E   + +QV++FVHSRKETV +A+   +   +   + LF      +DK + +LV      K ++ D+K++  +GF +HHAG+A +DRN  E++F D  I+VL  T+TLAWGVNLPA  VIIKGTQVY   KG + +L   DV+Q+FGR GRP + +  G GI+ T+ + L +Y+SL+ +Q PIES+  SKL DNLNAEI +G+V N+ E+I+WL YTY+++RMRKNP  YG++   + +DP L    R +I  AA  L   +MI FD+ S  FI+ ++GR+++ +Y  NE++++  +       + +V  + S  +EF  I  REE+  E+K+L  E+V   I    + P  K N LLQAYISQ ++    LSSD+ Y++Q++ R+ RA+F + ++++W   +  +L  CK +E+R+WA   PL QF  +P  I +++       + L++ +  ELGELV+N K G  +YK + + PK+N++  + PIT + M++ + + PDF W  + HG +Q FW+FVE+     ILH+E F+L  +  N+ H + F + + DPLPP   ++ VSD WIG E+   I F +++ P      T+LL L+ LP  AL+N   ESIY  K  +FN +QT  F +LYN++EN F+G+PTGSGKT+ AE+AI   F      + VY+  +  L + R  +W K    + G  V++LTG++  D K +  A I+++T E +D +SR W+ +K +Q++ L I+D++HL+ S   G  LE+I SR  Y+SSQ + P+R++G+S +++NA D+  WL       YNF  SVR  PL + I  F  N+      +  M+KPV+  I + SP+ P ++FV + +QT   A  L+   G   + ++      E  +  Y+  ++++ L  +L  G+G  H  L   +R++  +LF    IQIL+ + TL W +   A+LVI+  TQ ++ K   Y D    D++QM+GRA   + D    +++  + +KK F + FL+   P+ES L   L DH  AEI + +I NKQ+A+D+L+WTFL+ R   NP YY ++   S   +S+HLS L+++TL +L  S+C+ +  D D+ A     I+++YYI + TI      +  ++  + +L  +  A E+ +LP+R GE ++   + Q  R  +        +  + DP  K  +LLQA+LSRV +  A+  +D   +L +S+R++QA +DV S   +    L  +++ Q I Q  W+ D  +  +P           F+E   +E       K +  L E+       L+N  D       + +D  + F    Q  P ++ + +E  ++       S   HL+   +N   VY + FP  ++E W+L+
Sbjct:  131 QELEKELLDFLGTGNIDLVSLLLQHRRMIV--------ATPIETTILLIKNAVNSTPEF-LTQQDIRNQVLKSAED----AKNRKLNPATKIIKY------PHVFRKYEAGSTTAMAFAGQKFT------------LPVGTTRMSYNTHEEIIIPAADQA---SNKNYLYTKLLKISDLDHFCKTVF-PYETLNQIQSLVYPVAYKTNENMLICAPTGAGKTDIALLTIINTIKQFSVVNGENEIDIQYDDFKVIYVAPLKALAAEIVDKFSKKLAPFNIQVRELTGDMQLTKAEILATQVIVTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLHEDRGSVIETLVARTLRQVESSQSMI--RIIGLSATLPNFMDVADFLGVNRQIGMFYFDQSFRPKPLEQQLLGCRGKAGSRQSKENIDKVAYDKLSEMIQRGYQVMVFVHSRKETVKSARNFIKLAESNHEVDLFAPDPIEKDKYSRSLV------KNRDKDMKEIFQFGFGIHHAGMARSDRNLTEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQVYDSKKGGFIDLGISDVIQIFGRGGRPGFGSANGTGILCTSNDRLDHYVSLITQQHPIESRFGSKLVDNLNAEISLGSVTNVDEAIEWLGYTYMFVRMRKNPFTYGIDWEEIANDPQLYERRRKMIVVAARRLHALQMIVFDEVSMHFIAKDLGRVSSDFYLLNESVEIFNQMCDPRATEADVLSMISMSSEFDGIKFREEESKELKRLSDESVECQIGSQLDTPQGKANVLLQAYISQTRIFDSALSSDSNYVAQNSVRICRALFLIGVNRRWGKFSNVMLNICKSIEKRLWAFDHPLCQFD-LPENIIRRIRDTKPSMEHLLELEADELGELVHNKKAGSRLYKILSRFPKINIEAEIFPITTNVMRIHIALGPDFVWDSRIHGDAQFFWVFVEESDKSQILHFEKFILNRRQLNNQHEMDFMIPLSDPLPPQVVVKVVSDTWIGCESTHAISFQHLIRPFNETLQTKLLKLRPLPTSALQNPLIESIYPFK--YFNPMQTMTFYTLYNTNENAFVGSPTGSGKTIVAELAIWHAFKTFPGKKIVYIAPMKALVRERVDDWRKKITPVTGDKVVELTGDSLPDPKDVHDATIVITTPEKFDGISRNWQTRKFVQDVSLIIMDEIHLLASDR-GPILEMIVSRMNYISSQTKQPVRLLGMSTAVSNAYDMAGWLGVKDHGLYNFPSSVRPVPLKMYIDGFPDNLAF-CPLMKTMNKPVFMAIKQHSPDKPALIFVASRRQTRLTALDLIHLCGMEDNPRRFLNIDDEEELQYYLSQVTDDTLKLSLQFGIGLHHAGLVQKDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTTGTAIVYTKESKKMFYKHFLNVGFPVESSLHKVLDDHLGAEITSGSITNKQEALDFLSWTFLFRRAHHNPTYYGIEDDTSTAGVSEHLSSLIDSTLENLRESQCVLLHGD-DIVATPFLSISSYYYISHLTIRQLLKQIHDHATFQEVLRWLSLAVEYNELPVRGGEIIMNEEMSQQSRYSVESTFTDEFELPMWDPHVKTFLLLQAHLSRVDLPIADYIQDTVSVLDQSLRILQAYIDVASELGYFHTVLTMIKMMQCIKQGYWYEDDPVSVLPGLQLRRIKDYTFSEQGFIEMTPQQKKKKLLTLEEIGRFGYKKLLNVFDQLTFGMTESEDTKKRFVSVCQRLPVLEGMKFEEQENNEVLTFYSK--HLSSKHNNGFEVYCDKFPKIQKELWFLI 1907          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Match: HFM1 (Meiosis specific DNA helicase; involved in the conversion of double-stranded breaks to later recombination intermediates and in crossover control; catalyzes the unwinding of Holliday junctions; has ssDNA and dsDNA stimulated ATPase activity [Source:SGD;Acc:S000003220])

HSP 1 Score: 272.322 bits (695), Expect = 9.557e-75
Identity = 206/599 (34.39%), Postives = 326/599 (54.42%), Query Frame = 1
Query: 1435 APKPKPL---EADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGD-SHLSREEINETQIIVCTPEKWDIISRKSSEKTYT-QLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKH--RGLFKFDSSYRPVPMEQEYLG--INERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVL-----IDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFL--KKSMGDIEVFKVFSKCAEFRNITVR 3183
            A KPK +   ++ +  +    LP   +  F K    N++QS+ + +  ES+EN ++ +PTG+GKT +  L ++R I K  N+D     ++ KI+YIAP KSL  EM  ++       NL V ML+ D S L  E+  +  II+ TPEKWD+++R+ S+ +   +LVKL+++DEIH + ++RG  LE I+ R     Q      ++R V LSAT+PN ED+A ++  +      +  FD SYR V + +   G   N +   ++  + N  + E + ++A    VLIF  +R  T++TAK +    LN     +F + KK          DK+    L + +  G A HHAG++  DR  VE+ F    I +L STSTLA GVNLPA++VIIKGT+ +  +  E  E S LDV+QM GRAGRPQ++T G  +++T+      Y +L++    +ES L   L ++L AE  + TV +I  +++WLR T+ Y+R  KNP+ Y   N       ++D  ++  C+ L+ T    L K ++I  D  +GE+ S   G     +Y + E+M   K+F+  KK +    +  + +   EF  + VR
Sbjct:  105 AKKPKKVTIRKSAKKCLSTTILPDSFRGVF-KFTEFNKMQSEAFPSIYESNENCIISSPTGSGKTVLFELAILRLI-KETNSD----TNNTKIIYIAPTKSLCYEMYKNWFPSF--VNLSVGMLTSDTSFLETEKAKKCNIIITTPEKWDLLTRRWSDYSRLFELVKLVLVDEIHTIKEKRGASLEVILTRMNTMCQ------NIRFVALSATVPNIEDLALWLKTNNELPANILSFDESYRQVQLTKFVYGYSFNCKNDFQKDAIYNSKLIEIIEKHADNRPVLIFCPTRASTISTAKFL----LNNH---IFSKSKKRCN---HNPSDKI----LNECMQQGIAFHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSW--NSSEIQEYSDLDVLQMIGRAGRPQFETHGCAVIMTDSKMKQTYENLIHGTDVLESSLHLNLIEHLAAETSLETVYSIETAVNWLRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLDT----LVKVKII--DISNGEYKSTAYGNAMTRHYISFESM---KQFINAKKFLSLQGILNLLATSEEFSVMRVR 664          

HSP 2 Score: 227.254 bits (578), Expect = 2.007e-60
Identity = 183/636 (28.77%), Postives = 310/636 (48.74%), Query Frame = 1
Query: 4063 KMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLF----SNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTN-MDNKSISKAHIIVSTAENWDVLSRRWKK-KKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYN---FNPSVRHRPLD--IEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIA-FLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNL--KGVSHRHLSD-HLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQS--LRLPISEDRRLSD----PRTKANILLQAYLSRVPIKAAELKEDLNQILIKS--------VRLIQACVDVL 5880
            K + FN +Q++ F S+Y S+EN  I +PTGSGKTV  E+AI+RL     S+  + + +Y+     L    Y  W  +F  L  +V  LT +T+ ++ +   K +II++T E WD+L+RRW    +  + ++L +VD++H I  +  G +LEVI +R   M       IR + LS ++ N  D+  WL  ++    N   F+ S R   L   +   +FN  ++  + A  +  + + I K + N PV++F PT   T   A FLL  +  S  K               N S++IL E +  G+ F H  +S+ +R  + + F + SI IL  + TL   +   AYLVI+  T+ +N  +    +YS +D++QM+GRA     +    +VIM  +  K   +  +H    LES L   L +H  AE   +T+ + + AV++L  TF Y R  +NP  Y    + VS   + D  +++  +  L  L   K I I +  +  +   G   T +YI + +++ F ++ K    ++ +L L+  + EF  + +RH E  +   I  S  L+ P   +++ S        K ++L+Q  L  +   + E    L+Q L++          RL++  VD  
Sbjct:  135 KFTEFNKMQSEAFPSIYESNENCIISSPTGSGKTVLFELAILRLIKETNSDTNNTKIIYIAPTKSLCYEMYKNWFPSFVNL--SVGMLTSDTSFLETEKAKKCNIIITTPEKWDLLTRRWSDYSRLFELVKLVLVDEIHTI-KEKRGASLEVILTRMNTMCQN----IRFVALSATVPNIEDLALWLKTNNELPANILSFDESYRQVQLTKFVYGYSFNCKNDFQKDAIYNSKLIEIIEKHADNRPVLIFCPTRASTISTAKFLLNNHIFSKSKK----------RCNHNPSDKILNECMQQGIAFHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQ--EYSDLDVLQMIGRAGRPQFETHGCAVIMTDSKMKQTYENLIHGTDVLESSLHLNLIEHLAAETSLETVYSIETAVNWLRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLDTLVKVKIIDISNG-EYKSTAYGNAMTRHYISFESMKQF-INAKKFLSLQGILNLLATSEEFSVMRVRHNEKKLFKEINLSPLLKYPFLTEKKQSQIIDRVSQKVSLLIQYELGGLEFPSYEGASKLHQTLVQDKFLVFRHCFRLLKCMVDTF 749          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Match: SKI2 (Ski complex component and putative RNA helicase; mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay; mutations in the human ortholog, SKIV2L, causes Syndromic diarrhea/Trichohepatoenteric (SD/THE) syndrome [Source:SGD;Acc:S000004390])

HSP 1 Score: 75.0998 bits (183), Expect = 1.132e-13
Identity = 52/175 (29.71%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 2218 VYEKVMEYAGKHQVL---IFVHSRKETVNTAKAIK--EKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELT 2727
             + +++ Y  K ++L   +FV S+K     A  ++    C N++   + +  +K+ T + ++D D  +    + LL  G AVHH GL    +  +E LF+   I+VL +T T A G+NLP   VI   + + + D     EL+  +  QM GRAGR   D+ G  I++   + L+
Sbjct:  613 TWPEIVNYLRKRELLPMVVFVFSKKRCEEYADWLEGINFCNNKEKSQIHMFIEKSITRLKKEDRDLPQILKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIF--SSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVMAYNSPLS 785          

HSP 2 Score: 50.447 bits (119), Expect = 3.761e-6
Identity = 45/194 (23.20%), Postives = 91/194 (46.91%), Query Frame = 1
Query: 4102 ESLYN--SDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLD-CHHTATYNFNPSVRHRPLDIEI 4674
            E++Y+    ++VF+ A T +GKTV AE AI    ++R   + +Y + +  L+  ++ ++ +TF  +   +I  TG+  ++      A+ ++ T E   + S  ++    I++++  I D++H +  Q  G   E +          L   ++ I LS ++ N  +   W+        Y  +   R  PL+I I
Sbjct:  336 EAVYHLEQGDSVFVAAHTSAGKTVVAEYAIA--MAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLI--TGDVQIN----PDANCLIMTTE--ILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEVI-------IMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEINI 512          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Match: MTR4 (ATP-dependent 3'-5' RNA helicase of the DExD/H family; involved in nuclear RNA processing and degradation both as a component of TRAMP complex and in TRAMP-independent processes; TRAMP unwinds RNA duplexes, with Mtr4p unwinding activity stimulated by Pap2p/Air2p but not dependent on ongoing polyadenylation; contains an arch domain, with two coiled-coil arms/stalks and a globular fist/KOW domain, which has RNA binding activity and is required for 5.8S rRNA processing [Source:SGD;Acc:S000003586])

HSP 1 Score: 71.2478 bits (173), Expect = 1.382e-12
Identity = 98/427 (22.95%), Postives = 171/427 (40.05%), Query Frame = 1
Query: 4105 SLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWL------DCHHTATYNFNPS-VRHRPLDI----------EIQTFNITHNATRLAAMSKPVYQTILKLSPNS-------------------------------------PVIVFVPTMKQTEEIAFLL--MGYALSDKKN-----FGRASEAIVSEYMRNISN-EILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIM 5199
            S  +  E+V + A T +GKTV AE AI +   N+Q  R +Y + +  L+  +Y E +  FG +G     +T N +        A  +V T E   + S  ++  + ++ +   I D++H +  +  G    V+   T  +   L   +R + LS ++ NA +  EW+       CH   T NF P+ ++H               E  TF   +    +A++S  +        PNS                                     PVIVF  + +  EE+A  +  + +   D+K      F  A  A++ E  R +   + ++  L  G+G  H  L    + ++  LF    +++L  + T    +   A  V+    + ++G+   +   S  + IQM GRA    +DD   VIM
Sbjct:  159 SCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQ--RVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPD--------AGCLVMTTEI--LRSMLYRGSEVMREVAWVIFDEVHYMRDKERG----VVWEETIIL---LPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYT-NFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGD-----DPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAI-ALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRW--VSGGEYIQMSGRAGRRGLDDRGIVIM 557          

HSP 2 Score: 69.3218 bits (168), Expect = 5.911e-12
Identity = 70/283 (24.73%), Postives = 122/283 (43.11%), Query Frame = 1
Query: 2032 MRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQE---------YLGINER---------KAVKRIELM-------NDLVYEKVMEYAGK----------------------HQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHD-----LKDLLPY---GFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNE 2715
            +R V LSAT+PN  + AE+I     +      +++RP P++           YL ++E+         KA+  I           D   +K   Y G                       + V++F  S+++    A  + +   N D       +K+A T +    +  +   D     +K +LP    G  +HH+GL    +  +E LF +  ++VL +T T + G+N+PA  V+   T V + D  ++  +S  + +QM GRAGR   D +G+ IM+ +E
Sbjct:  287 VRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDD------EKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVF--TSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDE 561          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Match: EDO49146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH22])

HSP 1 Score: 2212.57 bits (5732), Expect = 0.000e+0
Identity = 1124/2167 (51.87%), Postives = 1555/2167 (71.76%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQ-QKFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXX-XSESDD---GGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVIS---NYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPG--YNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDK--KNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDA-RSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDV----ILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLM----ELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEV--SKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDRRS+DE TGEV+  +  +   +MG +  + KP   EE++ KR ++          +  S+L+ +V       Y PKT ETKS YE +L+ +   + +    +I     DE+L  LK+  + DKE+ K    LLG+ + D ++  LV+L  K+TDY   + ++N++        + +  D++EEE+    ++  +SES+D   G VEA+TN TL       G +S+                QK  A+S+ L+  DIDAFWLQR L+K++ D    + +++++ E+LK A +++ELENKL+ ++G D+F  +R+LR+N+ M+ YCT L  +Q+ +E+ +IEA+M+ DP   +IL  L   D K D++  ER RK   R A+I AD++  +S+ +      G+  +LDL+ + F  GSHLM NK C+LP G+FRK +PG  Y  V VPA KPKP E  E L  I  LP Y +AAFE   TLNRIQS++ +TAL SDEN+LLCAPTGAGKTNVALLT++REIGKHIN DGTI  ++FKI+Y+APM+SLV EM  +FS+RL +Y L V+ L+GD +L++E+I+ TQIIVCTPEKWDII+RKS E+T+TQLV+L+IIDEIHLLHD+RGPVLE++VART+R ++++   +  R+VGLSATLPN ED+A F+ V+  +GLF FD+S+RPVP+EQ+++GI E+K +KR++  N++VYEKV+E+AGK+QVL+FVHSRKET  TAKA+++ CL RD+LGLFLR+  AST VL+ + ++VKN +LKDLLPYGFA+HHAG++  DR  VE+LF D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG W EL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSL+N+QLP+ESQ ISKLADNLNAE+V+G+V+   +++ WL YTYLYIRM +NP+LYG+ +  I+ DP L+    +LI++AAS+L+K  ++ +DK+SG F   E+GRIA++YY T+ET+      LK ++ +IE+F+VFS  +EF+ I VREE+K+E+ KLLE VP+P+KE  E+P  K+N LLQ++ISQLKLE F L SD  YI+QSA RL+RA+FE+ L++ WA L    L   K +++RMW    PLRQFKK+P E+ KK+EKK  P++R  D   +E+GELV+  K+GKT++K +HQ+PK+ L  H+QPITRST+ VELT+TPDF+W  K HG+S+ FWI VEDV SE ILH+EYFLLK K+  D+H++KF+V +++PLPP Y+IR VSD+W+G ET++ + F +++LPEKN P TELLDLQ LP  ALRN  +E++Y  K  +FN IQTQ F +LY+S ENVFIGAPTGSGKT+CAE A++R      + RCVYVT +  LA+  Y +W   FG  LGK V+ LTG T+ D K ++K +++VST E WDVLSRRWK++K +QN+ LFI+D+ HLIG    G  +E+ICSR RY+SSQLE  IRI+ LS SL NA+DV +WL    T  +NF+P+VR  PL++ IQ FNITH ++RL AM+KPVYQ I+K SP  P +VFVP+ +QT+ +A  ++ ++ +D   + F   +E  ++ ++  ++++ L ET++ G+ F+HE LS  E  ++ +LF+S +IQ++VVS TLC S+   A+LV+VMDTQ Y GK   Y DY   D++ M+G A+   +DDA ++VI+CQ +KK+F +KFL+EPLP+ESHLDH LHDHFNAE+VTKTIENKQDAVDYLTWTFLY RMT NPNYYNL+GV+HRHLSDH+SELVENTL DLE SKC++++D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I +A+E+  L +RH E+     +L R+   +  P     + +DP  K N+L+QA++SR+ + + EL+ D   IL K++RLIQACVDVLSSN WL PALAAMELAQM TQA W +DS LKQIPHF  P +++RC    V++VFD+M     L  +Q  + +       QDVARF   YPNI+L++E+     +  G  V++ + L R+++   +V A  FP KREE WWLV+G+        +    S  +  +L+F AP   G+Y Y L+FM D+Y+GCDQEY F I V
Sbjct:    1 MADATARSLQYEYKANSNLVLQADRSLIDRRSRDEATGEVVSLVGHLGGMRMGDKYERTKPPVSEERKAKR-QKIADKEEFAKLRGSSLLSEEVEDLTGVRYRPKTRETKSTYEVLLSFIQAAIGDQP-RDILCGAADEVLASLKDDKMKDKEKLKEIVSLLGD-MPDERFALLVNLGKKITDYTFDRDYSNDDEVIDETYGVAVQFDEDEEEEKEDFDMVRESESEDETEGMVEAETNMTLQ------GGLSE---------------SQK--ASSDTLHPRDIDAFWLQRELNKYYADAEASRSKSEEVQEILKSANDERELENKLMLLLGHDKFSFIRLLRKNRNMVLYCTLLATAQSSKEKKEIEAKMEADPDLAQILHALNETD-KGDLIQEERARKAANRKARIAADLDALESDQVRMQFTRGARKVLDLEELAFKDGSHLMANKQCQLPVGTFRKQRPGKGYEEVHVPALKPKPFETGEQLTPITSLPMYAQAAFEGYPTLNRIQSRLCETALNSDENLLLCAPTGAGKTNVALLTILREIGKHINLDGTINTEEFKIIYVAPMRSLVQEMVLNFSKRLSTYGLTVSELTGDHNLTKEQIHGTQIIVCTPEKWDIITRKSGERTFTQLVRLIIIDEIHLLHDDRGPVLESLVARTIRQIETTQELV--RLVGLSATLPNYEDVATFMRVNPAKGLFFFDNSFRPVPLEQQFIGITEKKPIKRMQATNEVVYEKVVEHAGKNQVLVFVHSRKETAKTAKAVRDMCLERDSLGLFLREDSASTEVLRSEAEQVKNGELKDLLPYGFAIHHAGMSRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWVELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLMNQQLPVESQFISKLADNLNAEVVLGSVQTAKDAVHWLGYTYLYIRMLRNPALYGISHDEIEKDPLLEQRRADLIHSAASLLDKNNLLKYDKKSGNFQVTELGRIASHYYLTHETVSTFNNLLKPTLSEIELFRVFSLSSEFKYINVREEEKLELNKLLERVPIPVKESIEEPSAKVNVLLQSFISQLKLEGFALMSDMVYITQSAGRLVRAIFEIVLNRGWAQLADKALCLSKMIDKRMWLSMTPLRQFKKIPMEVIKKIEKKEFPWERYYDLGPNEIGELVHMPKLGKTLHKLVHQLPKMELATHIQPITRSTLSVELTVTPDFQWDEKVHGNSEAFWILVEDVDSEIILHHEYFLLKAKYAQDEHVVKFFVPVFEPLPPQYFIRIVSDRWLGSETQLPVSFRHLILPEKNQPPTELLDLQPLPVSALRNPAFEALYRDKFPYFNPIQTQVFSTLYDSSENVFIGAPTGSGKTICAEFAVLRFLQQSPEGRCVYVTPIQALAEQVYADWQNKFGLQLGKNVVMLTGETSADLKLLAKGNVVVSTPEKWDVLSRRWKQRKNVQNVSLFIMDEAHLIGGD-TGPVMEIICSRMRYISSQLERTIRIVALSSSLANAKDVAQWLGVPSTGLFNFHPNVRPVPLELHIQGFNITHTSSRLIAMTKPVYQAIMKHSPKKPAVVFVPSRRQTKLLALDILTFSGADNEPQRFLHCTEDDLNPFVSRLTDKTLKETVTYGIAFLHEGLSDAEVKIVNQLFTSGAIQVVVVSRTLCLSVNLSAHLVVVMDTQFYEGKTHSYADYPVTDVLHMIGHASRPLLDDAGKAVILCQASKKEFFKKFLYEPLPIESHLDHTLHDHFNAEVVTKTIENKQDAVDYLTWTFLYRRMTLNPNYYNLQGVTHRHLSDHMSELVENTLNDLEQSKCVSVEDEMDVTPLNLGMIAAYYYINYTTIELFSVSLNAKTKLRGLVEIISSASEYAPLSIRHHEEATLKQLLNRVPHKITSP-----KFNDPHVKTNLLIQAHMSRMQL-SPELQSDTELILSKAMRLIQACVDVLSSNGWLSPALAAMELAQMATQAMWSKDSYLKQIPHFT-PDIIKRCVEKEVESVFDIMFCIITLATQQFDSTLLIITILFQDVARFCNRYPNIELSFEIPDKNQIKTGRPVNMTVDLEREDEQPGAVIAPFFPQKREEGWWLVIGDTKANRYEPLAPSISRQDTPTLDFVAPSSPGTYSYVLFFMCDAYMGCDQEYPFKITV 2130          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Match: EDO46714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC5])

HSP 1 Score: 1314.29 bits (3400), Expect = 0.000e+0
Identity = 707/1761 (40.15%), Postives = 1065/1761 (60.48%), Query Frame = 1
Query: 1345 GSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSS-EKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGK-HQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENV-LIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN--VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEK--FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFG-ALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGY--ALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDD-IDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKL--LERCEAAGVKTVFDLMELEDEQKLALMN-----FPDDKLQDVARFFQCYPNIDLTYEVSKSVSAG-----GQVSVQIHLARDEDNISSVYANN---------------------------FPYKREESWWLVVGEPNQGHLISIKLLS--SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            G+  +      LP  + RK    Y  V +P     P  A ++ V I+ L    + AF+  K+LNRIQS VY +A  ++EN+L+CAPTGAGKTN+A++T++REI ++I   G I+KD FKIVY+APMK+L  EM  +FS+RL    + V  L+GD  L++ EI +TQ++V TPEKWD+++RKS+ +    QLVKLLIIDE+HLLHD+RG V+E +VART+R + SS S I  RIVGLSATLPN  D+A F+ VD ++GLF FDS +RPVP+ Q ++G+      ++   M+ + YEKV E   K +QV++FVH+R  TV TA  ++E   N+    LF  ++        + + + +N  L+DL P GF  HHAG+  TDR  VE+ F    I+VLV T+TLAWGVNLPAH VIIKGT+VY   KG + +L  LDV+Q+FGRAGRPQ+D  G G +IT  + L++YLSLL  Q PIES L + L D+LNAEI +GTV N++E+++WL Y+YLYIRM KNP +YG+ +    DDPTL+N+ R LI + A  L+KA MI F +  G   + ++GR A+++Y   +T++   +  +  +   E+ ++ S   EF  I VRE++  E+++ L    V +P+K G E+   K+N LLQ YIS+ ++E F+L SD  Y++Q+ ARL+R +FE+ L + +  L   +L   K +E+R+W    PL+QF  +  EI  KLE +    ++L D    E+G LV++ +MG T+   +++ P +++   +QPITR+ ++V LTIT +FEW  ++HGSS+ +WI+VED  + +I H EY LL++K     +   L F + I++PLPP YY+ AVSD+W+G ET   I F +++LPE++ P TELLDLQ LP  AL N  YE +Y  K + FN +QTQ F ++YNSD NV +GAPTGSGKT+ AE+AI RLF     A+ VY+  L  L + R  +W   FG  LGK VI+LTG+   D++SIS+A +IV+T E WD +SR W+ +  ++ + L I+D++HL+G +  G  LEVI SRT ++SS  +  +R++GLS +L NARD+ +WL       +NF PSVR  PL++ I  F   H   R+A M+KP ++ I   SP  P +VFV + +QT   A  L+ +  A  D K +    E  + + +  + +  L   LS G+G  H  L   +R+++ ELF +Q IQ+L+ + TL W +   A+LV++  T+ ++GK C Y D+   D++QM+GRA     DD  ++VI+    KK F +KFL+EP P+ES L   L DH NAE+V  TI +KQDA+DY+TWT+ + R+  NP YY+L+   H  ++ +LS LVE+   +LE S C+   +D + +S      IA++YY+++ T+ M    L  +  +  LLE++  A E+ +LP+RH ED I + + + L L ++         TK N+L QA+ SR+ + +++   D   +L +++R++QA +DV +   WL  AL  M + QM+ QA+W  D  L  +P      L    R     ++++ +L+     +K  L N         +++ +    +  P + L+ ++  +   G      +  V+  L    DN  +V+A+                            FP  + E WWLV+G+ + G L+++K L     T   +L+F  P + G    T+Y MSDSYLG DQ+Y     V+
Sbjct:  420 GASFVAGSKIALPTDAKRKITKSYEEVSIPPSTGPPPGAGDHRVPISQLDEIGQIAFQGTKSLNRIQSIVYDSAYNTNENLLICAPTGAGKTNIAMMTIVREIKQNIE-QGVIKKDKFKIVYVAPMKALAAEMVRNFSKRLAGLGISVRELTGDMQLTKMEILKTQMLVTTPEKWDVVTRKSTGDVALAQLVKLLIIDEVHLLHDDRGSVIECLVARTLRQVLSSQSMI--RIVGLSATLPNYLDVAHFLRVDPYKGLFAFDSRFRPVPLGQTFIGVKGLNPFQQAHEMDKICYEKVTENVEKGYQVMVFVHARNATVRTAMTLREMASNQGDSMLFRAEQAPDYGSALKQVMRSRNKQLRDLFPDGFGTHHAGMLRTDRTMVEQYFAKGLIKVLVCTATLAWGVNLPAHAVIIKGTEVYDAKKGSFVDLGILDVLQIFGRAGRPQFDKFGEGTIITAHDRLSHYLSLLTRQAPIESTLTASLTDSLNAEICLGTVTNVNEAVEWLSYSYLYIRMIKNPLVYGIPHKDKEDDPTLENYRRQLIVSTARKLDKARMIRFAEEQGYLSATDLGRTASHFYIKYDTIEEFNERFRPDLAMPEILEMLSHAGEFEQIKVREDELSELEEHLHEDCVVIPVKGGVENTYGKVNILLQTYISRGRVESFSLVSDLGYVAQNGARLIRGLFEIALRRGYPVLANRLLTLSKCIEKRLWPEEHPLKQFTTLSPEILNKLEGRKASLEKLRDMVPEEIGHLVHHVRMGHTVKSCVNRFPAISIAASIQPITRTVLRVRLTITAEFEWNDRAHGSSEPWWIWVEDPENSHIYHSEYLLLQKKQVLSEEPQSLVFTIPIFEPLPPQYYVHAVSDRWLGAETVCAISFQHLILPERHPPHTELLDLQPLPISALHNVSYELLY--KFTHFNPVQTQVFHTVYNSDHNVLLGAPTGSGKTIIAELAIFRLFDKYPGAKAVYIAPLKALVRERMDDWKVRFGRKLGKRVIELTGDVTPDSRSISQADLIVTTPEKWDGISRSWQTRSYVKQVNLLIIDEIHLLGDE-RGPVLEVIVSRTNFISSHTDKKVRVVGLSTALANARDLADWLGIGSAGMFNFRPSVRPVPLEVHITGFPGKHYCPRMATMNKPTFEAIRIHSPTKPTLVFVSSRRQTRLTALDLIAFLAAQDDPKQWLHMPEEEMEQVLHAVRDSNLKLVLSFGIGLHHAGLHERDRSVVEELFVNQKIQVLIATSTLAWGVNFPAHLVVIKGTEYFDGKKCRYVDFPITDVLQMMGRAGRPQYDDQGKAVILVHDVKKHFYKKFLYEPFPVESSLLEVLADHLNAEVVAGTITSKQDAMDYMTWTYFFRRLVMNPTYYDLQDTDHDSVNKYLSRLVESAAAELELSGCLNTGEDSVSLSPTTAAHIASYYYLNHLTLRMLKERLHADCSLPDLLEVLSEAHEYSELPVRHNEDAINSDLAKELPLEVNP-HTFDSAHTKTNLLFQAHFSRLALPSSDYFTDQKSVLDQAIRILQAMIDVAADEGWLATALRIMHVGQMVVQARWLHDCSLLTLPGIQAQHLSGFRRPNGDQIQSLPELVHAVSARKSILDNALRGMVSSQEIEQIHSVLRRLPMLALSIKLRGAWEEGDGAKKAEKPVRTDLVGLHDNWVTVHADQEYAMKVSLKRLSASFRVSTDAKVHAPCFPKVQTEGWWLVLGDTDTGELMALKRLGPVQGTTTATLSFYTPEEEGRKILTVYLMSDSYLGIDQQYDLFFEVI 2173          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Match: EDO26736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB80])

HSP 1 Score: 107.842 bits (268), Expect = 2.883e-27
Identity = 48/115 (41.74%), Postives = 82/115 (71.30%), Query Frame = 1
Query:  850 NSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDR 1194
            +S+ L+  DIDAFWLQR L+K++ D    + +++++ E+LK A +++ELENKL+ ++G D+F  +R+LR+N+ M+ YCT L  +Q+ +E+ +IEA+M+ DP   +IL  L   D+
Sbjct:    1 SSDTLHPRDIDAFWLQRELNKYYADAEASRSKSEEVQEILKSANDERELENKLMLLLGHDKFSFIRLLRKNRNMVLYCTLLATAQSSKEKKEIEAKMEADPDLAQILHALNETDK 115          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Match: EDO34884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN39])

HSP 1 Score: 105.916 bits (263), Expect = 1.687e-23
Identity = 91/340 (26.76%), Postives = 169/340 (49.71%), Query Frame = 1
Query: 2677 YDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLK----KSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFE-VTLSKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNI-PFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKI 3657
            +DT    +++T   +   Y SLL+    IES L   L ++LNAEIV+ T+ ++  +++WL+ T+L+IR++KNP+ Y            D   +NL     + LE++ ++  +    +   +E G + A YY      D +K+FL     +++ D+ +  + SKC EF ++ +R  +K  +  L ++     V  P+    +    KINCL+QA +  L +  F+L+ D   I +S  R+ R + E + L   + +L  ++L + K ++ R+W  S  + RQ +KV   ++  L    +  F ++ +    E+  +VN H   G  I   +   PK  + +
Sbjct:  143 FDTSATAVILTTTTKKDKYSSLLHGTQQIESSLHRHLIEHLNAEIVLHTITDVSVALEWLKSTFLFIRIQKNPTYY------------DMCIQNL-----NTLERSNLVKMED-GFDLKPSEPGCLMARYYI---AFDSIKEFLAIQGTETLSDMVI--LLSKCKEFADVKLRVSEKRILNTLNKDKHKATVRFPVNGKIKTTDQKINCLIQATLGCLPITEFSLNQDVTKIFRSGQRVTRCLMELLMLRGDYRALQNAILVT-KCMKSRLWENSLYVSRQLEKVGMTLSTMLVNAGLTTFKKIEETNPREIELIVNRHPPFGSQIRDAVLAFPKYEVSV 458          

HSP 2 Score: 100.523 bits (249), Expect = 1.030e-21
Identity = 71/238 (29.83%), Postives = 119/238 (50.00%), Query Frame = 1
Query: 5182 ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRI-----KQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVL 5880
            A +VI+  T KKD     LH    +ES L   L +H NAEIV  TI +   A+++L  TFL+ R+ +NP YY++               ++N L  LE S  + ++D  D+     G +   YYI + +I+ F L+++    +  ++ L+    EF D+ LR  E  IL  +     K ++R P++   + +D   K N L+QA L  +PI    L +D+ +I     R+ +  +++L
Sbjct:  147 ATAVILTTTTKKDKYSSLLHGTQQIESSLHRHLIEHLNAEIVLHTITDVSVALEWLKSTFLFIRIQKNPTYYDM--------------CIQN-LNTLERSNLVKMEDGFDLKPSEPGCLMARYYIAFDSIKEF-LAIQGTETLSDMVILLSKCKEFADVKLRVSEKRILNTLNKDKHKATVRFPVNGKIKTTD--QKINCLIQATLGCLPITEFSLNQDVTKIFRSGQRVTRCLMELL 366          

HSP 3 Score: 52.7582 bits (125), Expect = 1.295e-6
Identity = 39/135 (28.89%), Postives = 63/135 (46.67%), Query Frame = 1
Query: 1960 RGPVLEAIVARTMRAMQSSHSNI-----------DMRIVGLSATLPNTEDIAEFIHVDKH-RGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYE---KVMEYAGKHQVLIFVHSRKETVNTAKAIKEK 2319
            RG  +EA+++R    M++  +NI            MR++ +SAT+PN EDIA ++   KH    +  D SYRPV + +  LG      +   +    L Y+    V  Y+ +   L+F  S    + T    K+K
Sbjct:   30 RGATVEAVISR----MKTVQTNITRNTNKLQFKASMRLIAISATIPNVEDIAAWLGSLKHPASSYSMDDSYRPVKLRKVVLGFPMHANMSEFKFDLSLNYKISGIVHTYSDQKPTLVFDTSATAVILTTTTKKDK 160          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Match: EDO44748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT3])

HSP 1 Score: 104.76 bits (260), Expect = 1.817e-22
Identity = 119/434 (27.42%), Postives = 189/434 (43.55%), Query Frame = 1
Query: 1510 AFEKIKTLNRIQSKVYK-TALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDS--HLSREEINETQIIVCTPEKWD-IISRKSSEKTYTQL-VKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINE-----------------RKAVKRIELMNDLVYEK--------VMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNH---DLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRP--DKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMI 2706
            A+  I+ L   Q    K  A++   N++   PT  GKT VA + MM+E+  H        KD   +V + P  S+V E   + ++        V   +G       R+   +  + + T EK + +++    EK    L + ++    +      RG  LE  +A+T+       S   ++IVG+SATL N  D+ +F+  +       + + +RPV + QEY+ ++                     V+RI    D  + K        V+E   +H  LIF  ++K   N AK + E  L R+      + K    + L Q L    N     LK  +PYG A HH+GL   +R  +E+ ++   +  L  TSTLA GVNLPA  VI++   + R    K ++         QM GRAGR   D+ G  I+I
Sbjct:   14 AYRGIQNLYEWQDACLKLPAIQEKRNLIYSLPTSGGKTLVAEILMMKELLVH-------HKD---VVLVLPFVSIVQEKVKTITQFAVELGFVVEEYAGSKGKFPPRKRRTKRALYIATIEKANSLVNSLIEEKRMDDLGLIVVDELHMLGEGGGRGATLEMCLAKTL------FSTNHIQIVGMSATLSNIGDLQKFLMAEV------YSNDFRPVEL-QEYVKVDNIVYKVPCSSSKSEADEIYVQVRRIGHSPDQRHIKDPDHLVPLVLEVIPQHSCLIFCATKKNCENVAKLMVE-FLPRE----MTQVKIGERMELLQALHHQANGLCPVLKKSVPYGIAYHHSGLTMDERKLIEDAYSQGVLCALTCTSTLAAGVNLPAKRVILRAPYIGRNIIRKSQYK--------QMIGRAGRAGIDSTGESILI 411          

HSP 2 Score: 82.4185 bits (202), Expect = 1.578e-15
Identity = 100/447 (22.37%), Postives = 197/447 (44.07%), Query Frame = 1
Query: 4126 NVFIGAPTGSGKTVCAEIAIMR-LFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNM--DNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIG-SQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNP-------------------SVRHRPLDIEIQTFNITHNATRLAAMSKP--VYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVS-EYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQK-FLHEPLPLESHLDHQLHDHFNAEIVT----KTIENKQDAVDYLTWTFL 5364
            N+    PT  GKT+ AEI +M+ L  + +D   V V     + Q +     +    LG  V +  G+       K  +K  + ++T E  + L     ++K + ++ L +VD+LH++G     G TLE+  ++T + ++     I+I+G+S +L+N  D+ ++L      + +F P                   S +    +I +Q   I H+  +   +  P  +   +L++ P    ++F  T K  E +A L++ +   +  +   G   E + +  +  N    +L +++  G+ + H  L+++ER L+ + +S   +  L  + TL   +   A  VI+     Y G++ +          QM+GRA  A +D    S+++ +T  K  +   F  E    +S L +Q +       +T    K  + K + V +L+ T +
Sbjct:   39 NLIYSLPTSGGKTLVAEILMMKELLVHHKDV--VLVLPFVSIVQEKVKTITQFAVELGFVVEEYAGSKGKFPPRKRRTKRALYIATIEKANSLVNSLIEEKRMDDLGLIVVDELHMLGEGGGRGATLEMCLAKTLFSTNH----IQIVGMSATLSNIGDLQKFL-MAEVYSNDFRPVELQEYVKVDNIVYKVPCSSSKSEADEIYVQVRRIGHSPDQ-RHIKDPDHLVPLVLEVIPQHSCLIFCATKKNCENVAKLMVEFLPREMTQVKIGERMELLQALHHQANGLCPVLKKSVPYGIAYHHSGLTMDERKLIEDAYSQGVLCALTCTSTLAAGVNLPAKRVILRAP--YIGRNIIRKSQYK----QMIGRAGRAGIDSTGESILIIKTTDKHKVAPLFSGEFDSCQSSLPYQEYKGLRTLFLTLLGLKICQTKSELVSFLSRTLM 471          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 2315.04 bits (5998), Expect = 0.000e+0
Identity = 1153/2155 (53.50%), Postives = 1585/2155 (73.55%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLP-IKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQ-KFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXX----XXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK--SVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            MAD  AR++Q+EYK NSNLVL ADR+LIDR  +DEPTGEVL  +  ++  KMG +  + +P  +E++++KR KRD+    ++  K  ++L+  + +     Y PKT ET+  YE +L+ ++  L +    +I     DE+L  LKN  + DKER++  ++LLG +  DT+Y+ LV+L  K+TDY   K   N ++        ++  E D+++ +E      + + S+ D  G EA   TTL+ +    G +  V                      + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ +I  +M++DP+ ++IL  L+  + KEDI+  E++R+ + R +++  D+E  D++   +     +LDL+++TFTQGSH M NK C+LPDGSFRK + GY  V VPA KPK    +E LV I  LP Y +A FE  KTLNRIQSK++K+A+++DEN+L+CAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SFS+RL SY + V+ L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE+++ART+R ++ +    D+R++GLSATLPN ED+A  + VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF+D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ+++KL D LNAEIV+G V+ + ++++WL YTYLY+RM +NP+LYG+ ++    DP L+    +LI+TAA++L+K  ++ +DKR+G F   ++GRIA+++Y T++++    + LK ++ +IE+F+VFS  +EF+NI VREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   +  CK +++RMW    PLRQFKK+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+HQ P+L+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +E++Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K  II+ST + WD+LSRRWK++K +QN+ LFIVD+ HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+D+  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY  I+K SP+ P +VFVP+ +QT   A  ++ +  +D   + F   +E  +  ++  I++  L ETL+ GVG++HE LS  ER ++ +LF+S ++Q++V S +LCW I   A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN   +DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+P+F     ++RC   GV+++FD+ME+EDE +  L+   D ++ DVARF   YPNI+L YEV +  ++ +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    1 MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTKMGDKAQRTRPQNLEDRRNKRRKRDEDRHDINKMKGFTLLSEGIDEMVGIVYKPKTKETRETYEVLLSFIHAALGDQP-RDILCGAADEVLAVLKNDKIRDKERRREVEQLLGPS-DDTRYHVLVNLGKKITDYGGDKELQNMDDNIDDTYGVNVQFESDEEEGDENPFGEVQDEQSDEDSEGEEAVVTTTLSANLGETGDVMTV--------------------KKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKILRQHRRMIQYCTMLASAQSEAEKERIIGKMESDPELSKILYKLQETE-KEDIIREEQSRRERVRKSRVD-DLEAMDTDHGESVMPRQILDLEDLTFTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKAFADNEVLVSIDKLPKYAQAGFEGFKTLNRIQSKLFKSAMDTDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFSKRLASYGITVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQD--DVRLLGLSATLPNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVAKLPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYGISQDDRSADPLLERRRMDLIHTAANVLDKNSLVKYDKRTGAFQVTDLGRIASHFYITHDSVQTYNQLLKPTLSEIELFRVFSLSSEFKNINVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFKKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPRLDLAVHLQPITRSTLKVELTITPDFQWDDKIHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRMVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVTALRNSAFEALYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNTEGRCVYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETSTDLKLLGKGDIIISTPDKWDILSRRWKQRKNVQNVSLFIVDEAHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDMAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMKHSPSKPAVVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLVPFLEKINDPTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPYFTSEH-IKRCTDKGVESIFDIMEMEDEDRSGLLQLTDAQMADVARFCNRYPNIELAYEVVERDNIKSGSPVLVQVQLEREEEVTGPVVAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-AMGIHNYTLYFMSDAYMGCDQEYKFSVDV 2124          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 2257.64 bits (5849), Expect = 0.000e+0
Identity = 1111/2054 (54.09%), Postives = 1519/2054 (73.95%), Query Frame = 1
Query:  340 YAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXX----XXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGV-ENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK--SVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            Y PKT ET+  YE +L+ ++  L +    +I     DE+L  LKN  + DKER++  ++LLG +  DT+Y+ LV+L  K+TDY   K   N ++        ++  E D+++ +E      + + S+ D  G EA   TTL+ +    G +  V                      + L+  DIDAFWLQR LS+ + D    QK+  ++LE+LK A +D+E EN+L+ ++G + FD +++LR+++ MI YCT L  +Q+  E+ +I  +M++DP+ ++IL  L+  + KEDI+  E++R+ + R +++  D+E  D++   +     +LDL+++TFTQGSH M NK C+LPDGSFRK + GY  V VPA KPK    +E LV I  LP Y +A FE  KTLNRIQSK++K+A+++DEN+L+CAPTGAGKTNVAL+ M+REIGKHIN DGTI  DDFKI+YIAPM+SLV EM  SFS+RL SY + V+ L+GD  L +EEIN TQIIVCTPEKWDII+RK  E+TYTQLV+L+IIDEIHLLHD+RGPVLE+++ART+R ++ +    D+R++GLSATLPN ED+A  + VD  +GLF FD+S+RPVP+EQ Y+GI E+KA+KR ++MN++VYEK+ME+AGK+QVL+FVHSRKET  TA+AI++ CL +DTLGLFLR+  AST VL+ + ++ KN +LKDLLPYGFA+HHAG+   DR  VE+LF+D+HIQVLVST+TLAWGVNLPAH VIIKGTQVY P+KG WTEL ALD++QM GRAGRPQYDTKG GI+IT+  EL YYLSLLN+QLPIESQ+++KL D LNAEIV+G V+ + ++++WL YTYLY+RM +NP+LYG+ ++    DP L+    +LI+TAA++L+K  ++ +DKR+G F   ++GRIA+++Y T++++    + LK ++ +IE+F+VFS  +EF+NI VREE+K+E++KLLE VP+P+KE  E+P  KIN LLQA+ISQLKLE F L +D  Y++QSA RLMRA+FE+ L++ WA LT   +  CK +++RMW    PLRQFKK+P E+ KK+EKKN PF+RL D  H+E+GEL+   KMGKTI+KY+HQ P+L+L +HLQPITRST+KVELTITPDF+W  K HGSS+ FWI VEDV SE ILH+EYFLLK K+  D+H++ F+V +++PLPP Y+IR VSD+W+  ET++ + F +++LPEK  P TELLDLQ LP  ALRN  +E++Y  K  FFN IQTQ F ++YNSD+NVF+GAPTGSGKT+CAE AI+R+  +  + RCVY+T +  LA+  + +W + F   L K V+ LTG T+ D K + K  II+ST + WD+LSRRWK++K +QN+ LFIVD+ HLIG + NG  LEVICSR RY+SSQ+E PIRI+ LS SL+NA+D+  WL C  TAT+NF+P+VR  PL++ IQ FN++H  TRL +M+KPVY  I+K SP+ P +VFVP+ +QT   A  ++ +  +D   + F   +E  +  ++  I++  L ETL+ GVG++HE LS  ER ++ +LF+S ++Q++V S +LCW I   A+LVIVMDTQ YNGK   Y DY   D++QMVG+AN   +DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+P+F     ++RC   GV+++FD+ME+EDE +  L+   D ++ DVARF   YPNI+L YEV +  ++ +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:   19 YKPKTKETRETYEVLLSFIHAALGDQP-RDILCGAADEVLAVLKNDKIRDKERRREVEQLLGPS-DDTRYHVLVNLGKKITDYGGDKELQNMDDNIDDTYGVNVQFESDEEEGDENPFGEVQDEQSDEDSEGEEAVVTTTLSANLGETGDVMTV--------------------KKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKILRQHRRMIQYCTMLASAQSEAEKERIIGKMESDPELSKILYKLQETE-KEDIIREEQSRRERVRKSRVD-DLEAMDTDHGESVMPRQILDLEDLTFTQGSHFMANKRCQLPDGSFRKQRKGYEEVHVPALKPKAFADNEVLVSIDKLPKYAQAGFEGFKTLNRIQSKLFKSAMDTDENLLVCAPTGAGKTNVALMAMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFSKRLASYGITVSELTGDHQLCKEEINATQIIVCTPEKWDIITRKGGERTYTQLVRLIIIDEIHLLHDDRGPVLESLIARTIRNVELTQD--DVRLLGLSATLPNYEDVATCLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFSDRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVAKLPDMLNAEIVLGNVQTVKDAVNWLGYTYLYVRMLRNPTLYGISQDDRSADPLLERRRMDLIHTAANVLDKNSLVKYDKRTGAFQVTDLGRIASHFYITHDSVQTYNQLLKPTLSEIELFRVFSLSSEFKNINVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTMNLCKMIDKRMWQSMSPLRQFKKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHQFPRLDLAVHLQPITRSTLKVELTITPDFQWDDKIHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRMVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVTALRNSAFEALYQNKFPFFNPIQTQVFNAVYNSDDNVFVGAPTGSGKTICAEFAILRMLLHNTEGRCVYITPMEALAEQVFVDWHQKFQDILNKKVVLLTGETSTDLKLLGKGDIIISTPDKWDILSRRWKQRKNVQNVSLFIVDEAHLIGGE-NGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDMAHWLGCSTTATFNFHPNVRPVPLELHIQGFNVSHTQTRLLSMAKPVYHAIMKHSPSKPAVVFVPSRRQTRLTAIDILTFCAADVVPQRFLHCTEKDLVPFLEKINDPTLKETLANGVGYLHEGLSATERKIVEQLFNSGAVQVVVSSRSLCWGISISAHLVIVMDTQYYNGKIHAYVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPYFTSEH-IKRCTDKGVESIFDIMEMEDEDRSGLLQLTDAQMADVARFCNRYPNIELAYEVVERDNIKSGSPVLVQVQLEREEEVTGPVVAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-AMGIHNYTLYFMSDAYMGCDQEYKFSVDV 2041          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:101173332])

HSP 1 Score: 1287.71 bits (3331), Expect = 0.000e+0
Identity = 660/1573 (41.96%), Postives = 1011/1573 (64.27%), Query Frame = 1
Query: 1324 KNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKS-SEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYA-GKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLID-DPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN-VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGS-SQGFWIFVEDVMSENILHYEYFLLKEK---FKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEW-MKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD--KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIK-DDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKL 6003
            K   F  G+ L+      LP+G  R+       V +P   P P+  +E  V I++L    +  F+ +K LNRIQS V++TA  ++EN+L+CAPTGAGKTN+A+LT++ EI +H+   G I+KD+FKIVY+APMK+L  EM N FS+RL+   + V  L+GD  L++ EI  TQ++V TPEKWD+++RKS  + + +Q+V+LLI+DE+HLLH++RGPVLE++VART+R ++S+ S I  RI+GLSATLPN  D+A F+HV+ + GLF FD  +RPVP+ Q ++GI     +++I  + ++ Y KV+E     HQV++FVH+R  TV TA A+ E   N   +  F  D+ +     ++ + + +N  +K++ P GF +HHAG+  +DR+ +E LF+  +++VLV T+TLAWGVNLPAH VIIKGTQ+Y   +G + +L  LDVMQ+FGRAGRPQ+D  G G +IT  ++L++YL+LL +Q PIESQ +S LADNLNAEI +GTV N+ E++ WL YTYLY+RMR NP  YG+ +  I  DPTL+     L+  +   L+KA MI F++R+G F S ++GR A+++Y    T++   +       + ++  + SK  EF  + VREE+  E+ ++  N   +    G E+   K+N LLQ YIS+  ++ F+L SD +Y++Q+AAR+MRA+FE+ L K+W ++T  +L  CK +++R+W  + PLRQF  +   +  +LE+K +  D+L + +  E+G ++++  +G T+ + +HQIP + ++  +QPITR+ ++V L +TPDF W  + HGS  + +W++VED ++++I H EYFLL++K    K   H++ F + I++PLP  YYIRAVSD+W+G E    I F N++LPE++ P TELLDLQ LP  ALRN EYES+Y  K + FN IQTQ F +LY++D NV +GAPTGSGKT+ AE+A+ R+F+    ++ VY+  L  L + R  +W ++    LGK V++LTG+   D ++I++A +IV+T E WD +SR W+ +  +Q + + I+D++HL+G +  G  LEVI SRT ++SS     +R++GLS +L NARD+ +WL       +NF PSVR  PL++ I  F   H   R+A+M+KP +Q I   SP  PV++FV + +QT   A  L+ Y  ++   K +    E  + + +  + +  L  TL+ G+G  H  L   +R  + ELF +  IQ+LV + TL W +   A+LV+V  T+ Y+GK   Y DY   D++QM+GRA     D+  ++VI+    KKDF +KFL+EP P+ES L   L DH NAEI   TI +KQDA+DY+TWT+ + R+  NP+YY+L   SH  ++ +LS LVE +L DLE S CI IK D+  V  +  G IA++YY+ + ++ MF   L+    +  LL ++ +A E+ +LP+RH ED + +++ Q L L ++          K ++LLQA+ SR  +  ++   D   +L  ++R+ QA +DV ++  WL  A++   L QM+ Q +W  DS L  +PH  +  L
Sbjct:  272 KAPAFVGGARLL------LPEGIRRENNKMCEEVEIPPNDPMPVGFEEKPVYISELDEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTVLHEIRQHLQPGGVIKKDEFKIVYVAPMKALAAEMTNYFSKRLEPLGITVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVSLSQIVRLLILDEVHLLHEDRGPVLESLVARTIRQVESTQSMI--RILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFVGIKTTNKIQQIHDIEEVCYNKVLEQVKAGHQVMVFVHARNATVRTAMALIEMAKNHGEICFFQTDQGSDYGQCEKQVQRSRNKQMKEMFPEGFGIHHAGMLRSDRSLMESLFSKGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQYLSSLADNLNAEIALGTVTNVEEAVKWLSYTYLYVRMRANPLAYGINHKAIQMDPTLELFRTELVVESGRRLDKAHMIRFEERTGYFASTDLGRTASHFYIRYNTIETFNELFSSQNTEADILNIVSKAEEFEQLKVREEELEELDQMQVNFCELLAAGGVENSYGKVNILLQTYISRGDVDSFSLISDLSYVAQNAARIMRALFEIALRKRWPAMTYRLLTLCKVIDKRLWGFAHPLRQFPNLSHIVLNRLEEKKLTVDKLKEMRKDEIGHMLHHVNIGLTVKQCVHQIPSILMEASIQPITRTVLRVRLMVTPDFRWNDQVHGSVGEPWWLWVEDPINDHIYHSEYFLLQKKQVVSKEPQHVV-FTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQNLVLPERHPPHTELLDLQPLPVIALRNPEYESLY--KFTHFNPIQTQIFHTLYHTDTNVLLGAPTGSGKTIAAEMAMFRVFNKYPSSKVVYIAPLKALVRERMEDWKIRIQEKLGKKVVELTGDVTPDVRAIAQADLIVTTPEKWDGVSRSWQNRSYVQKVAILIIDEIHLLG-EDRGPVLEVIVSRTNFISSHTSKSVRVVGLSTALANARDLADWLGIKQVGLFNFRPSVRPVPLEVHIHGFPGQHYCPRMASMNKPTFQAIRSHSPAKPVLIFVSSRRQTRLTALDLIAYLATEDNPKQWLHQDEREIEDIIATVRDSNLKLTLAFGIGLHHAGLHERDRKTVEELFVNCKIQVLVATSTLAWGVNFPAHLVVVKGTEYYDGKSRRYVDYPITDVLQMMGRAGRPQFDEQGKAVILVHDIKKDFYKKFLYEPFPVESSLLSVLSDHLNAEIAAGTISSKQDAMDYITWTYFFRRLVMNPSYYSLADTSHESINKYLSNLVEQSLRDLEISHCIEIKEDERTVEPLTYGRIASYYYLKHQSVGMFKERLRAELLIPELLSILTDAEEYAELPVRHNEDQLNSQLAQQLPLQVN-PHSFDSAHAKTHLLLQAHFSRAQLPCSDYSTDTKTVLDNAIRICQAMLDVAANEGWLVTAISICNLVQMVVQGRWLHDSSLLTLPHIEQQHL 1831          

HSP 2 Score: 246.514 bits (628), Expect = 6.886e-65
Identity = 209/797 (26.22%), Postives = 366/797 (45.92%), Query Frame = 1
Query: 4036 EEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSN---------RQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAI-QNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCH-HTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL-KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGR---------ASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRH------LSDHLSELVENTLMDLENSKCIAIKDDID-VSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYE--VSKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKRE------ESWWLVVGEPNQGHL 6315
            +E   +  K M   N IQ+  FE+ YN++EN+ I APTG+GKT  A + ++              + + + VYV  +  LA      + K    LG TV +LTG+  +    I +  ++V+T E WDV++R+     ++ Q ++L I+D++HL+  +  G  LE + +RT       ++ IRI+GLS +L N  DV  +L  + +   + F+   R  PL         T+   ++  + +  Y  +L ++     V+VFV     T   A  L+  A    KN G          +      + ++   N+ + E    G G  H  +  ++R+LM  LFS   +++LV + TL W +   A+ VI+  TQ+Y+ K   + D   +D++Q+ GRA     D      I+   +K       L +  P+ES     L D+ NAEI   T+ N ++AV +L++T+LY RM  NP  Y   G++H+       L    +ELV  +   L+ +  I  ++     ++ +LG  A+ +YI Y TIE F+      +    +L ++  A EFE L +R  E   L +++ +    +     + +   K NILLQ Y+SR  + +  L  DL+ +   + R+++A  ++    RW       + L ++I +  W     L+Q P+ +   +L R E               E+KL +    + +  ++      + NI LT +  V +  S   + S+Q  + R    +  +   +F +  +      E WWL V +P   H+
Sbjct:  322 DEIGQLVFKGMKRLNRIQSIVFETAYNTNENLLICAPTGAGKTNIAMLTVLHEIRQHLQPGGVIKKDEFKIVYVAPMKALAAEMTNYFSKRLEPLGITVKELTGDMQLTKGEILRTQMLVTTPEKWDVVTRKSVGDVSLSQIVRLLILDEVHLL-HEDRGPVLESLVARTIRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFRPVPLGQTFVGIKTTNKIQQIHDIEEVCYNKVLEQVKAGHQVMVFVHARNATVRTAMALIEMA----KNHGEICFFQTDQGSDYGQCEKQVQRSRNKQMKEMFPEGFGIHHAGMLRSDRSLMESLFSKGYLKVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGAFVDLGILDVMQIFGRAGRPQFDKFGEGTIITTHDKLSHYLTLLTQQNPIESQYLSSLADNLNAEIALGTVTNVEEAVKWLSYTYLYVRMRANPLAY---GINHKAIQMDPTLELFRTELVVESGRRLDKAHMIRFEERTGYFASTDLGRTASHFYIRYNTIETFNELFSSQNTEADILNIVSKAEEFEQLKVREEELEELDQMQVNF-CELLAAGGVENSYGKVNILLQTYISRGDVDSFSLISDLSYVAQNAARIMRALFEIALRKRWPAMTYRLLTLCKVIDKRLWGFAHPLRQFPNLSH-IVLNRLE---------------EKKLTVDKLKEMRKDEIGHMLH-HVNIGLTVKQCVHQIPSILMEASIQ-PITRTVLRVRLMVTPDFRWNDQVHGSVGEPWWLWVEDPINDHI 1091          

HSP 3 Score: 68.1662 bits (165), Expect = 1.129e-10
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 1
Query: 6244 ANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEK--VSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            A  FP  ++E W+LV+GE ++  L+++K +     +   S+ F  P K G Y YTLY MSDSYLG DQ+Y   +NV
Sbjct: 1963 APRFPKVKDEGWFLVLGEVDRRELLAVKRVGYVRSRTVASVAFYTPEKPGRYIYTLYVMSDSYLGLDQQYDLHLNV 2038          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Match: snrnp200 (small nuclear ribonucleoprotein U5 subunit 200 [Source:NCBI gene;Acc:101154872])

HSP 1 Score: 551.592 bits (1420), Expect = 5.102e-178
Identity = 268/455 (58.90%), Postives = 352/455 (77.36%), Query Frame = 1
Query: 5113 YDDYSAVDLIQMVGRANHASMDD-ARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSK--SVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLS-SPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINV 6465
            Y DY   D++QMVG+AN   +DD  R VIMCQ +KKDF +KFL+EPLP+ESHLDH LHDHFNAEIVTKTIENKQDAVDYLTWTFLY RMT+NPNYYNL+G+SHRHLSDHLSELVENTL DLE SKCI+I+D++DV+ +NLGMIA +YYI+YTTIE+FS+SL   +K+R L+E+I NA E++++P+RH ED +L ++ Q +   ++ + + +DP  K N+LLQA+LSR+ + +AEL+ D  +IL K++RLIQACVDVLSSN WL PALAAMELAQM+TQA W +DS LKQ+P+F   + ++RC   GV+++FD+ME+EDE +  L+   D ++ DVARF   YPNI+L YEV +  ++ +G  V VQ+ L R+E+    V A  FP KREE WW+V+G+P    LISIK L+     KV L+F AP   G + YTLYFMSD+Y+GCDQEY+F+++V
Sbjct:    5 YVDYPIYDVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGMSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLN-NPKFNDPHVKTNLLLQAHLSRMQL-SAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPYFTS-EHIKRCTDKGVESIFDIMEMEDEDRSGLLQLTDAQMADVARFCNRYPNIELAYEVVERDNIKSGSPVLVQVQLEREEEVTGPVVAPLFPQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAP-AMGIHNYTLYFMSDAYMGCDQEYKFSVDV 455          

HSP 2 Score: 150.984 bits (380), Expect = 5.878e-38
Identity = 120/453 (26.49%), Postives = 216/453 (47.68%), Query Frame = 1
Query: 2638 DVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGA-EDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIP--FDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMK--------VEL---------TITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETE 3936
            DV+QM G+A RP  D +G  +++   ++  ++   L E LP+ES L   L D+ NAEIV  T+ N  +++D+L +T+LY RM +NP+ Y ++   +    L +H   L+      LE+++ I+ +        N +G IAAYYY    T+++    L        + ++ S  AE++NI +R  +   +++L + VP  +      DP  K N LLQA++S+++L    L SDT  I   A RL++A  +V  S  W S  L+ +E  + V Q MW+    L+Q      E  K+   K +   FD +  +     G L         + ++ ++ P  N+++  + + R  +K        V+L          + P F          +G+W+ + D  S +++  +   L++K K     +   + I++     Y +  +SD ++G + E
Sbjct:   12 DVLQMVGKANRPMLDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCLHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQG--MSHRHLSDHLSELVENTLHDLEQSKCISIEDEMDVAPLN-LGMIAAYYYINYTTIELFSMSLNAKTKIRGLIEIISNAAEYKNIPIRHHEDTLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSA-ELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPYFTSEHIKRCTDKGVESIFDIMEMEDEDRSGLLQLTDAQMADVARFCNRYP--NIELAYEVVERDNIKSGSPVLVQVQLEREEEVTGPVVAPLF-----PQKREEGWWVVIGDPKSNSLISIKRLTLQQKAKVKLDFVAPAMGIHN-----YTLYFMSDAYMGCDQE 448          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 259.61 bits (662), Expect = 5.780e-72
Identity = 221/747 (29.59%), Postives = 369/747 (49.40%), Query Frame = 1
Query: 1504 KAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSRE-EINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXX-XXRGPVLEAIVAR-----TMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLF-KFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEK---VMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKD---LLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLK----KSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXN----VPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMR-AMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPL-RQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNH-KMGKTIYKYIHQIPKLNLKIHLQP 3669
            ++ F +    N +QS+     L +++N + CAPTG+GKT +  L ++R +   + T    R  D K VY AP+K+L ++   +++++     L    L+GD+ +    EI ++ II+ TPEKWD ++RK  +    QLV+L +IDE+H++    RG  LE +V+R     + R  Q+  + + MR V +SAT+PN  DIAE++  +     +   + S+RPV + +  LG          +    L Y+    +  Y+ +   L+F  +RK    +A              +  +D + +  +  + L K  N  L     L+P G   HHAGL  +DR  VEE FT   + VL +T TLA GVNLPAH+V+IK T  Y    G   E S  D++QM GRAGRPQ+DT    +++T       Y+ L+N    IES L   L ++LNAEIV+ T+ +++ ++DW+R T+LYIR  KNP+ Y               C   + + +SI    ++I+ D+     I    GR+ A  YC     D +K+F K    +S+ D+   ++ SK  EF  I +R  +K  +    ++       P+K   +    K+N L+QA +  + ++ F L+ DTA I +   R+ + + F    S+   +  L+ +   K  + ++W  S  + +Q +K+       +      F ++      EL  ++N H   G  I   +  +PK ++ +   P
Sbjct:    4 RSVFSEFPFFNYVQSQALDDVLYTNKNFVACAPTGSGKTVLFELAIIRLL---METQEPWR--DVKAVY-APIKALCSQCFENWNKKFGHLGLICKELTGDTEIEDFFEIQDSNIILTTPEKWDSLTRKWRDNCLLQLVRLFLIDEVHVVKDATRGATLEVVVSRMKAVHSFRTSQNPEAGLSMRFVAVSATIPNVSDIAEWLSNEGEPATYLNMNESHRPVKLRKVVLGFPCSPNQTEFKFDLSLSYKMANIIQTYSDQKPALVFCSTRKGAQQSA-------------AILAKDVRFNLSIEHKQLTKYANSVLDSKLRLVPLGIGFHHAGLDLSDRKLVEEAFTQGDLSVL-TTRTLAMGVNLPAHLVVIKSTMQYVV--GSCEEYSEADILQMIGRAGRPQFDTSATAVIMTKVQTRDKYMKLMNGVEVIES-LHGHLVEHLNAEIVLQTISDVNMALDWIRSTFLYIRALKNPTHY--------------LCLKNLNSLSSI----DLISMDEDIN--IKPTAGRLMA-RYCV--AFDTMKQFSKVDGSESLSDL--VELVSKSKEFSEIQLRVNEKRPLNSFNKDKNRTTIFPLKGKMKSSDMKVN-LIQAQLGCISIQDFGLTQDTAKIFRIGLRISKLSEFLGQRSRAGFTALLNSIILAKCFQSKLWENSPYVSKQLEKIQTLSAAMVNAGLTTFTKIEQINPRELELILNRHPPFGNQIRDSVMHLPKYDVCVEQLP 701          

HSP 2 Score: 233.802 bits (595), Expect = 2.246e-63
Identity = 176/632 (27.85%), Postives = 307/632 (48.58%), Query Frame = 1
Query: 4039 EYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQ----DARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNM-DNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSS-------QLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIE--IQTFNITHNATRLA---AMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLL---MGYALS-DKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQ----SLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRL 5856
            ++ S++S+   FFN +Q+Q  + +  +++N    APTGSGKTV  E+AI+RL    Q    D + VY   +  L    +  W K FG LG    +LTG+T + D   I  ++II++T E WD L+R+W+    +Q ++LF++D++H++     G TLEV+ SR + + S       +    +R + +S ++ N  D+ EWL          N +  HRP+ +   +  F  + N T      ++S  +   I   S   P +VF  T K  ++ A +L   + + LS + K   + + +++   +R          +  G+GF H  L +++R L+ E F+   + +L  + TL   +   A+LV++  T  Y    C  ++YS  D++QM+GRA     D  A +VIM +   +D   K ++    +ES L   L +H NAEIV +TI +   A+D++  TFLY R  +NP +Y                L    L  L +   I++ +DI++     G +   Y + + T++ FS  +  +  +  L+EL+  + EF ++ LR  E   L    +    +   P+    + SD +     L+QA L  + I+   L +D  +I    +R+
Sbjct:    2 KFRSVFSE-FPFFNYVQSQALDDVLYTNKNFVACAPTGSGKTVLFELAIIRLLMETQEPWRDVKAVY-APIKALCSQCFENWNKKFGHLGLICKELTGDTEIEDFFEIQDSNIILTTPEKWDSLTRKWRDNCLLQLVRLFLIDEVHVVKDATRGATLEVVVSRMKAVHSFRTSQNPEAGLSMRFVAVSATIPNVSDIAEWLSNEGEPATYLNMNESHRPVKLRKVVLGFPCSPNQTEFKFDLSLSYKMANIIQTYSDQKPALVFCSTRKGAQQSAAILAKDVRFNLSIEHKQLTKYANSVLDSKLR---------LVPLGIGFHHAGLDLSDRKLVEEAFTQGDLSVL-TTRTLAMGVNLPAHLVVIKSTMQYVVGSC--EEYSEADILQMIGRAGRPQFDTSATAVIMTKVQTRDKYMKLMNGVEVIES-LHGHLVEHLNAEIVLQTISDVNMALDWIRSTFLYIRALKNPTHY----------------LCLKNLNSLSSIDLISMDEDINIKP-TAGRLMARYCVAFDTMKQFS-KVDGSESLSDLVELVSKSKEFSEIQLRVNEKRPLNSFNKDKNRTTIFPLKGKMKSSDMKVN---LIQAQLGCISIQDFGLTQDTAKIFRIGLRI 597          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Match: SMESG000004936.1 (SMESG000004936.1)

HSP 1 Score: 4312.3 bits (11183), Expect = 0.000e+0
Identity = 2139/2142 (99.86%), Postives = 2140/2142 (99.91%), Query Frame = 1
Query:   43 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNYAPKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFXXXXXXXXXXLHXXXXXXXXXXXXXXXXXXXXSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQVSVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNYAPKTAETKSVYE MLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFTNENNDDTNDLHIEIDDDQEEEEDDVYGEVQDSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKLLIIDEIHLLHDERGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVREEDKIEIKKLLENVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVS GGQVSVQIHLARDEDNISSVYAN+FPYKREESWWLVVGEPNQGHLISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV
Sbjct:    1 MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKKMGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNYAPKTAETKSVYETMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDKERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFTNENNDDTNDLHIEIDDDQEEEEDDVYGEVQDSESDDGGVEADTNTTLNISQFAAGTISQVPGTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQKRTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKLLIIDEIHLLHDERGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVREEDKIEIKKLLENVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKKVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENILHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVFDLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSPGGQVSVQIHLARDEDNISSVYANHFPYKREESWWLVVGEPNQGHLISIKLLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 2142          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Match: SMESG000072466.1 (SMESG000072466.1)

HSP 1 Score: 1189.87 bits (3077), Expect = 0.000e+0
Identity = 675/1701 (39.68%), Postives = 1043/1701 (61.32%), Query Frame = 1
Query:  955 ILEVLKIAKNDQELENKLLRIVGVDRFDLVR--MLRENKLMIYYCTKLCCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAP--KPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKT-YTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRPVPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAG-KHQVLIFVHSRKETVNTAKAIKEKCLNRDTLG-----LFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLLNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKNPSLYGVE-NVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPI-KEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFK-KVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPKLNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSS-QGFWIFVEDVMSENILHYEYFLL---KEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEITIVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALNDLAQLRYTEWMKTF-GALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWL--DCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKK--NFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMD-DARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHFNAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLSELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSD-PRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQIP 5982
            I  +L  +KN+ EL+N+L  ++G++ F+++   +LR N+L+  +        + +    I  E+  +P          N++RK     A++ ++T   +   +A  +   S    +Y  V   DL N    Q + ++  +   LP  +  K    Y  + + A   K + L  D   V+I DL    +  FE IK LN IQS V+K A  S+EN+L+ APTGAGKTN+A+LT++ +I +HI   G I+ D+FKI+Y+APMK+L  EM  SFS+RL+S  + V   +GD  L+++EI +TQ+IV TPEK+D+I+RKS+  T   QLVKLLIIDE+HLLH++RG V+E+IVART+R ++S+   I  RIVGLSATLPN  D+AEF+ V+  +GLF FDS +RPVP+ Q ++GI    A    E +N+  Y+K++E+   K QV+IFVH+R +T  TA  ++     R  +G     LF  D K +     + +DK ++  LKD+ P G A HHAG+  +DR+FVE+ F   +I++L  T+TLAWGVNLPAH VIIKGTQ+Y  +K  + +L  LDV+Q+FGRAGRPQ+D +G GI++  +++L +YLSL+    PIES+ +  L DNLNAEI +GTV N+ E++ WL YTYLY+RM KNP  YG++   + +D TL +   +LI  +A  L+K ++I FD+RSG   S + GR+ ++YY   ET   L+     S+ + EVF++ S+ +EF  + VR+E+  E+ ++ E   V + ++G  D   K+N LLQ+YI + + + F+L SD  +I+Q+A R++R +FE  +   WA +T  +L+ CK +E R+W    P+ +F   +P E   +++ K +  + +++    EL +++     GK +      IP++++ + +QP+TR+ +++   I P F W  K HGS  Q FW++VED  S+ I+HY   +    K+  + +   + F + I++P+P  Y +R VS+ WIG ++   I F N++LPE + P T LLDL+ LP  AL+NE+Y+  Y+   S FN IQTQ F +LY SD NV +GAPTGSGKTV AE+A+ R+F+ + + + VY+  L  L + R  +W K F   L K V++LTG+   D K+++++ +IV+T E WD +SR W+++K +Q++ L ++D++HL+G +  G  LEVI SRT ++++  +  +RIIGLS +L NARD+ +WL  D +    YNF PSVR  PL I IQ F+  H   R+A M+KP+YQ I   S   PV++FV + +QT   AF L+ +A+S  K   +   S       ++NI +  L   LS G+G  H  L   +R L+  LF +Q IQIL+ + TL W +   A+LV+V  T+ ++GK   Y DY   D++QM+GRA     D + ++VIM    KK+F +KFL+EP P+ES L   L DH NAEI+  +I +KQ A++YLTWTF Y R+  NPNYY+L+ V H+ ++ +LS L+EN + +LE S+CI   +   +    +G IA++YY+ + ++ +F   LK +S +  LL+++ +  EF +LP+RH E+ +   + +  ++PI  D    D P TK N+LLQAY SRV +   +   D   +L +++R++QA +D   S  WL   L    + QM+ Q  W  D  L Q+P
Sbjct:  240 IKNLLSSSKNNDELQNELFDLIGMEGFEIISELLLRRNELVDNF--------SKQNYVDIVDELLHNPS--------LNLERK-----AKKLQQTPTGNMYKEASTKFVGSTKNIHYPHV--YDL-NAELQQTASMINGQKIYLPKSAIIKELNIYKSIELKADLNKIEALRVDR--VQIKDLDQIAQMGFEGIKQLNLIQSVVFKAAYGSNENLLISAPTGAGKTNIAMLTVLHQIKQHIGLGGKIKTDEFKIIYVAPMKALAAEMTESFSKRLRSLGISVRECTGDMQLTKQEITKTQMIVTTPEKYDVITRKSTGDTALVQLVKLLIIDEVHLLHEDRGSVIESIVARTLRQVESNQKVI--RIVGLSATLPNYLDVAEFLRVNPEKGLFYFDSRFRPVPLHQTFIGIKGENARTVKENLNETCYQKMLEFIKRKQQVMIFVHARNDTQRTATFLRNTLKERGDIGYVTEELFNNDFKIAL----KRVDKSRDMALKDVFPDGLACHHAGMLRSDRSFVEQQFVAGNIRILCCTATLAWGVNLPAHAVIIKGTQIYDAEKSSFVDLGILDVLQIFGRAGRPQFDKEGHGIIMCKQDKLNHYLSLIMRSHPIESRFMRSLNDNLNAEIALGTVTNVEEAVKWLSYTYLYVRMPKNPLNYGIKWEEIKNDHTLRDFRESLIIESARSLDKTKLIRFDERSGFLTSTDSGRLTSHYYIRFETASQLEDDFCSSLLNEEVFQIISRSSEFSQMKVRDEELSELIEMYEGCHVELMQDGCTDVAGKVNILLQSYIDRYQPQSFSLVSDLNFITQNAGRIVRYIFEKAIRNGWAMMTDRLLKLCKCIEHRIWDGYSPIWRFAGDIPDEAIHRIDNKRLSIEDILNIPVKELDDIIRYGNKGKDVKVVASFIPRVDVNVEVQPVTRTILRLRSKIVPTFRWSDKYHGSQMQSFWLWVEDPESD-IIHYSEMISVTKKQVIEREAIEIIFAIPIFEPMPSRYLLRIVSNVWIGSDSLTDISFKNLILPELHPPHTNLLDLRPLPVSALKNEKYQQFYA--YSHFNPIQTQVFHALYYSDTNVLLGAPTGSGKTVAAELAMFRVFNTQPNKKVVYIAPLKALVRERTDDWKKKFEDILHKKVVELTGDIAPDMKAVAESDLIVTTPEKWDGVSRSWQERKFVQDVALIVIDEIHLLG-EDRGPVLEVIVSRTNFITAHTKCKVRIIGLSTALANARDLADWLQIDTNSMGLYNFRPSVRPAPLQIHIQGFSGRHYCPRMATMNKPIYQAIEIHSSEKPVLIFVSSRRQTRLTAFDLISFAVSSDKPRQWTNLSHDETEFLLQNIRDNDLKLVLSYGIGMHHAGLHEKDRKLVENLFLNQKIQILIATSTLAWGVNFPAHLVVVKGTEFFDGKTKRYVDYPITDVLQMMGRAGRPQFDNNGKAVIMVHDIKKEFYKKFLYEPFPVESSLLKVLPDHMNAEIIAGSITSKQSAMNYLTWTFFYRRLLMNPNYYSLEAVDHKAINLYLSRLIENIVYELEQSQCIETDESGTLEPGIMGRIASYYYLKHQSVRLFHSKLKSDSSLEDLLDILTSTEEFAELPVRHNENQLNAELAK--KVPIKLDANTMDSPNTKGNLLLQAYFSRVALPITDYYTDTKLVLDQAIRIVQAMIDAAGSEGWLATCLRLANVIQMLVQGLWVSDHPLLQLP 1902          

HSP 2 Score: 60.077 bits (144), Expect = 2.970e-8
Identity = 27/85 (31.76%), Postives = 49/85 (57.65%), Query Frame = 1
Query: 6223 DNISSVYANNFPYKREESWWLVVGEPNQGHLISIK---LLSSPTEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV 6468
            + I   +A  FP  ++E + +++G+P    ++ +K   ++     K+S+ F +P + G   YTLY MSDSY+G DQE    ++V+
Sbjct: 2074 NKIPKAFAPKFPKPKDEGYIIILGDPENQEVLGLKRIPMIRQANTKISITFFSPEQIGRSVYTLYVMSDSYIGFDQELPIYLDVM 2158          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Match: SMESG000005293.1 (SMESG000005293.1)

HSP 1 Score: 409.453 bits (1051), Expect = 5.978e-125
Identity = 211/281 (75.09%), Postives = 229/281 (81.49%), Query Frame = 1
Query: 1195 KEDIVTAERNRKTQARSAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGSFRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRKSSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMR 2037
            K+DIV AER RKTQ+RS K QAD+EME+SNVI NYG V+MLDLKNITFTQGSH MTNKNCELPDGS+RKTKPGYNLV VPAP PKPL+ADENLVKI+D  SYVKAAFE IKTLNRIQS+VYKTALESDENIL+CAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVY+AP+KSLVNEMA SFS+RLK YNLKV+MLSGDSHLSR+EI +  II       D I     E                     RGPVLEAIVART+RA QSSHSNID+R
Sbjct:    2 KKDIVGAERRRKTQSRSEKSQADVEMENSNVIPNYGCVNMLDLKNITFTQGSHPMTNKNCELPDGSYRKTKPGYNLVYVPAPTPKPLKADENLVKISDFQSYVKAAFENIKTLNRIQSEVYKTALESDENILICAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYVAPLKSLVNEMAKSFSDRLKRYNLKVSMLSGDSHLSRKEIIKLLII-------DEIHLLHDE---------------------RGPVLEAIVARTIRANQSSHSNIDIR 254          

HSP 2 Score: 307.76 bits (787), Expect = 7.095e-90
Identity = 159/206 (77.18%), Postives = 179/206 (86.89%), Query Frame = 1
Query: 2878 RMRKNPSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNEIGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVRXXXXXXXXXXXXNVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAYISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFKK 3495
            R+RK PSLYGVEN L DDPTL+NHCR+LIYTAA+ILEKAEMINFDKRSGEF SNEIGRIAA+YYC NETM+V K+FLK++  +IE+ KVFSKC EFRNITVREEDKIEIKKL+E+V  PIKE  EDP TKINCL+QAYIS L LERFTLSSDT YI++SA RL+RAMFE TLSKK A L+  VLE CKEVE+RMW+ S PLRQFKK
Sbjct:  345 RVRKTPSLYGVENALFDDPTLENHCRSLIYTAANILEKAEMINFDKRSGEFFSNEIGRIAAHYYCANETMNVFKRFLKETTCNIEIIKVFSKCCEFRNITVREEDKIEIKKLMEHVGTPIKESVEDPSTKINCLMQAYISHLTLERFTLSSDTTYIAESATRLIRAMFEFTLSKKCAILSEMVLEICKEVEKRMWSISFPLRQFKK 550          

HSP 3 Score: 59.6918 bits (143), Expect = 2.274e-8
Identity = 47/205 (22.93%), Postives = 93/205 (45.37%), Query Frame = 1
Query: 5371 RMTRNPNYYNLKGV--SHRHLSDHLSELVENTLMDLENSKCIAI-KDDIDVSAINLGMIATFYYIHYTTIEMFSLSLKPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLSDPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNRWLGPALAAMELAQMITQAQWHRDSLLKQ 5976
            R+ + P+ Y ++        L +H   L+      LE ++ I   K   +  +  +G IA  YY    T+ +F   LK  +    ++++     EF ++ +R  + + + ++ + +  PI E   + DP TK N L+QAY+S + ++   L  D   I   + RLI+A  +   S +    +   +E+ + + +  W     L+Q
Sbjct:  345 RVRKTPSLYGVENALFDDPTLENHCRSLIYTAANILEKAEMINFDKRSGEFFSNEIGRIAAHYYCANETMNVFKRFLKETTCNIEIIKVFSKCCEFRNITVREEDKIEIKKLMEHVGTPIKES--VEDPSTKINCLMQAYISHLTLERFTLSSDTTYIAESATRLIRAMFEFTLSKKCAILSEMVLEICKEVEKRMWSISFPLRQ 547          

HSP 4 Score: 54.299 bits (129), Expect = 1.146e-6
Identity = 45/173 (26.01%), Postives = 71/173 (41.04%), Query Frame = 1
Query: 4075 FNAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSN---------RQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLS 4566
             N IQ++ +++   SDEN+ I APTG+GKT  A + +MR             + D + VYV  L  L       +          V  L+G++++  K I                            I+L I+D++HL+  +  G  LE I +RT   +    + I I  LS
Sbjct:  114 LNRIQSEVYKTALESDENILICAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYVAPLKSLVNEMAKSFSDRLKRYNLKVSMLSGDSHLSRKEI----------------------------IKLLIIDEIHLLHDER-GPVLEAIVARTIRANQSSHSNIDIRNLS 257          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Match: SMESG000065396.1 (SMESG000065396.1)

HSP 1 Score: 160.999 bits (406), Expect = 1.913e-41
Identity = 120/410 (29.27%), Postives = 206/410 (50.24%), Query Frame = 1
Query: 1534 NRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRK--SSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGL-FKFDSSYRPVPMEQEYLGINERKAVKRIE---LMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLL 2745
            N++Q   +     S++++++ APTG+GKT +  + +++ +   +  + ++ +  F I+Y+AP+KSL  E   S+ E+ K +++    ++GD  +  +  N+  II  TPEK D I+RK  +    +  +  L   +   +    RG  LE ++ R    + S       R +GLSAT+ N +D  ++    ++R +  +     R V +  + L     K     +   L+N  + + + +YA    +LIF  +RK T   AK + ++   R  L     D+     V+ Q   K+    L+  +  G   HHAGL   DR  VE  F    + VL STSTL+ GVNLPAH+V+IKGT  +  +  +    + L  +QM GRAGRPQ+D   V I++T+  E    L+++
Sbjct:   81 NQLQRDSFNDVFHSNKSVIIKAPTGSGKTVIFEIAVVKCL---LENESSLER--FTIIYVAPLKSLCREKWLSWQEKFKRFDIVGIEMTGDFEMICDA-NKNHIIYTTPEKLDGITRKLDTFSINFPNVKLLCFDEIHTINDGVRGVTLEVVIIRLKYLLDSR-----TRFIGLSATIGNVDDFVKWFSNIENRCISHQMPEESRSVKLTTQVLAYPRPKGQSLFQFDNLLNHRIPDLISKYADSKPLLIFCMTRKSTFQLAKFLVDQ--TRFELKF---DQIHQLGVISQ---KISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEEEVRALNMM 469          

HSP 2 Score: 128.642 bits (322), Expect = 1.249e-30
Identity = 106/403 (26.30%), Postives = 192/403 (47.64%), Query Frame = 1
Query: 4078 NAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLF----SNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKK-KKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL---------------KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAI--VSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKD 5220
            N +Q   F  +++S+++V I APTGSGKTV  EIA+++      S+ +    +YV  L  L + ++  W + F       I++TG+  M   + +K HII +T E  D ++R+         N++L   D++H I     G TLEV+  R +Y+   L++  R IGLS ++ N  D  +W           N  + H+ +  E ++  +T   T++ A  +P  Q++                K + + P+++F  T K T ++A  L+     D+  F    + I  +    + IS E L   +  GVGF H  L   +R ++   F   ++ +L  + TL   +   A+LV++  T  +N    +   Y+   L+QM+GRA     D++   I+  +++++
Sbjct:   81 NQLQRDSFNDVFHSNKSVIIKAPTGSGKTVIFEIAVVKCLLENESSLERFTIIYVAPLKSLCREKWLSWQEKFKRFDIVGIEMTGDFEMICDA-NKNHIIYTTPEKLDGITRKLDTFSINFPNVKLLCFDEIHTINDGVRGVTLEVVIIRLKYL---LDSRTRFIGLSATIGNVDDFVKWFSNIE------NRCISHQ-MPEESRSVKLT---TQVLAYPRPKGQSLFQFDNLLNHRIPDLISKYADSKPLLIFCMTRKSTFQLAKFLV-----DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSN--IEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 462          
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Match: SMESG000065396.1 (SMESG000065396.1)

HSP 1 Score: 160.614 bits (405), Expect = 2.183e-41
Identity = 120/410 (29.27%), Postives = 206/410 (50.24%), Query Frame = 1
Query: 1534 NRIQSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKDDFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQIIVCTPEKWDIISRK--SSEKTYTQLVKXXXXXXXXXXXXXRGPVLEAIVARTMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGL-FKFDSSYRPVPMEQEYLGINERKAVKRIE---LMNDLVYEKVMEYAGKHQVLIFVHSRKETVNTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGFAVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQVYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSLL 2745
            N++Q   +     S++++++ APTG+GKT +  + +++ +   +  + ++ +  F I+Y+AP+KSL  E   S+ E+ K +++    ++GD  +  +  N+  II  TPEK D I+RK  +    +  +  L   +   +    RG  LE ++ R    + S       R +GLSAT+ N +D  ++    ++R +  +     R V +  + L     K     +   L+N  + + + +YA    +LIF  +RK T   AK + ++   R  L     D+     V+ Q   K+    L+  +  G   HHAGL   DR  VE  F    + VL STSTL+ GVNLPAH+V+IKGT  +  +  +    + L  +QM GRAGRPQ+D   V I++T+  E    L+++
Sbjct:   83 NQLQRDSFNDVFHSNKSVIIKAPTGSGKTVIFEIAVVKCL---LENESSLER--FTIIYVAPLKSLCREKWLSWQEKFKRFDIVGIEMTGDFEMICDA-NKNHIIYTTPEKLDGITRKLDTFSINFPNVKLLCFDEIHTINDGVRGVTLEVVIIRLKYLLDSR-----TRFIGLSATIGNVDDFVKWFSNIENRCISHQMPEESRSVKLTTQVLAYPRPKGQSLFQFDNLLNHRIPDLISKYADSKPLLIFCMTRKSTFQLAKFLVDQ--TRFELKF---DQIHQLGVISQ---KISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSNIEQTYTQNKL--LQMIGRAGRPQFDNSAVAIILTSSEEEVRALNMM 471          

HSP 2 Score: 128.642 bits (322), Expect = 1.436e-30
Identity = 106/403 (26.30%), Postives = 192/403 (47.64%), Query Frame = 1
Query: 4078 NAIQTQCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLF----SNRQDARCVYVTALNDLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDVLSRRWKK-KKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLETPIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNITHNATRLAAMSKPVYQTIL---------------KLSPNSPVIVFVPTMKQTEEIAFLLMGYALSDKKNFGRASEAI--VSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLELFSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLIQMVGRANHASMDDARSVIMCQTNKKD 5220
            N +Q   F  +++S+++V I APTGSGKTV  EIA+++      S+ +    +YV  L  L + ++  W + F       I++TG+  M   + +K HII +T E  D ++R+         N++L   D++H I     G TLEV+  R +Y+   L++  R IGLS ++ N  D  +W           N  + H+ +  E ++  +T   T++ A  +P  Q++                K + + P+++F  T K T ++A  L+     D+  F    + I  +    + IS E L   +  GVGF H  L   +R ++   F   ++ +L  + TL   +   A+LV++  T  +N    +   Y+   L+QM+GRA     D++   I+  +++++
Sbjct:   83 NQLQRDSFNDVFHSNKSVIIKAPTGSGKTVIFEIAVVKCLLENESSLERFTIIYVAPLKSLCREKWLSWQEKFKRFDIVGIEMTGDFEMICDA-NKNHIIYTTPEKLDGITRKLDTFSINFPNVKLLCFDEIHTINDGVRGVTLEVVIIRLKYL---LDSRTRFIGLSATIGNVDDFVKWFSNIE------NRCISHQ-MPEESRSVKLT---TQVLAYPRPKGQSLFQFDNLLNHRIPDLISKYADSKPLLIFCMTRKSTFQLAKFLV-----DQTRFELKFDQIHQLGVISQKISEEKLRACIIRGVGFHHAGLCQLDREIVESSFLCGALPVLCSTSTLSMGVNLPAHLVVIKGTSNFNSN--IEQTYTQNKLLQMIGRAGRPQFDNSAVAIILTSSEEE 464          
The following BLAST results are available for this feature:
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRNP2000.000e+054.41small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
SNRNP2002.306e-7553.43small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ASCC30.000e+039.63activating signal cointegrator 1 complex subunit 3... [more]
HFM11.531e-8931.03helicase for meiosis 1 [Source:HGNC Symbol;Acc:HGN... [more]
ASCC34.141e-7447.30activating signal cointegrator 1 complex subunit 3... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrp-2000.000e+049.49Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
Y54E2A.40.000e+034.73pep chromosome:WBcel235:II:14754622:14778149:1 gen... [more]
Y54E2A.47.973e-9432.98pep chromosome:WBcel235:II:14768462:14778149:1 gen... [more]
Y54E2A.41.589e-5530.27pep chromosome:WBcel235:II:14773761:14778137:1 gen... [more]
polq-12.034e-2526.21DNA polymerase theta [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(3)72Ab0.000e+053.21gene:FBgn0263599 transcript:FBtr0075527[more]
obe0.000e+038.32gene:FBgn0038344 transcript:FBtr0083147[more]
DNApol-theta1.411e-2227.41gene:FBgn0002905 transcript:FBtr0082662[more]
mus3015.067e-2025.96gene:FBgn0002899 transcript:FBtr0076689[more]
tst5.410e-1625.19gene:FBgn0039117 transcript:FBtr0334895[more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrnp2000.000e+054.66small nuclear ribonucleoprotein 200 (U5) [Source:Z... [more]
snrnp2000.000e+054.66small nuclear ribonucleoprotein 200 (U5) [Source:Z... [more]
ascc30.000e+038.65activating signal cointegrator 1 complex subunit 3... [more]
ascc32.905e-8148.82activating signal cointegrator 1 complex subunit 3... [more]
hfm12.417e-7428.59helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRNP2000.000e+051.78small nuclear ribonucleoprotein, U5 200kDa subunit... [more]
gipc10.000e+037.96GIPC PDZ domain containing family member 1 [Source... [more]
gipc10.000e+038.04GIPC PDZ domain containing family member 1 [Source... [more]
gipc10.000e+037.85GIPC PDZ domain containing family member 1 [Source... [more]
gipc10.000e+038.10GIPC PDZ domain containing family member 1 [Source... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snrnp2000.000e+054.31small nuclear ribonucleoprotein 200 (U5) [Source:M... [more]
Ascc30.000e+038.52activating signal cointegrator 1 complex subunit 3... [more]
Hfm11.271e-9431.17HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Hfm11.271e-9431.17HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Polq2.922e-2728.42polymerase (DNA directed), theta [Source:MGI Symbo... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75643|U520_HUMAN0.000e+054.41U5 small nuclear ribonucleoprotein 200 kDa helicas... [more]
sp|Q6P4T2|U520_MOUSE0.000e+054.31U5 small nuclear ribonucleoprotein 200 kDa helicas... [more]
sp|F1LNJ2|U520_RAT0.000e+054.24U5 small nuclear ribonucleoprotein 200 kDa helicas... [more]
sp|Q9VUV9|U520_DROME0.000e+053.21Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
sp|Q9U2G0|U520_CAEEL0.000e+049.49Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IYW60.000e+054.46U5 small nuclear ribonucleoprotein 200 kDa helicas... [more]
A0A087TVN50.000e+054.63U5 small nuclear ribonucleoprotein helicase (Fragm... [more]
A0A3S3P5W20.000e+054.58Antiviral helicase Slh1-like protein OS=Dinothromb... [more]
A0A3S1AA110.000e+053.80Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A3B3T0810.000e+054.15Small nuclear ribonucleoprotein 200 (U5) OS=Paramo... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrnp2000.000e+053.95small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ascc30.000e+038.62activating signal cointegrator 1 complex subunit 3... [more]
hfm11.218e-7929.54helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
polq5.343e-2628.06DNA polymerase theta [Source:NCBI gene;Acc:1030397... [more]
helq4.983e-2029.86helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ascc39.459e-8441.27activating signal cointegrator 1 complex subunit 3... [more]
ascc35.684e-8441.29activating signal cointegrator 1 complex subunit 3... [more]
ENSPMAT00000005265.14.123e-12053.80pep scaffold:Pmarinus_7.0:GL487662:5509:13814:-1 g... [more]
ENSPMAT00000003190.11.257e-5127.50pep scaffold:Pmarinus_7.0:GL480029:355:29241:-1 ge... [more]
helq3.115e-2226.54helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BRR20.000e+038.31RNA-dependent ATPase RNA helicase (DEIH box); requ... [more]
SLH10.000e+035.94Putative RNA helicase related to Ski2p; involved i... [more]
HFM19.557e-7534.39Meiosis specific DNA helicase; involved in the con... [more]
SKI21.132e-1329.71Ski complex component and putative RNA helicase; m... [more]
MTR41.382e-1222.95ATP-dependent 3'-5' RNA helicase of the DExD/H fam... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491460.000e+051.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467140.000e+040.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267362.883e-2741.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348841.687e-2326.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447481.817e-2227.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrnp2000.000e+053.50small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
snrnp2000.000e+054.09small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
ascc36.886e-6541.96activating signal cointegrator 1 complex subunit 3... [more]
snrnp2005.102e-17858.90small nuclear ribonucleoprotein U5 subunit 200 [So... [more]
hfm15.780e-7229.59helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of U5 small nuclear ribonucleoprotein 200 kDa helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004936.10.000e+099.86SMESG000004936.1[more]
SMESG000072466.12.970e-839.68SMESG000072466.1[more]
SMESG000005293.15.978e-12575.09SMESG000005293.1[more]
SMESG000065396.11.913e-4129.27SMESG000065396.1[more]
SMESG000065396.12.183e-4129.27SMESG000065396.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034055 ID=SMED30034055|Name=U5 small nuclear ribonucleoprotein 200 kDa helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=6505bp
ATTTAACTTAAAGTTTCGATTTGAGAAAAACAAAAACTTACCATGGCTGA
TAATATAGCTCGAACGATGCAATTTGAGTACAAAATGAACTCAAATTTAG
TTTTGACAGCAGACAGAACTCTGATTGATCGTAGATCTAAGGATGAGCCC
ACCGGAGAAGTTTTACCAATTAAAGATATAGATCCAAAGAAAATGGGTGC
TCGAGTGTTAAAGCGTAAGCCTGATTGTATGGAAGAAAAACAGGATAAAC
GTATTAAAAGAGACCAATCGAATAGAACTTTAGATTATCAGAAAACTGAA
AGTGTTCTTACTTCAGATGTTATACAACAAAAGTTCAACTATGCTCCAAA
AACAGCCGAAACCAAATCAGTATACGAAGCAATGCTGAATATAGTTAATA
ATGTTCTACCAGAAGCAGATATGCATAATATAACTCAAGAAACTACTGAT
GAATTACTTATTGATTTAAAAAATTCTAATTTATCAGACAAAGAAAGAAA
GAAAGCAGCTAAAGAACTTCTTGGAAATAATTTAACGGATACTCAATATA
ATAGTCTGGTCAGTTTGTCAATTAAGCTAACTGATTATAAAGCTCCGAAA
TTTTTTACAAATGAAAATAATGACGACACAAATGATTTACATATTGAAAT
TGATGACGACCAGGAGGAAGAAGAAGATGATGTATATGGAGAAGTACAAG
ACTCAGAATCTGACGATGGAGGTGTAGAAGCCGATACAAACACGACTTTG
AACATTTCTCAATTTGCTGCTGGTACAATTTCTCAAGTTCCTGGAACAAG
CACAATTTTACCGTATTGCGGGTACCTAATACAACAAAAGAATATTGCAA
ATAGTGAAAAATTGAACGTCAATGACATAGATGCATTTTGGTTACAAAGA
ACTTTGAGTAAACATTTTACTGATCCCAATGAATGTCAAAAGCGAACTAA
AGATATTTTGGAAGTGTTAAAAATTGCTAAGAACGATCAAGAGTTAGAAA
ATAAACTACTTCGAATTGTTGGAGTCGACCGATTTGATTTGGTACGAATG
TTGAGAGAAAATAAATTAATGATTTATTACTGCACGAAATTGTGTTGTTC
TCAAACGCCTGAGGAACGAAACAAAATTGAAGCTGAAATGAAAACTGATC
CTAAATCAAATAGAATTTTAGCTGATTTGAGAAATATTGATCGAAAAGAG
GACATTGTTACTGCAGAGAGAAACCGAAAGACTCAGGCAAGGTCGGCGAA
AATTCAAGCTGATATAGAAATGGAAGATAGCAACGTAATATCTAATTATG
GAAGCGTCGATATGTTAGATTTGAAGAATATTACATTCACTCAAGGTAGT
CACCTTATGACAAATAAAAATTGTGAATTGCCTGATGGGTCATTTAGGAA
AACTAAACCTGGATATAATCTCGTTTGTGTCCCGGCACCAAAGCCAAAGC
CTTTAGAAGCGGATGAGAATCTAGTGAAAATCGCAGATTTGCCGTCATAT
GTAAAAGCTGCTTTCGAAAAAATTAAGACTCTCAATCGAATACAATCAAA
AGTTTACAAAACTGCTTTGGAAAGTGACGAAAACATTTTACTTTGTGCTC
CGACTGGGGCTGGTAAGACTAATGTAGCACTACTTACTATGATGAGGGAG
ATAGGAAAACACATAAATACAGATGGAACAATTAGAAAGGACGATTTCAA
AATTGTGTACATTGCTCCAATGAAATCGTTGGTCAATGAAATGGCCAATT
CATTTTCTGAGCGTTTGAAAAGTTATAATTTAAAAGTTGCTATGCTAAGT
GGAGATAGTCATTTAAGCAGAGAAGAAATCAATGAAACTCAGATTATCGT
ATGTACCCCTGAAAAATGGGACATTATTTCACGGAAATCGAGTGAAAAAA
CGTATACTCAATTGGTAAAACTTCTCATTATTGATGAAATCCATTTATTG
CACGACGAAAGAGGTCCAGTGTTAGAAGCAATCGTAGCTCGAACAATGCG
GGCGATGCAATCTTCGCACAGTAATATCGATATGAGAATTGTTGGATTGT
CAGCTACTCTTCCAAATACTGAGGATATCGCAGAATTTATCCACGTAGAT
AAACACAGGGGATTGTTTAAATTCGATAGCAGCTACCGTCCAGTGCCAAT
GGAACAAGAATATCTCGGCATTAATGAGCGAAAAGCCGTAAAACGGATAG
AATTGATGAATGATTTGGTATATGAAAAAGTAATGGAATATGCCGGCAAG
CATCAAGTTCTCATATTTGTACACAGCCGCAAGGAAACCGTGAATACTGC
GAAAGCAATCAAAGAAAAATGTTTAAATCGAGACACTCTTGGATTGTTTC
TTCGGGACAAGAAAGCGTCAACTCTAGTTTTACAACAGGATCTGGATAAG
GTGAAAAATCATGATCTGAAAGATTTACTGCCATACGGATTTGCTGTTCA
TCACGCCGGATTGGCCTACACCGATAGAAACTTTGTAGAGGAATTATTCA
CTGACAAACACATTCAAGTGCTCGTGTCAACTTCTACGTTAGCTTGGGGG
GTGAACTTACCGGCTCACGTTGTAATAATCAAAGGAACTCAAGTCTATAG
ACCAGATAAAGGAGAATGGACTGAACTGAGTGCCCTTGATGTCATGCAAA
TGTTCGGCAGAGCCGGTAGACCGCAATATGACACAAAAGGTGTCGGTATA
ATGATCACAAATGAGAATGAACTGACCTATTATTTGAGCTTGCTCAATGA
ACAGTTACCTATCGAGAGTCAATTGATTAGCAAATTAGCTGACAATCTCA
ATGCAGAAATAGTAATGGGAACCGTTAGAAACATTCATGAATCGATTGAC
TGGCTGCGTTACACATATCTGTACATTAGAATGCGTAAAAATCCATCTTT
GTATGGAGTTGAAAACGTGCTAATCGATGACCCAACACTTGATAATCATT
GTCGAAATTTGATTTACACAGCTGCCAGTATTCTAGAAAAGGCGGAAATG
ATAAATTTTGACAAGAGATCCGGAGAATTCATTTCAAATGAAATTGGCCG
AATCGCTGCCTATTACTATTGTACAAACGAAACGATGGATGTATTGAAAA
AGTTCCTCAAGAAATCAATGGGTGATATTGAAGTGTTTAAAGTATTTTCA
AAATGTGCCGAGTTTCGCAACATAACGGTTCGAGAAGAGGATAAAATTGA
GATTAAAAAGCTACTGGAAAATGTGCCGGTTCCGATAAAAGAAGGTGCAG
AAGATCCACCGACGAAAATCAATTGTTTACTTCAAGCGTACATTTCCCAG
TTGAAATTAGAGCGATTTACCCTATCTAGTGACACTGCATATATTTCCCA
ATCGGCTGCCCGTTTGATGCGAGCAATGTTCGAGGTTACATTGTCTAAAA
AATGGGCCAGTTTAACGTTATCAGTGCTGGAATCATGCAAAGAAGTCGAA
CAGAGAATGTGGGCCTGCTCGTGTCCTCTGAGACAATTCAAAAAGGTGCC
ATGGGAAATAACTAAAAAACTGGAAAAGAAAAACATTCCATTTGATAGAT
TAATCGATCAGAAACATCACGAATTGGGGGAATTGGTGAATAACCATAAA
ATGGGGAAAACAATTTACAAATATATTCACCAGATTCCGAAATTGAATCT
GAAAATTCATTTACAGCCAATAACGAGGAGCACTATGAAAGTCGAGTTGA
CAATTACTCCCGATTTTGAGTGGTGTCCCAAAAGCCACGGATCATCTCAG
GGATTCTGGATTTTTGTTGAGGACGTTATGTCAGAAAATATTCTACATTA
CGAATATTTCCTGTTAAAGGAAAAATTTAAAAACGATGATCATATCCTGA
AGTTCTACGTTTCAATATATGATCCATTGCCACCATTGTATTATATTCGT
GCGGTTTCCGATAAATGGATCGGATTAGAAACCGAAATTACAATAGTATT
CTTTAATGTTTTATTACCGGAGAAAAATCATCCACTAACAGAACTTCTCG
ATTTACAAAAACTTCCGTACAAAGCTTTGAGAAATGAAGAGTACGAGTCT
ATTTATTCAAAGAAAATGTCATTTTTCAACGCAATACAAACCCAGTGTTT
TGAATCGTTATACAATTCAGACGAGAATGTGTTCATTGGAGCTCCGACTG
GTAGCGGTAAAACCGTTTGTGCAGAGATTGCAATTATGCGATTATTCTCC
AATAGACAAGATGCTCGATGTGTTTATGTGACTGCTTTGAATGATTTGGC
ACAATTACGATATACTGAATGGATGAAAACATTTGGCGCCCTGGGGAAAA
CTGTTATCAAATTGACTGGAAACACAAACATGGATAATAAGAGTATTTCT
AAAGCACATATTATCGTATCGACCGCTGAGAATTGGGATGTGTTGTCTAG
GCGATGGAAAAAGAAAAAGGCTATTCAGAACATTCAATTATTTATCGTGG
ATGATCTCCATTTGATTGGTAGTCAGCATAACGGAACCACATTAGAAGTG
ATTTGCTCTAGAACTAGATATATGAGCTCGCAACTAGAAACTCCAATTAG
AATTATCGGATTGTCTTATTCATTAACCAATGCCAGAGATGTTGGCGAAT
GGTTGGATTGCCATCATACGGCAACGTACAATTTCAATCCCAGTGTCAGA
CATCGTCCTTTGGATATTGAAATCCAGACCTTCAATATCACACACAACGC
TACCCGATTGGCTGCAATGAGTAAACCGGTTTATCAAACCATATTGAAAT
TATCACCGAATAGTCCGGTAATTGTATTTGTTCCGACAATGAAGCAAACC
GAAGAAATCGCTTTCCTATTAATGGGTTACGCATTATCGGACAAGAAAAA
TTTCGGAAGAGCAAGTGAAGCAATTGTCAGTGAATATATGAGAAATATAT
CCAATGAAATTCTTATTGAGACATTGTCTTGTGGCGTTGGATTTATTCAC
GAAGCTTTATCGATCAATGAACGCAATCTCATGTTGGAGTTGTTCTCTAG
TCAATCTATTCAAATTTTGGTGGTCAGTCATACTCTTTGTTGGTCGATCC
CATCGGATGCGTATCTGGTGATTGTCATGGATACACAGGTGTACAACGGC
AAAGATTGCATGTACGACGACTATTCGGCAGTGGATTTAATTCAGATGGT
CGGTCGCGCCAATCATGCCTCAATGGACGATGCTAGATCAGTAATTATGT
GTCAAACCAATAAGAAAGACTTCATACAGAAATTTCTACATGAACCGTTG
CCATTGGAATCTCACCTTGACCACCAACTGCATGATCATTTCAATGCGGA
AATCGTTACAAAAACTATTGAAAACAAACAAGATGCGGTGGATTATTTAA
CTTGGACATTCCTGTATTATCGAATGACAAGAAATCCAAATTATTACAAT
TTGAAAGGAGTTAGTCATCGGCATTTAAGTGATCATTTGAGTGAACTTGT
CGAGAACACATTGATGGACTTGGAAAATTCGAAATGCATTGCAATTAAAG
ACGATATCGATGTTTCTGCTATAAATCTTGGAATGATTGCAACTTTTTAC
TATATCCACTATACAACGATTGAAATGTTTTCTCTCTCATTGAAACCGAA
TTCTAAGGTTCGCGTGTTGTTAGAACTAATCTGCAATGCAACCGAATTTG
AAGATTTACCATTAAGGCACGGAGAAGATGTTATTTTAACGAGAATAAAG
CAATCGTTGAGATTACCGATTTCAGAAGATCGTCGACTCAGTGATCCTAG
AACCAAGGCAAATATTTTGCTGCAAGCCTATTTATCCCGAGTTCCTATCA
AAGCTGCTGAATTGAAAGAAGATCTCAATCAAATTTTAATAAAGTCAGTT
AGATTGATACAGGCTTGTGTCGATGTTCTATCGAGCAATCGTTGGTTGGG
TCCTGCTCTTGCAGCCATGGAATTGGCGCAAATGATTACTCAAGCTCAAT
GGCACAGAGATTCATTGTTGAAACAAATTCCCCATTTTAATGAGCCTAAA
TTACTTGAACGATGTGAAGCAGCCGGTGTGAAAACCGTATTCGATTTAAT
GGAGCTTGAAGATGAACAGAAATTGGCTTTAATGAATTTTCCCGATGATA
AATTACAAGATGTTGCACGTTTCTTTCAATGCTACCCGAACATTGATTTA
ACGTATGAAGTAAGCAAAAGTGTGAGTGCTGGAGGTCAGGTTTCCGTGCA
AATACATTTGGCTAGAGATGAAGATAACATTTCTTCTGTGTACGCAAATA
ATTTTCCATACAAACGAGAAGAAAGTTGGTGGTTGGTTGTTGGTGAACCA
AATCAAGGACATTTAATATCGATAAAATTGCTCAGCTCACCAACTGAGAA
AGTATCTTTAAATTTCGATGCTCCTCGAAAATCAGGCTCCTATGAATACA
CTCTGTATTTCATGTCAGACTCCTATCTTGGTTGCGACCAGGAATATCAG
TTTACAATAAATGTTGTTTAATATTATTAGAAATAAAATTTTGATAATAA
AACAA
back to top

protein sequence of SMED30034055-orf-1

>SMED30034055-orf-1 ID=SMED30034055-orf-1|Name=SMED30034055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2143bp
MADNIARTMQFEYKMNSNLVLTADRTLIDRRSKDEPTGEVLPIKDIDPKK
MGARVLKRKPDCMEEKQDKRIKRDQSNRTLDYQKTESVLTSDVIQQKFNY
APKTAETKSVYEAMLNIVNNVLPEADMHNITQETTDELLIDLKNSNLSDK
ERKKAAKELLGNNLTDTQYNSLVSLSIKLTDYKAPKFFTNENNDDTNDLH
IEIDDDQEEEEDDVYGEVQDSESDDGGVEADTNTTLNISQFAAGTISQVP
GTSTILPYCGYLIQQKNIANSEKLNVNDIDAFWLQRTLSKHFTDPNECQK
RTKDILEVLKIAKNDQELENKLLRIVGVDRFDLVRMLRENKLMIYYCTKL
CCSQTPEERNKIEAEMKTDPKSNRILADLRNIDRKEDIVTAERNRKTQAR
SAKIQADIEMEDSNVISNYGSVDMLDLKNITFTQGSHLMTNKNCELPDGS
FRKTKPGYNLVCVPAPKPKPLEADENLVKIADLPSYVKAAFEKIKTLNRI
QSKVYKTALESDENILLCAPTGAGKTNVALLTMMREIGKHINTDGTIRKD
DFKIVYIAPMKSLVNEMANSFSERLKSYNLKVAMLSGDSHLSREEINETQ
IIVCTPEKWDIISRKSSEKTYTQLVKLLIIDEIHLLHDERGPVLEAIVAR
TMRAMQSSHSNIDMRIVGLSATLPNTEDIAEFIHVDKHRGLFKFDSSYRP
VPMEQEYLGINERKAVKRIELMNDLVYEKVMEYAGKHQVLIFVHSRKETV
NTAKAIKEKCLNRDTLGLFLRDKKASTLVLQQDLDKVKNHDLKDLLPYGF
AVHHAGLAYTDRNFVEELFTDKHIQVLVSTSTLAWGVNLPAHVVIIKGTQ
VYRPDKGEWTELSALDVMQMFGRAGRPQYDTKGVGIMITNENELTYYLSL
LNEQLPIESQLISKLADNLNAEIVMGTVRNIHESIDWLRYTYLYIRMRKN
PSLYGVENVLIDDPTLDNHCRNLIYTAASILEKAEMINFDKRSGEFISNE
IGRIAAYYYCTNETMDVLKKFLKKSMGDIEVFKVFSKCAEFRNITVREED
KIEIKKLLENVPVPIKEGAEDPPTKINCLLQAYISQLKLERFTLSSDTAY
ISQSAARLMRAMFEVTLSKKWASLTLSVLESCKEVEQRMWACSCPLRQFK
KVPWEITKKLEKKNIPFDRLIDQKHHELGELVNNHKMGKTIYKYIHQIPK
LNLKIHLQPITRSTMKVELTITPDFEWCPKSHGSSQGFWIFVEDVMSENI
LHYEYFLLKEKFKNDDHILKFYVSIYDPLPPLYYIRAVSDKWIGLETEIT
IVFFNVLLPEKNHPLTELLDLQKLPYKALRNEEYESIYSKKMSFFNAIQT
QCFESLYNSDENVFIGAPTGSGKTVCAEIAIMRLFSNRQDARCVYVTALN
DLAQLRYTEWMKTFGALGKTVIKLTGNTNMDNKSISKAHIIVSTAENWDV
LSRRWKKKKAIQNIQLFIVDDLHLIGSQHNGTTLEVICSRTRYMSSQLET
PIRIIGLSYSLTNARDVGEWLDCHHTATYNFNPSVRHRPLDIEIQTFNIT
HNATRLAAMSKPVYQTILKLSPNSPVIVFVPTMKQTEEIAFLLMGYALSD
KKNFGRASEAIVSEYMRNISNEILIETLSCGVGFIHEALSINERNLMLEL
FSSQSIQILVVSHTLCWSIPSDAYLVIVMDTQVYNGKDCMYDDYSAVDLI
QMVGRANHASMDDARSVIMCQTNKKDFIQKFLHEPLPLESHLDHQLHDHF
NAEIVTKTIENKQDAVDYLTWTFLYYRMTRNPNYYNLKGVSHRHLSDHLS
ELVENTLMDLENSKCIAIKDDIDVSAINLGMIATFYYIHYTTIEMFSLSL
KPNSKVRVLLELICNATEFEDLPLRHGEDVILTRIKQSLRLPISEDRRLS
DPRTKANILLQAYLSRVPIKAAELKEDLNQILIKSVRLIQACVDVLSSNR
WLGPALAAMELAQMITQAQWHRDSLLKQIPHFNEPKLLERCEAAGVKTVF
DLMELEDEQKLALMNFPDDKLQDVARFFQCYPNIDLTYEVSKSVSAGGQV
SVQIHLARDEDNISSVYANNFPYKREESWWLVVGEPNQGHLISIKLLSSP
TEKVSLNFDAPRKSGSYEYTLYFMSDSYLGCDQEYQFTINVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR041094Brr2_helicase_PWI
IPR036390WH_DNA-bd_sf
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR004179Sec63-dom
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000008C2_dom
IPR011991WHTH_DNA-bd_dom
IPR014756Ig_E-set
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0000354cis assembly of pre-catalytic spliceosome
GO:0000398mRNA splicing, via spliceosome
GO:0001649osteoblast differentiation
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005681spliceosomal complex
GO:0005682U5 snRNP
GO:0016020membrane
GO:0071013catalytic step 2 spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004179Sec63 domainSMARTSM00973Sec63_2coord: 1826..2139
e-value: 1.1E-87
score: 307.2
coord: 998..1303
e-value: 4.7E-104
score: 361.7
IPR004179Sec63 domainPFAMPF02889Sec63coord: 1827..2137
e-value: 1.2E-69
score: 234.4
IPR004179Sec63 domainPFAMPF02889Sec63coord: 999..1301
e-value: 9.0E-79
score: 264.3
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 511..695
e-value: 0.0043
score: 26.3
coord: 1359..1511
e-value: 1.2
score: 12.8
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 786..878
e-value: 9.0E-16
score: 68.4
coord: 1622..1710
e-value: 0.014
score: 21.5
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 770..876
e-value: 3.8E-6
score: 27.2
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 702..935
score: 12.297
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 1562..1750
score: 8.821
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 493..706
e-value: 1.4E-30
score: 117.5
coord: 1341..1545
e-value: 1.2E-16
score: 71.3
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 506..691
score: 22.443
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 1354..1529
score: 18.368
NoneNo IPR availableGENE3DG3DSA:1.10.3380.10coord: 1830..1971
e-value: 1.3E-47
score: 163.4
NoneNo IPR availableGENE3DG3DSA:1.10.10.2530coord: 908..997
e-value: 4.3E-32
score: 112.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 489..699
e-value: 1.3E-179
score: 599.2
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 1972..2029
e-value: 2.8E-19
score: 70.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 700..901
e-value: 1.3E-179
score: 599.2
NoneNo IPR availablePIRSFPIRSF039073BRR2coord: 1..2142
e-value: 0.0
score: 2641.8
NoneNo IPR availableGENE3DG3DSA:1.10.10.2530coord: 1740..1826
e-value: 3.1E-36
score: 125.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1537..1739
e-value: 3.2E-50
score: 172.3
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 1142..1197
e-value: 7.7E-22
score: 79.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1307..1536
e-value: 2.7E-84
score: 283.9
NoneNo IPR availableGENE3DG3DSA:1.10.3380.10coord: 999..1140
e-value: 6.6E-49
score: 167.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 206..227
NoneNo IPR availablePANTHERPTHR24075:SF13U5 SMALL NUCLEAR RIBONUCLEOPROTEIN 200 KDA HELICASEcoord: 6..2141
NoneNo IPR availablePANTHERPTHR24075FAMILY NOT NAMEDcoord: 6..2141
NoneNo IPR availableCDDcd18021DEXHc_Brr2_2coord: 1344..1531
e-value: 3.82515E-100
score: 317.663
NoneNo IPR availableCDDcd18795SF2_C_Ski2coord: 699..889
e-value: 6.54477E-61
score: 203.939
NoneNo IPR availableCDDcd18019DEXHc_Brr2_1coord: 480..695
e-value: 1.17401E-122
score: 383.259
NoneNo IPR availableCDDcd18795SF2_C_Ski2coord: 1539..1721
e-value: 8.52041E-26
score: 103.402
NoneNo IPR availableSUPERFAMILYSSF158702Sec63 N-terminal domain-likecoord: 1859..2032
NoneNo IPR availableSUPERFAMILYSSF158702Sec63 N-terminal domain-likecoord: 1026..1199
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 1347..1508
e-value: 5.7E-18
score: 65.3
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 499..675
e-value: 1.5E-28
score: 99.7
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 2032..2142
e-value: 6.2E-34
score: 118.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1198..1306
e-value: 8.2E-39
score: 134.0
IPR041094Brr2, N-terminal helicase PWI domainPFAMPF18149Helicase_PWIcoord: 271..379
e-value: 4.7E-34
score: 116.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1234..1522
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 694..906
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 439..684
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1531..1737
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 906..1009
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 1737..1838
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 2037..2141