N(G),N(G)-dimethylarginine dimethylaminohydrolase

Overview
NameN(G),N(G)-dimethylarginine dimethylaminohydrolase
Smed IDSMED30034045
Length (bp)1108
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N(G),N(G)-dimethylarginine dimethylaminohydrolase (SMED30034045) t-SNE clustered cells

Violin plots show distribution of expression levels for N(G),N(G)-dimethylarginine dimethylaminohydrolase (SMED30034045) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N(G),N(G)-dimethylarginine dimethylaminohydrolase (SMED30034045) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N(G),N(G)-dimethylarginine dimethylaminohydrolase (SMED30034045) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034045

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034045SMESG000056249.1 dd_Smed_v4_1460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034045SMESG000056249.1 dd_Smed_v4_1460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30034045SMESG000056249.1 dd_Smed_v4_1460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034045SMESG000056249.1 dd_Smed_v4_1460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034045SMESG000056249.1 dd_Smed_v4_1460_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:2715])

HSP 1 Score: 172.555 bits (436), Expect = 1.203e-50
Identity = 105/275 (38.18%), Postives = 158/275 (57.45%), Query Frame = 2
Query:   89 AFKYA-FAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            AF  A  A+V +LP S  Q      K    ++ +A  +H  +V +L  ++G+ V+EL  +E  P+CV V+D AV+   TAL+  P    R+ EV+++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+ +SEL K    L   ++L+ K
Sbjct:    9 AFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Match: DDAH2 (dimethylarginine dimethylaminohydrolase 2 [Source:HGNC Symbol;Acc:HGNC:2716])

HSP 1 Score: 140.198 bits (352), Expect = 2.068e-38
Identity = 92/272 (33.82%), Postives = 146/272 (53.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-------HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVEI  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V  P  +L+    M G      G S++A+K +  +  +  + Y  ++LP+D AA   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGP-SHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Match: DDAH2 (dimethylarginine dimethylaminohydrolase 2 [Source:HGNC Symbol;Acc:HGNC:2716])

HSP 1 Score: 140.198 bits (352), Expect = 2.068e-38
Identity = 92/272 (33.82%), Postives = 146/272 (53.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-------HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVEI  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V  P  +L+    M G      G S++A+K +  +  +  + Y  ++LP+D AA   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGP-SHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Match: DDAH2 (dimethylarginine dimethylaminohydrolase 2 [Source:HGNC Symbol;Acc:HGNC:2716])

HSP 1 Score: 140.198 bits (352), Expect = 2.068e-38
Identity = 92/272 (33.82%), Postives = 146/272 (53.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-------HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVEI  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V  P  +L+    M G      G S++A+K +  +  +  + Y  ++LP+D AA   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGP-SHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Match: DDAH2 (dimethylarginine dimethylaminohydrolase 2 [Source:HGNC Symbol;Acc:HGNC:2716])

HSP 1 Score: 140.198 bits (352), Expect = 2.068e-38
Identity = 92/272 (33.82%), Postives = 146/272 (53.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-------HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVEI  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V  P  +L+    M G      G S++A+K +  +  +  + Y  ++LP+D AA   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEIGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGP-SHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Fly
Match: CG1764 (gene:FBgn0030467 transcript:FBtr0073796)

HSP 1 Score: 187.578 bits (475), Expect = 5.666e-57
Identity = 102/272 (37.50%), Postives = 163/272 (59.93%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNI 901
            M+ KY  AIV+ + ++    ++N  F++Q A+++H  +  +LR IG+DV+EL P+++ PE V V+++AVI NG AL+       RQ E   +   LKKEL + ++EI   NA L G DVLFTG+E  VG+S+ TNE GA+AVA A+PEYP T +RV    R LK  +TMAG  V  +  S + ++++  +       Y++++LPE+ AA   YIN  ++H     IP ++   + KID     I++SE  +    L    LL+ ++K+ +++
Sbjct:    1 MSPKYTHAIVARISDAL---LENGKFDVQLAKQQHEQYCTLLRTIGLDVIELPPDDQLPEGVFVENSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGISSFTNEEGARAVAMAYPEYPVTPIRVNGTKR-LKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAICTYQKLTLPEESAANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTSSCLLLRRWKSIRSL 268          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Fly
Match: CG1764 (gene:FBgn0030467 transcript:FBtr0339946)

HSP 1 Score: 187.578 bits (475), Expect = 5.666e-57
Identity = 102/272 (37.50%), Postives = 163/272 (59.93%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNI 901
            M+ KY  AIV+ + ++    ++N  F++Q A+++H  +  +LR IG+DV+EL P+++ PE V V+++AVI NG AL+       RQ E   +   LKKEL + ++EI   NA L G DVLFTG+E  VG+S+ TNE GA+AVA A+PEYP T +RV    R LK  +TMAG  V  +  S + ++++  +       Y++++LPE+ AA   YIN  ++H     IP ++   + KID     I++SE  +    L    LL+ ++K+ +++
Sbjct:    1 MSPKYTHAIVARISDAL---LENGKFDVQLAKQQHEQYCTLLRTIGLDVIELPPDDQLPEGVFVENSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGISSFTNEEGARAVAMAYPEYPVTPIRVNGTKR-LKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAICTYQKLTLPEESAANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTSSCLLLRRWKSIRSL 268          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Zebrafish
Match: ddah2 (dimethylarginine dimethylaminohydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-913])

HSP 1 Score: 128.257 bits (321), Expect = 4.077e-34
Identity = 90/275 (32.73%), Postives = 138/275 (50.18%), Query Frame = 2
Query:   98 YAFAIVSSLPNSFTQFIKNPS---FNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMEN-----ANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +  AIV  +P SF +  +       +I KA+ +       LR+ +G+ ++E++ +   PE  +++D AVI   TAL+  P+   R  E   +R+ L  EL + +VE+  E      A L GSDVLFTGKE  VG+S HTN  GA+ +A  F ++  +TV V    R LK   +M G +   I  S+ A+K L  +  +  ++Y+ +S+ E+ AA   YI        L+H   E   +S   F+   D+  LP   SE  K G  L    LL+ K
Sbjct:   10 FTHAIVRGIPESFGKLAEGGDGFQTDIAKAKRQMGVLTGALRQKVGLQLIEIQVDSDLPESWRIEDIAVIQGDTALITRPFKQQRCCEAEAVRRVLN-ELNMTVVEMGEEEGGSGGATLEGSDVLFTGKEFFVGISKHTNHRGAEILADTFRDFAVSTVPVCGGSR-LKNICSMGGPDTIIISNSDGAKKTLRVMEQLSDHHYEILSVSEEVAANCIYIRGPAKVDYLLHPTAEECSDSIAAFQRLTDYTLLPTACSEASKLGGALSSFCLLINK 282          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Zebrafish
Match: ddah2 (dimethylarginine dimethylaminohydrolase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-913])

HSP 1 Score: 128.257 bits (321), Expect = 4.077e-34
Identity = 90/275 (32.73%), Postives = 138/275 (50.18%), Query Frame = 2
Query:   98 YAFAIVSSLPNSFTQFIKNPS---FNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMEN-----ANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +  AIV  +P SF +  +       +I KA+ +       LR+ +G+ ++E++ +   PE  +++D AVI   TAL+  P+   R  E   +R+ L  EL + +VE+  E      A L GSDVLFTGKE  VG+S HTN  GA+ +A  F ++  +TV V    R LK   +M G +   I  S+ A+K L  +  +  ++Y+ +S+ E+ AA   YI        L+H   E   +S   F+   D+  LP   SE  K G  L    LL+ K
Sbjct:   10 FTHAIVRGIPESFGKLAEGGDGFQTDIAKAKRQMGVLTGALRQKVGLQLIEIQVDSDLPESWRIEDIAVIQGDTALITRPFKQQRCCEAEAVRRVLN-ELNMTVVEMGEEEGGSGGATLEGSDVLFTGKEFFVGISKHTNHRGAEILADTFRDFAVSTVPVCGGSR-LKNICSMGGPDTIIISNSDGAKKTLRVMEQLSDHHYEILSVSEEVAANCIYIRGPAKVDYLLHPTAEECSDSIAAFQRLTDYTLLPTACSEASKLGGALSSFCLLINK 282          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Zebrafish
Match: ddah1 (dimethylarginine dimethylaminohydrolase 1 [Source:NCBI gene;Acc:406561])

HSP 1 Score: 88.5817 bits (218), Expect = 8.583e-21
Identity = 51/149 (34.23%), Postives = 83/149 (55.70%), Query Frame = 2
Query:  443 LFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            L +GKE  VGLS  TN+ GA+ +A  F +Y  +T+ V++   +LK   +MAG N+ AIG S++A+K L  I  +    Y+++++P+D AA   Y+N      +L+H   E+ P S  VFE       +P+   E  K    L  +++L+
Sbjct:    1 LCSGKEFFVGLSKRTNQRGAEILANTFKDYAVSTIPVEEGL-HLKSFCSMAGPNLIAIGSSDAAQKALKVIQQMSDCKYEKLTVPDDRAANCVYMNLPGKGDVLLHCTPEVFPESAKVFERLKSHMLIPVSNQEKMKVDGALTCLSVLL 148          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Xenopus
Match: cldn8.2 (claudin 8, gene 2 [Source:Xenbase;Acc:XB-GENE-991597])

HSP 1 Score: 160.999 bits (406), Expect = 2.130e-46
Identity = 98/272 (36.03%), Postives = 153/272 (56.25%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEILR-EIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +   AIV ++P+S  Q      K    +I  AR+ H  +V +L+ ++G+ V+EL  +E  P+   V+D A++   TAL+  P    R+ E   +++ L+ +L L +VE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V +   +LK   +MAG N+ AIG SE+A+K L  +  +  + Y +++LP+D AA   Y+N     H+L+H   E  P S  VFE   +   +P+  +EL K    L   +LL+ K
Sbjct:   11 RCTHAIVRAIPDSLCQEALRTEKGSVVDISLARKHHEQYVGVLKNKLGLSVIELPADECLPDAPFVEDVAIVCEETALITRPGAPSRRKEAEAVKKALQ-DLQLNVVEMTDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVCETL-HLKSFCSMAGPNLIAIGSSEAAQKALKTMQQMSDHRYDKLTLPDDAAANCIYLNIPSKGHVLLHRAPEDFPESAKVFEKLKEHMLIPLPNTELAKVDGCLTCCSLLINK 280          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Xenopus
Match: ccdc9 (coiled-coil domain containing 9 [Source:Xenbase;Acc:XB-GENE-5900021])

HSP 1 Score: 155.606 bits (392), Expect = 2.137e-44
Identity = 92/271 (33.95%), Postives = 154/271 (56.83%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYI-----NHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            M+ +Y  A+V  +P+S  +   N   ++ +A+ E+  +  ILR+ +G+ V+EL P E  P+   + DTAV++  TAL+  P+   R+ E   + Q + +EL  ++ E+N ENA L  SD+LFTG EI VGLS  TN  GA+ VA+ + +Y  +TV V     +LK   +M G +   IG S++A+K L  +  +  ++Y+ +++P+D AA   Y      +++LIH   +  PNS  VF+   D+  +P   +EL K G  L   ++L+ +
Sbjct:    3 MSGRYTHAVVRGVPSSLAKE-ANGQVDLARAQRENGVYCGILRQKLGLQVVELPPNEELPQGQLIGDTAVVIADTALITRPWIPARRKETEGL-QKIFEELKFRVCELNDENATLDASDILFTGSEIFVGLSKWTNLRGAEMVAKTYQDYAVSTVPVSGDL-HLKSFCSMGGPDTLVIGSSDTAKKALKTMEQLTDHHYETLTVPDDPAANCIYARVGPKSNVLIHRSVDEYPNSAQVFQKLTDYTLVPATCTELSKIGGFLTSCSILINR 270          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Match: Ddah1 (dimethylarginine dimethylaminohydrolase 1 [Source:MGI Symbol;Acc:MGI:1916469])

HSP 1 Score: 159.073 bits (401), Expect = 8.937e-46
Identity = 99/275 (36.00%), Postives = 154/275 (56.00%), Query Frame = 2
Query:   89 AFKYA-FAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            AF  A  A+V + P S  +      +    +  +A  +H  +V +L  ++G+ V++L  +E  P+CV V+D AV+   TAL+  P    R+ EV+++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+  SE+ K    L   ++ + K
Sbjct:    9 AFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHELYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Match: Ddah2 (dimethylarginine dimethylaminohydrolase 2 [Source:MGI Symbol;Acc:MGI:1859016])

HSP 1 Score: 137.502 bits (345), Expect = 1.751e-37
Identity = 90/272 (33.09%), Postives = 146/272 (53.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYI-------NHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVE+  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V     +L+    M G      G SE+A+K +  + ++  + Y  ++LP+D A+   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEMGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSG-SSHLRGLCGMGGPRTVVAGSSEAAQKAVRAMAALTDHPYASLTLPDDAASDCLFLRPGLPGATPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Match: Ddah1 (dimethylarginine dimethylaminohydrolase 1 [Source:MGI Symbol;Acc:MGI:1916469])

HSP 1 Score: 120.553 bits (301), Expect = 2.623e-32
Identity = 70/180 (38.89%), Postives = 104/180 (57.78%), Query Frame = 2
Query:  356 LIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            ++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+  SE+ K    L   ++ + K
Sbjct:    1 MMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINK 178          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Match: Ddah2 (dimethylarginine dimethylaminohydrolase 2 [Source:MGI Symbol;Acc:MGI:1859016])

HSP 1 Score: 120.168 bits (300), Expect = 2.227e-31
Identity = 75/217 (34.56%), Postives = 123/217 (56.68%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN 730
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVE+  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V     +L+    M G      G SE+A+K +  + ++  + Y  ++LP+D A+   ++ 
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEMGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSG-SSHLRGLCGMGGPRTVVAGSSEAAQKAVRAMAALTDHPYASLTLPDDAASDCLFLR 224          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Match: Ddah2 (dimethylarginine dimethylaminohydrolase 2 [Source:MGI Symbol;Acc:MGI:1859016])

HSP 1 Score: 90.8929 bits (224), Expect = 1.802e-21
Identity = 59/148 (39.86%), Postives = 89/148 (60.14%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQF----IKNPSFNIQKAREEH-LNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAF 523
            + + A++  +P S           P+ ++ KA+ EH +   ++ + +G+ +LEL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVE+  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F
Sbjct:   10 RCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEMGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTF 156          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Match: sp|O94760|DDAH1_HUMAN (N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3)

HSP 1 Score: 172.555 bits (436), Expect = 5.777e-50
Identity = 105/275 (38.18%), Postives = 158/275 (57.45%), Query Frame = 2
Query:   89 AFKYA-FAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            AF  A  A+V +LP S  Q      K    ++ +A  +H  +V +L  ++G+ V+EL  +E  P+CV V+D AV+   TAL+  P    R+ EV+++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+ +SEL K    L   ++L+ K
Sbjct:    9 AFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Match: sp|P56965|DDAH1_BOVIN (N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Bos taurus OX=9913 GN=DDAH1 PE=1 SV=3)

HSP 1 Score: 163.31 bits (412), Expect = 1.772e-46
Identity = 99/267 (37.08%), Postives = 151/267 (56.55%), Query Frame = 2
Query:  110 IVSSLPNSFTQ----FIKNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +V +LP S  Q      K    +  +A  +H  +V +L  ++G+ V++L  +E  P+CV V+D AV+   TAL+  P    R+ E +++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+  SEL K    L   ++L+ K
Sbjct:   17 VVRALPESLAQQALRRTKGDEVDFARAERQHQLYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEADMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVVDAL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDTAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSNSELEKVDGLLTCSSVLINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Match: sp|O08557|DDAH1_RAT (N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Ddah1 PE=1 SV=3)

HSP 1 Score: 159.844 bits (403), Expect = 3.759e-45
Identity = 96/272 (35.29%), Postives = 152/272 (55.88%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +   A+V + P S  +      +    +  +A  +H  +V +L  ++G+ V++L  +E  P+CV V+D AV+   TAL+  P    R+ EV+++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+  SE+ K    L   ++ + K
Sbjct:   12 RATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHQLYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Match: sp|Q9CWS0|DDAH1_MOUSE (N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus OX=10090 GN=Ddah1 PE=1 SV=3)

HSP 1 Score: 159.073 bits (401), Expect = 6.252e-45
Identity = 99/275 (36.00%), Postives = 154/275 (56.00%), Query Frame = 2
Query:   89 AFKYA-FAIVSSLPNSFTQFI----KNPSFNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            AF  A  A+V + P S  +      +    +  +A  +H  +V +L  ++G+ V++L  +E  P+CV V+D AV+   TAL+  P    R+ EV+++++ L+K L L IVE+  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A  F +Y  +TV V     +LK   +MAG N+ AIG SESA+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  V+E   D   +P+  SE+ K    L   ++ + K
Sbjct:    9 AFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHELYVGVLGSKLGLQVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSL-HLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINK 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Match: sp|Q3SX44|DDAH2_BOVIN (N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Bos taurus OX=9913 GN=DDAH2 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.180e-40
Identity = 92/272 (33.82%), Postives = 144/272 (52.94%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQ----FIKNPSFNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-------HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLV 874
            + + A++  +P S           P+ ++ KA+ EH      LR+ +G+ ++EL PEE  P    + DTAVI   TAL+  P+   R+ EV+ +R+ L+ +LGL+IVE+  ENA L G+DVLFTG+E  VGLS  TN  GA+ VA  F ++  +TV V     +L+    M G      G SE+A+K +  +  +  + Y  ++LP+D AA   ++          L+H     +PNS    +   D   +P+  SEL KAG  L  + L++
Sbjct:   10 RCSHALIRGVPESLASGEGAAAGLPALDLAKAQREHGVLGGKLRQRLGLQLVELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQ-DLGLRIVEMGDENATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVTS-TSHLRGLCGMGGPRTVVAGSSEAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGQPGLPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVL 279          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Match: A0A4S2M6W3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002268 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 3.173e-128
Identity = 176/282 (62.41%), Postives = 229/282 (81.21%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQF------IKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTL 913
            MAF+YA+AIVS +P+SF+ F      + NP  ++++   E   FVE LR IG+D+LEL+ EERHPECVKVDDTAVI+NGTALMC+P+G HRQGEVNLIRQTLKKE+G+KIVE+N ENA + GSDVLFTG+EIIVG+S+HTNE+GAQAVARAFPEY T+ ++V+ PFR+LK+A+ +AG+NV A+G SE+AR+ML+++  VV+Y YK I+LPED AA   Y+NH L+H    MIP S GVFENKID++RLPI L  LY AG+ + K+AL VG+F++Q NI+ST+
Sbjct:    1 MAFQYAYAIVSKIPDSFSSFRADKGTVDNPG-SLRELHNECTEFVETLRRIGIDILELKAEERHPECVKVDDTAVIINGTALMCNPHGSHRQGEVNLIRQTLKKEVGVKIVELNTENAQVEGSDVLFTGQEIIVGISSHTNEDGAQAVARAFPEYATSMIQVRPPFRSLKDAVGVAGINVLAVGGSEAAREMLSDMKRVVSYKYKIITLPEDHAANVLYVNHYLLHWAPSMIPASIGVFENKIDYDRLPIALPHLYAAGVPMSKLALFVGRFRHQCNIISTI 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Match: A0A1S8WI82 (Putative N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Opisthorchis viverrini OX=6198 GN=X801_10063 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 3.173e-128
Identity = 176/282 (62.41%), Postives = 229/282 (81.21%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQF------IKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTL 913
            MAF+YA+AIVS +P+SF+ F      + NP  ++++   E   FVE LR IG+D+LEL+ EERHPECVKVDDTAVI+NGTALMC+P+G HRQGEVNLIRQTLKKE+G+KIVE+N ENA + GSDVLFTG+EIIVG+S+HTNE+GAQAVARAFPEY T+ ++V+ PFR+LK+A+ +AG+NV A+G SE+AR+ML+++  VV+Y YK I+LPED AA   Y+NH L+H    MIP S GVFENKID++RLPI L  LY AG+ + K+AL VG+F++Q NI+ST+
Sbjct:    1 MAFQYAYAIVSKIPDSFSSFRADKGTVDNPG-SLRELHNECTEFVETLRRIGIDILELKAEERHPECVKVDDTAVIINGTALMCNPHGSHRQGEVNLIRQTLKKEVGVKIVELNTENAQVEGSDVLFTGQEIIVGISSHTNEDGAQAVARAFPEYATSMIQVRPPFRSLKDAVGVAGINVLAVGGSEAAREMLSDMKRVVSYKYKIITLPEDHAANVLYVNHYLLHWAPSMIPASIGVFENKIDYDRLPIALPHLYAAGVPMSKLALFVGRFRHQCNIISTI 281          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Match: A0A504YTB9 (Ng-dimethylarginine dimethylaminohydrolase OS=Fasciola gigantica OX=46835 GN=FGIG_08186 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.425e-125
Identity = 172/280 (61.43%), Postives = 223/280 (79.64%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSF----NIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTL 913
            MAF+YA+AIVS +P SF+ +  +       +++ A  E   FVE LR+IGVD+LELE EERHPECVKVDDTAVI+NGTALMC+P G HRQGEVNLIRQTLKKE+G+KIVE+N ENA++ GSDVLFTG+EIIVG S HTNE GAQAVARAFPEY T+ ++V+ PF +LK+A+ +AG+NV A+G+SE+A+KML +I  V +Y YK I+LPED AA   Y+NH L+H   EMIPNS G+FENKID+ R  + + EL+ AG+ L K+AL VG+F++Q+N++ST+
Sbjct:    1 MAFQYAYAIVSKIPESFSDYQADKETAGRRSLRGAHTERTEFVETLRKIGVDILELEAEERHPECVKVDDTAVIINGTALMCNPSGPHRQGEVNLIRQTLKKEVGVKIVELNTENAHVEGSDVLFTGQEIIVGTSRHTNEAGAQAVARAFPEYATSMIQVRAPFLSLKDAVGVAGINVLAVGESEAAQKMLKDIRKVASYTYKLITLPEDHAANLLYVNHYLMHWSPEMIPNSIGIFENKIDYKRTSMHMPELFSAGVPLSKLALFVGRFRHQRNVISTI 280          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Match: A0A5K4F1Q9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.310e-122
Identity = 174/286 (60.84%), Postives = 221/286 (77.27%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSFNI----------QKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTL 913
            MAF+Y +A+VS +P SF +F+ +P  NI          ++A  E   FVE LR+ GVDVLE+E +ERHPECVKVDDTAVI+NGTALMC+PY  HRQGEVNLIR TLKKELG+KIVE+N ENA + GSDVLFTG+EIIVG+SAHTNE GA AVARAFPEY T+ V++ QPFR+LK+A+ +AG+NV A+G+SE+A+++L EI  V ++ YK I+LPED AA   YINH L+HL  +MIP S GVFENKI++ R  I + EL+ AG++L K+AL  G F  QKNI+ST+
Sbjct:    1 MAFQYEYAVVSQIPRSFEEFLMSPDANIPGKKGGKFDYEEACNEREKFVEALRQNGVDVLEMEADERHPECVKVDDTAVIINGTALMCNPYRCHRQGEVNLIRHTLKKELGIKIVELNTENAQVEGSDVLFTGQEIIVGISAHTNEAGAHAVARAFPEYATSIVKLPQPFRSLKDAVGVAGINVLAVGESEAAKQLLKEIGRVASHTYKVITLPEDHAANVLYINHHLLHLSSQMIPKSIGVFENKINYYRSQIHIPELFNAGVSLSKLALFAGPFGRQKNIISTI 286          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Match: C1L7I7 (Ng-dimethylarginine dimethylaminohydrolase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 6.450e-121
Identity = 172/286 (60.14%), Postives = 218/286 (76.22%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPS----------FNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTL 913
            MAF+Y +AIVS +P SF +F+ +P           FN ++A  E   FVE LR+ GVDVLE+E +ERHPECVKVDDTAVI+NGTALMC+PY  HRQGEVNLIR TLKKELG+KIVE+N ENA + GSDVLFTG+EIIVG+SAHTNE GA AVARAFPEY T+ V++   FR+LK+A+ +AG+NV A+G+SE+A+++L EI  V ++ YK I+LPED AA   YINH L+HL  +MIP S G+FENKI++ R  + + EL+ AGI L K+AL  G F  QKNI+ST+
Sbjct:    1 MAFQYEYAIVSQIPKSFEEFLTSPDANGTIKKGDKFNYEEACNEREKFVEALRQNGVDVLEMEADERHPECVKVDDTAVIINGTALMCNPYRCHRQGEVNLIRHTLKKELGIKIVELNTENAQVEGSDVLFTGQEIIVGISAHTNEAGAHAVARAFPEYATSIVKLHTAFRSLKDAVGVAGINVLAVGESEAAKQLLKEIGRVTSHTYKVITLPEDHAANVLYINHHLLHLSSQMIPKSIGIFENKINYYRSQVHIPELFNAGIPLSKLALFAGPFGRQKNIISTI 286          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Cavefish
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:2715])

HSP 1 Score: 153.68 bits (387), Expect = 7.961e-44
Identity = 94/273 (34.43%), Postives = 149/273 (54.58%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFT-QFIKN-PS---FNIQKAREEHLNFVEIL-REIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            ++  A++ + P+S   Q +++ P+    +++  R E   +V +L + +G+ V+ LE +E  P+CV V+D AV+   TAL+  P    R+ E   ++  L   L L IVE+  E+A L G DVLFTG+E  VGLS  TN  GA+ +A  F +Y  +TV V     +LK   +MAG  + AIG SE+A+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  VFE   D   +P+   E  K    L   ++L+ K
Sbjct:    7 RFTHAVIRAAPDSLAAQALRSGPAELQVDMEAVRREEEQYVSVLEKTLGLRVVRLEADEELPDCVFVEDPAVVCGNTALITRPGAPSRRKETEALKTALAN-LDLNIVEMTDESATLDGGDVLFTGREFFVGLSKRTNRRGAEILADTFQDYAVSTVPVLDTL-HLKSFCSMAGPGLIAIGSSEAAQKALKTMQQMSDHKYDKLTVPDDLAANCIYMNLPDKGHVLLHCTPEAFPESAKVFEKLKDHMLIPVHNDEKRKVDGCLTCCSVLINK 277          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Cavefish
Match: ddah2 (N(G),N(G)-dimethylarginine dimethylaminohydrolase 2-like [Source:NCBI gene;Acc:103041625])

HSP 1 Score: 138.658 bits (348), Expect = 4.566e-38
Identity = 89/279 (31.90%), Postives = 141/279 (50.54%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQFI---KNPSFNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINME-----NANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKN 889
            ++  AIV  +P SF Q     ++ S ++ KA+ +       LR+ +G+ ++E+  +   PE  +++D AVI   TAL+  P+   R+ E + +R+ +  EL L +VE+ +E      A L GSDVLFTG+E  VG+S HTN  GA+ +A  F ++  +TV V    R LK   +M G        SE A+K    +  +  ++Y  +S+ ED A+   Y+        L+H   +  PNS   F+   D+  LP   SE  K G  L    LL+ +  N
Sbjct:    9 RFTHAIVRGIPESFGQRADGGESVSVDVAKAQRQFGVLTGALRQKVGLQLIEIPADPELPESWRIEDIAVIQGDTALITRPFKQQRRAEADAVRRVMN-ELNLTVVEMGVEEGGSGGATLEGSDVLFTGREFFVGISKHTNHRGAEVLADTFRDFAVSTVPVCGGCR-LKNICSMGGPETIVFSNSEGAKKTQRMMEQLTDHHYDVLSVSEDVASNCVYVRGPAKVDYLLHPTADECPNSITAFQKLPDYTLLPTACSEASKLGGALSSFCLLINRKPN 285          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Cavefish
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:2715])

HSP 1 Score: 114.775 bits (286), Expect = 6.595e-30
Identity = 67/177 (37.85%), Postives = 96/177 (54.24%), Query Frame = 2
Query:  365 QTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            +T    L L IVE+  E+A L G DVLFTG+E  VGLS  TN  GA+ +A  F +Y  +TV V     +LK   +MAG  + AIG SE+A+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   E  P S  VFE   D   +P+   E  K    L   ++L+ K
Sbjct:   23 KTALANLDLNIVEMTDESATLDGGDVLFTGREFFVGLSKRTNRRGAEILADTFQDYAVSTVPVLDTL-HLKSFCSMAGPGLIAIGSSEAAQKALKTMQQMSDHKYDKLTVPDDLAANCIYMNLPDKGHVLLHCTPEAFPESAKVFEKLKDHMLIPVHNDEKRKVDGCLTCCSVLINK 198          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007943.1 (pep scaffold:Pmarinus_7.0:GL484822:1474:8984:-1 gene:ENSPMAG00000007186.1 transcript:ENSPMAT00000007943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.923e-10
Identity = 26/49 (53.06%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  377 KELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAF 523
            +EL ++IVE+  E+A L G DVLFTG+E  VGLS  TN+ GA+ +A  F
Sbjct:   17 EELKMRIVEMTDESACLDGGDVLFTGREFFVGLSKRTNQRGAEILADTF 65          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:NCBI gene;Acc:101157285])

HSP 1 Score: 163.31 bits (412), Expect = 1.835e-47
Identity = 98/272 (36.03%), Postives = 149/272 (54.78%), Query Frame = 2
Query:   98 YAFAIVSSLPNSFTQ---FIKNPSFNIQKAREEHLNFVEILR-EIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFK 886
            Y  AIV  +P S  +          ++ KAR EH  +V++LR  +G++V+EL  +E  P+CV V+D AV+   TAL+  P    R+ E   +++ L  +L + IVEI  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A AF +Y  +TV V +   +LK   +M G  +  IG S+ A+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   +  P S  VFE   D   +P+   E  K    L   ++L+ K K
Sbjct:   11 YTHAIVRGIPASLAKEALRTNQAEVDLDKARTEHDAYVQVLRTRLGLEVVELPADESLPDCVFVEDAAVVCGDTALITRPGAESRRRETEAMKEALT-DLNMNIVEIADENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADAFKDYAVSTVPVLEGL-HLKSFCSMGGPGLIVIGSSDPAQKALKIMQQMSDHRYDKLTVPDDLAANCIYMNLPDKGHVLLHCTTDEFPESVKVFEKLKDHMLIPVSNLEKVKLDGALTCCSVLINKKK 280          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Match: ddah2 (N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 [Source:NCBI gene;Acc:101158865])

HSP 1 Score: 146.747 bits (369), Expect = 4.461e-41
Identity = 89/279 (31.90%), Postives = 146/279 (52.33%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQFIKNP------SFNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINME-----NANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYI-----NHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            ++  A+V  +P SF +   +       S ++ KA+ +       LR+ +G+ ++E+ P+   PE  +++D AVI   TAL+  P+   R+ EV  +R+ +  EL L +VE+  E      A L GSDVLFTG+E  VG+S+HTN  GA+ +A  F ++  +TV V    R LK   +M G +      +E A+K L  +  +  + Y+ +S+PE+ AA   Y+        L+H   E  P+S   F+   D++ LP   SE  K G +L  + LL+ +
Sbjct:    9 RFTHAVVRGIPESFGKTAADGHENGAVSVDLAKAQRQFGCLTGALRQKVGLQLIEIPPDAELPESWRIEDVAVIQGDTALIARPFQQQRRSEVKAVRRVMS-ELNLTVVEMGAEQGGSAGATLEGSDVLFTGREFFVGISSHTNHGGAEVLADTFRDFAVSTVPVCGGSR-LKNICSMGGPDTIVFSSTEGAKKTLRVMEQLTDHRYEVLSVPEESAANCIYVKGPSKKDFLLHRPVEECPDSVSAFQKLPDYSLLPTACSEASKLGASLSSLCLLINR 285          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Match: ddah2 (N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 [Source:NCBI gene;Acc:101158865])

HSP 1 Score: 146.747 bits (369), Expect = 4.461e-41
Identity = 89/279 (31.90%), Postives = 146/279 (52.33%), Query Frame = 2
Query:   95 KYAFAIVSSLPNSFTQFIKNP------SFNIQKAREEHLNFVEILRE-IGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINME-----NANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYI-----NHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGK 880
            ++  A+V  +P SF +   +       S ++ KA+ +       LR+ +G+ ++E+ P+   PE  +++D AVI   TAL+  P+   R+ EV  +R+ +  EL L +VE+  E      A L GSDVLFTG+E  VG+S+HTN  GA+ +A  F ++  +TV V    R LK   +M G +      +E A+K L  +  +  + Y+ +S+PE+ AA   Y+        L+H   E  P+S   F+   D++ LP   SE  K G +L  + LL+ +
Sbjct:    9 RFTHAVVRGIPESFGKTAADGHENGAVSVDLAKAQRQFGCLTGALRQKVGLQLIEIPPDAELPESWRIEDVAVIQGDTALIARPFQQQRRSEVKAVRRVMS-ELNLTVVEMGAEQGGSAGATLEGSDVLFTGREFFVGISSHTNHGGAEVLADTFRDFAVSTVPVCGGSR-LKNICSMGGPDTIVFSSTEGAKKTLRVMEQLTDHRYEVLSVPEESAANCIYVKGPSKKDFLLHRPVEECPDSVSAFQKLPDYSLLPTACSEASKLGASLSSLCLLINR 285          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:NCBI gene;Acc:101157285])

HSP 1 Score: 112.464 bits (280), Expect = 2.874e-29
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 2
Query:  380 ELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFK 886
            +L + IVEI  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A AF +Y  +TV V +   +LK   +M G  +  IG S+ A+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   +  P S  VFE   D   +P+   E  K    L   ++L+ K K
Sbjct:    7 DLNMNIVEIADENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADAFKDYAVSTVPVLEGL-HLKSFCSMGGPGLIVIGSSDPAQKALKIMQQMSDHRYDKLTVPDDLAANCIYMNLPDKGHVLLHCTTDEFPESVKVFEKLKDHMLIPVSNLEKVKLDGALTCCSVLINKKK 179          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Match: DDAH1 (dimethylarginine dimethylaminohydrolase 1 [Source:NCBI gene;Acc:101157285])

HSP 1 Score: 112.079 bits (279), Expect = 4.171e-29
Identity = 65/174 (37.36%), Postives = 96/174 (55.17%), Query Frame = 2
Query:  380 ELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYIN-----HILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFK 886
            +L + IVEI  ENA L G DVLFTG+E  VGLS  TN+ GA+ +A AF +Y  +TV V +   +LK   +M G  +  IG S+ A+K L  +  +  + Y ++++P+D AA   Y+N     H+L+H   +  P S  VFE   D   +P+   E  K    L   ++L+ K K
Sbjct:   14 DLNMNIVEIADENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADAFKDYAVSTVPVLEGL-HLKSFCSMGGPGLIVIGSSDPAQKALKIMQQMSDHRYDKLTVPDDLAANCIYMNLPDKGHVLLHCTTDEFPESVKVFEKLKDHMLIPVSNLEKVKLDGALTCCSVLINKKK 186          
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Planmine SMEST
Match: SMESG000056249.1 (SMESG000056249.1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 277/277 (100.00%), Postives = 277/277 (100.00%), Query Frame = 2
Query:   86 MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTLA 916
            MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTLA
Sbjct:    1 MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVLELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKELGLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYPTTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELYKAGITLPKMALLVGKFKNQKNIVSTLA 277          
The following BLAST results are available for this feature:
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDAH11.203e-5038.18dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
DDAH22.068e-3833.82dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
DDAH22.068e-3833.82dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
DDAH22.068e-3833.82dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
DDAH22.068e-3833.82dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG17645.666e-5737.50gene:FBgn0030467 transcript:FBtr0073796[more]
CG17645.666e-5737.50gene:FBgn0030467 transcript:FBtr0339946[more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ddah24.077e-3432.73dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
ddah24.077e-3432.73dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
ddah18.583e-2134.23dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cldn8.22.130e-4636.03claudin 8, gene 2 [Source:Xenbase;Acc:XB-GENE-9915... [more]
ccdc92.137e-4433.95coiled-coil domain containing 9 [Source:Xenbase;Ac... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddah18.937e-4636.00dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
Ddah21.751e-3733.09dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
Ddah12.623e-3238.89dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
Ddah22.227e-3134.56dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
Ddah21.802e-2139.86dimethylarginine dimethylaminohydrolase 2 [Source:... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O94760|DDAH1_HUMAN5.777e-5038.18N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
sp|P56965|DDAH1_BOVIN1.772e-4637.08N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
sp|O08557|DDAH1_RAT3.759e-4535.29N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
sp|Q9CWS0|DDAH1_MOUSE6.252e-4536.00N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
sp|Q3SX44|DDAH2_BOVIN1.180e-4033.82N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M6W33.173e-12862.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8WI823.173e-12862.41Putative N(G),N(G)-dimethylarginine dimethylaminoh... [more]
A0A504YTB92.425e-12561.43Ng-dimethylarginine dimethylaminohydrolase OS=Fasc... [more]
A0A5K4F1Q92.310e-12260.84Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
C1L7I76.450e-12160.14Ng-dimethylarginine dimethylaminohydrolase OS=Schi... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DDAH17.961e-4434.43dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
ddah24.566e-3831.90N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
DDAH16.595e-3037.85dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007943.11.923e-1053.06pep scaffold:Pmarinus_7.0:GL484822:1474:8984:-1 ge... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDAH11.835e-4736.03dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
ddah24.461e-4131.90N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
ddah24.461e-4131.90N(G),N(G)-dimethylarginine dimethylaminohydrolase ... [more]
DDAH12.874e-2937.36dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
DDAH14.171e-2937.36dimethylarginine dimethylaminohydrolase 1 [Source:... [more]
back to top
BLAST of N(G),N(G)-dimethylarginine dimethylaminohydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000056249.10.000e+0100.00SMESG000056249.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034045 ID=SMED30034045|Name=N(G),N(G)-dimethylarginine dimethylaminohydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1108bp
TAACTGGTTTAAATAGATTAGTGTAATTAATTACTTAATTGAAAAATTAT
CTTATTTGATAAATATAAGGAAATAACTAATTGTTATGGCATTTAAGTAC
GCTTTTGCTATTGTTAGTAGTTTACCAAATTCTTTTACCCAATTTATTAA
AAATCCATCTTTTAATATTCAAAAAGCTCGTGAAGAGCATTTGAATTTTG
TTGAAATTTTGCGAGAAATAGGAGTCGATGTGTTAGAACTTGAACCAGAA
GAAAGACATCCTGAATGTGTGAAAGTTGATGATACTGCAGTAATATTGAA
TGGTACTGCTTTAATGTGTAGTCCATATGGAGTTCATAGACAAGGCGAAG
TTAATTTAATAAGACAAACCTTAAAGAAAGAGCTGGGATTAAAAATAGTT
GAAATCAATATGGAGAATGCTAATTTAGCTGGTAGTGATGTTTTATTTAC
AGGCAAAGAGATAATCGTTGGATTGTCTGCCCATACCAATGAAAATGGTG
CTCAAGCTGTAGCTCGCGCTTTCCCTGAATATCCAACAACAACTGTGCGT
GTGCAGCAACCATTCCGTAATCTGAAAGAAGCTATAACAATGGCCGGAGT
CAATGTGTTTGCTATTGGTCAGAGCGAATCTGCTCGTAAAATGCTAACAG
AGATAATGAGCGTTGTGACCTACAATTACAAACAAATCTCGCTTCCAGAA
GATTTTGCTGCTCAGACATTTTACATCAATCACATATTGATCCATCTGTG
TGACGAAATGATTCCAAACAGTTTCGGAGTGTTTGAAAATAAGATCGATT
TCAACCGGCTGCCAATTGACCTATCAGAACTCTACAAAGCCGGCATCACT
TTACCCAAAATGGCTCTGCTCGTAGGGAAATTTAAAAATCAAAAAAATAT
CGTTTCGACTTTAGCATAAGGAAATTGATTTTCTCGCATTGTTTTAATGC
TGCCCAATGATTTCAATACCGAATCTGTGTTTGTGTGTGTTTTTTGATTG
GTTGATATTTGATTTGGTTCATTTTTATATATCGATCAGTGAATATTATT
GACTTAGACTGTCTATTGACTCATTCTGTTTATTATTATTATTATTATTA
TTAATATC
back to top

protein sequence of SMED30034045-orf-1

>SMED30034045-orf-1 ID=SMED30034045-orf-1|Name=SMED30034045-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MAFKYAFAIVSSLPNSFTQFIKNPSFNIQKAREEHLNFVEILREIGVDVL
ELEPEERHPECVKVDDTAVILNGTALMCSPYGVHRQGEVNLIRQTLKKEL
GLKIVEINMENANLAGSDVLFTGKEIIVGLSAHTNENGAQAVARAFPEYP
TTTVRVQQPFRNLKEAITMAGVNVFAIGQSESARKMLTEIMSVVTYNYKQ
ISLPEDFAAQTFYINHILIHLCDEMIPNSFGVFENKIDFNRLPIDLSELY
KAGITLPKMALLVGKFKNQKNIVSTLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR033199DDAH
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 2..265
e-value: 1.7E-57
score: 196.9
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 13..253
IPR033199Dimethylarginine dimethylaminohydrolasePANTHERPTHR12737DIMETHYLARGININE DIMETHYLAMINOHYDROLASEcoord: 3..264