Bromodomain-containing protein 2

Overview
NameBromodomain-containing protein 2
Smed IDSMED30034033
Length (bp)1368
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bromodomain-containing protein 2 (SMED30034033) t-SNE clustered cells

Violin plots show distribution of expression levels for Bromodomain-containing protein 2 (SMED30034033) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bromodomain-containing protein 2 (SMED30034033) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bromodomain-containing protein 2 (SMED30034033) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034033

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034033h1SMcG0012777 SmedASXL_009283SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30034033h1SMcG0012777 dd_Smed_v4_7290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034033h1SMcG0012777 dd_Smed_v4_7290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Match: BRDT (bromodomain testis associated [Source:HGNC Symbol;Acc:HGNC:1105])

HSP 1 Score: 93.2041 bits (230), Expect = 1.229e-21
Identity = 47/110 (42.73%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
             TN+L  + K ++  + ++  + PF +PVD V  QLPDY  +IK+P+DL+TIK+RL  K+Y    +C++DFN M  NCY+YN P D I+ M   L+     KL  MP +E
Sbjct:   28 LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE 137          

HSP 2 Score: 52.7582 bits (125), Expect = 1.443e-7
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S ++ F  PVD   L L DY+ +IK P+DL+TI+K ++ + Y      + D   M +NC +YN    DI
Sbjct:   47 SFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDI 115          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Match: BRDT (bromodomain testis associated [Source:HGNC Symbol;Acc:HGNC:1105])

HSP 1 Score: 92.4337 bits (228), Expect = 1.412e-21
Identity = 47/110 (42.73%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
             TN+L  + K ++  + ++  + PF +PVD V  QLPDY  +IK+P+DL+TIK+RL  K+Y    +C++DFN M  NCY+YN P D I+ M   L+     KL  MP +E
Sbjct:   28 LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE 137          

HSP 2 Score: 52.373 bits (124), Expect = 1.557e-7
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S ++ F  PVD   L L DY+ +IK P+DL+TI+K ++ + Y      + D   M +NC +YN    DI
Sbjct:   47 SFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDI 115          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Match: BRDT (bromodomain testis associated [Source:HGNC Symbol;Acc:HGNC:1105])

HSP 1 Score: 92.4337 bits (228), Expect = 1.412e-21
Identity = 47/110 (42.73%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
             TN+L  + K ++  + ++  + PF +PVD V  QLPDY  +IK+P+DL+TIK+RL  K+Y    +C++DFN M  NCY+YN P D I+ M   L+     KL  MP +E
Sbjct:   28 LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE 137          

HSP 2 Score: 52.373 bits (124), Expect = 1.557e-7
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S ++ F  PVD   L L DY+ +IK P+DL+TI+K ++ + Y      + D   M +NC +YN    DI
Sbjct:   47 SFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDI 115          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Match: BRDT (bromodomain testis associated [Source:HGNC Symbol;Acc:HGNC:1105])

HSP 1 Score: 92.8189 bits (229), Expect = 2.907e-21
Identity = 47/110 (42.73%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
             TN+L  + K ++  + ++  + PF +PVD V  QLPDY  +IK+P+DL+TIK+RL  K+Y    +C++DFN M  NCY+YN P D I+ M   L+     KL  MP +E
Sbjct:   28 LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE 137          

HSP 2 Score: 52.7582 bits (125), Expect = 1.983e-7
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S ++ F  PVD   L L DY+ +IK P+DL+TI+K ++ + Y      + D   M +NC +YN    DI
Sbjct:   47 SFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDI 115          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Match: BRDT (bromodomain testis associated [Source:HGNC Symbol;Acc:HGNC:1105])

HSP 1 Score: 93.2041 bits (230), Expect = 7.197e-20
Identity = 47/110 (42.73%), Postives = 69/110 (62.73%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
             TN+L  + K ++  + ++  + PF +PVD V  QLPDY  +IK+P+DL+TIK+RL  K+Y    +C++DFN M  NCY+YN P D I+ M   L+     KL  MP +E
Sbjct:   28 LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE 137          

HSP 2 Score: 69.3218 bits (168), Expect = 4.471e-12
Identity = 34/101 (33.66%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSI 1002
            C  ++ E+++ K+ S  + F  PVDV +LGL +Y++++K P+DL TI++ MD + Y        D+ LM  NC  YN    ++  + R  Q  FE  +  I
Sbjct:  276 CSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFETHFSKI 376          

HSP 3 Score: 61.6178 bits (148), Expect = 1.319e-9
Identity = 31/71 (43.66%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF  PVD  A  L +Y  V+K+P+DL TIKE++  + Y+   K   D  LM  NCY YN PD  +++M 
Sbjct:  292 AWPFYNPVDVNALGLHNYYDVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMA 362          

HSP 4 Score: 52.7582 bits (125), Expect = 9.512e-7
Identity = 26/69 (37.68%), Postives = 39/69 (56.52%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S ++ F  PVD   L L DY+ +IK P+DL+TI+K ++ + Y      + D   M +NC +YN    DI
Sbjct:   47 SFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDI 115          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Match: F13C5.2 (pep chromosome:WBcel235:X:593960:596289:1 gene:WBGene00017423.1 transcript:F13C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13C5.2)

HSP 1 Score: 80.8777 bits (198), Expect = 2.184e-16
Identity = 44/123 (35.77%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  643 SENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            SE+   S+++     E  KC  ++ E   S + S  + F +PVDV  LGL+DYHE+IK P+D+STI+K +    YD+ +    D  LMINNC  YN     + +   +F+ +F   +   F E
Sbjct:  106 SEDEAESDHL---HDELKKCLSILKEFEKSTHDSFTFPFRKPVDVVLLGLTDYHEVIKKPMDMSTIRKKLIGEEYDTAVEFKEDFKLMINNCLTYNNEGDPVADFALQFRKKFAAKWKKEFPE 225          

HSP 2 Score: 67.3958 bits (163), Expect = 5.581e-12
Identity = 37/98 (37.76%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAK------PFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGI 474
            ++ L   LKK +  +  +E +       PF KPVD V   L DY +VIK P+D+STI+++LI + Y+T  +  +DF LM+ NC  YN   DP+    +
Sbjct:  112 SDHLHDELKKCLSILKEFEKSTHDSFTFPFRKPVDVVLLGLTDYHEVIKKPMDMSTIRKKLIGEEYDTAVEFKEDFKLMINNCLTYNNEGDPVADFAL 209          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Match: bet-1 (Bromodomain-containing protein bet-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95Y80])

HSP 1 Score: 74.7146 bits (182), Expect = 4.890e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  L+N+  + KY+   + F EPVD + LGL DYH++IK P+DL +++  M+   Y       +D+ LM+ NC +YN     +G+    F L F+ ++   + E
Sbjct:  266 CLKLLNDFSTKKYQEFAWPFNEPVDAEQLGLHDYHKIIKEPMDLKSMKAKMESGAYKEPSDFEHDVRLMLRNCFLYN----PVGDPVHSFGLRFQEVFDRRWAE 365          

HSP 2 Score: 67.3958 bits (163), Expect = 1.139e-11
Identity = 31/92 (33.70%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
             TNKLD ++  ++    +++   PF KPVD VA  +P Y + +  P+DL TI+ RL   +Y    +C+ D   + +NCY +N  +D +  M 
Sbjct:   40 HTNKLDYIMTTVLKEAGKHKHVWPFQKPVDAVALCIPLYHERVARPMDLKTIENRLKSTYYTCAQECIDDIETVFQNCYTFNGKEDDVTIMA 131          

HSP 3 Score: 58.5362 bits (140), Expect = 7.339e-9
Identity = 29/74 (39.19%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  253 EAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGI 474
            E A PF +PVD     L DY ++IK P+DL ++K ++    Y+       D  LML NC++YN   DP+ S G+
Sbjct:  280 EFAWPFNEPVDAEQLGLHDYHKIIKEPMDLKSMKAKMESGAYKEPSDFEHDVRLMLRNCFLYNPVGDPVHSFGL 353          

HSP 4 Score: 50.0618 bits (118), Expect = 2.881e-6
Identity = 24/82 (29.27%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  703 YILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            YI+   L  +      + F +PVD  +L +  YHE +  P+DL TI+  +    Y      ++DI  +  NC  +NG++ D+
Sbjct:   46 YIMTTVLKEAGKHKHVWPFQKPVDAVALCIPLYHERVARPMDLKTIENRLKSTYYTCAQECIDDIETVFQNCYTFNGKEDDV 127          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Match: bet-1 (Bromodomain-containing protein bet-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95Y80])

HSP 1 Score: 74.3294 bits (181), Expect = 6.191e-14
Identity = 35/104 (33.65%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  L+N+  + KY+   + F EPVD + LGL DYH++IK P+DL +++  M+   Y       +D+ LM+ NC +YN     +G+    F L F+ ++   + E
Sbjct:  266 CLKLLNDFSTKKYQEFAWPFNEPVDAEQLGLHDYHKIIKEPMDLKSMKAKMESGAYKEPSDFEHDVRLMLRNCFLYN----PVGDPVHSFGLRFQEVFDRRWAE 365          

HSP 2 Score: 67.781 bits (164), Expect = 7.444e-12
Identity = 36/113 (31.86%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
             TNKLD ++  ++    +++   PF KPVD VA  +P Y + +  P+DL TI+ RL   +Y    +C+ D   + +NCY +N  +D +  M   +   +K  L   P +E  M
Sbjct:   40 HTNKLDYIMTTVLKEAGKHKHVWPFQKPVDAVALCIPLYHERVARPMDLKTIENRLKSTYYTCAQECIDDIETVFQNCYTFNGKEDDVTIMAQNVHEVIKKSLEQAPREEHDM 152          

HSP 3 Score: 58.5362 bits (140), Expect = 6.523e-9
Identity = 29/74 (39.19%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  253 EAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGI 474
            E A PF +PVD     L DY ++IK P+DL ++K ++    Y+       D  LML NC++YN   DP+ S G+
Sbjct:  280 EFAWPFNEPVDAEQLGLHDYHKIIKEPMDLKSMKAKMESGAYKEPSDFEHDVRLMLRNCFLYNPVGDPVHSFGL 353          

HSP 4 Score: 50.8322 bits (120), Expect = 1.907e-6
Identity = 24/82 (29.27%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  703 YILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            YI+   L  +      + F +PVD  +L +  YHE +  P+DL TI+  +    Y      ++DI  +  NC  +NG++ D+
Sbjct:   46 YIMTTVLKEAGKHKHVWPFQKPVDAVALCIPLYHERVARPMDLKTIENRLKSTYYTCAQECIDDIETVFQNCYTFNGKEDDV 127          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.364e-9
Identity = 33/106 (31.13%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  178 RCPQKPFTNKLDIMLKKIIPFVM-------RYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGI 474
            R P  P T       + +I F++       + E A PF  PVD     +PDY ++IK P+DL T+ ++L    Y+  G+   D  LML+N ++YN  +  +   G+
Sbjct:  841 REPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGL 946          

HSP 2 Score: 55.0694 bits (131), Expect = 9.828e-8
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  757 FLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            F  PVD K L + DYHE+IK P+DL T+ K +    Y +     +DI+LM++N  +YN + + +
Sbjct:  878 FRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKV 941          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.373e-9
Identity = 33/106 (31.13%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  178 RCPQKPFTNKLDIMLKKIIPFVM-------RYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGI 474
            R P  P T       + +I F++       + E A PF  PVD     +PDY ++IK P+DL T+ ++L    Y+  G+   D  LML+N ++YN  +  +   G+
Sbjct:  841 REPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGL 946          

HSP 2 Score: 55.0694 bits (131), Expect = 9.896e-8
Identity = 25/64 (39.06%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  757 FLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            F  PVD K L + DYHE+IK P+DL T+ K +    Y +     +DI+LM++N  +YN + + +
Sbjct:  878 FRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKV 941          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0071119)

HSP 1 Score: 91.2781 bits (225), Expect = 4.151e-19
Identity = 41/118 (34.75%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHK 552
            TN+L  ++K ++  + ++  + PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y +  + +QDFN M  NCY+YN P + ++ M   L+     K+  MP +E +++ +  K
Sbjct:   36 TNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAK 153          

HSP 2 Score: 78.9518 bits (193), Expect = 3.708e-15
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL S K+    + F +PVD + LGL DYH++IK P+DL T+++ MD R Y S      D+ L+  NC  YN    D+  + R+ Q  FE  Y +I  E
Sbjct:  484 CNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 587          

HSP 3 Score: 65.0846 bits (157), Expect = 9.172e-11
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DL T+K ++  + Y++  +   D  L+  NCY YN PD  +++MG
Sbjct:  500 AWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMG 570          

HSP 4 Score: 63.1586 bits (152), Expect = 3.461e-10
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  709 LINELMSSKYKST-NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            LI  +M   +K   ++ F +PVD K L L DYH++IK P+D+ TI+K ++   Y S    + D   M NNC +YN    D+  + +  +  F     S+ KE+
Sbjct:   42 LIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEE 144          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0333307)

HSP 1 Score: 91.2781 bits (225), Expect = 4.192e-19
Identity = 41/118 (34.75%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHK 552
            TN+L  ++K ++  + ++  + PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y +  + +QDFN M  NCY+YN P + ++ M   L+     K+  MP +E +++ +  K
Sbjct:   36 TNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAK 153          

HSP 2 Score: 78.9518 bits (193), Expect = 3.777e-15
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL S K+    + F +PVD + LGL DYH++IK P+DL T+++ MD R Y S      D+ L+  NC  YN    D+  + R+ Q  FE  Y +I  E
Sbjct:  484 CNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 587          

HSP 3 Score: 65.0846 bits (157), Expect = 9.257e-11
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DL T+K ++  + Y++  +   D  L+  NCY YN PD  +++MG
Sbjct:  500 AWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMG 570          

HSP 4 Score: 63.1586 bits (152), Expect = 3.493e-10
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  709 LINELMSSKYKST-NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            LI  +M   +K   ++ F +PVD K L L DYH++IK P+D+ TI+K ++   Y S    + D   M NNC +YN    D+  + +  +  F     S+ KE+
Sbjct:   42 LIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEE 144          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0333308)

HSP 1 Score: 85.5001 bits (210), Expect = 2.589e-17
Identity = 45/131 (34.35%), Postives = 75/131 (57.25%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMK--NLKHKIVPLRSVKTPK 585
            TN+L  ++K ++  + ++  + PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y +  + +QDFN M  NCY+YN P + ++ M   L+     K+  MP +E +++    K      R+  TPK
Sbjct:   36 TNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPK 166          

HSP 2 Score: 81.2629 bits (199), Expect = 7.008e-16
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL S K+    + F +PVD + LGL DYH++IK P+DL T+++ MD R Y S      D+ L+  NC  YN    D+  + R+ Q  FE  Y +I  E
Sbjct:  479 CNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 582          

HSP 3 Score: 63.1586 bits (152), Expect = 3.277e-10
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            ++ F +PVD K L L DYH++IK P+D+ TI+K ++   Y S    + D   M NNC +YN    D+  + +  +  F     S+ KE+
Sbjct:   56 SWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEE 144          

HSP 4 Score: 63.1586 bits (152), Expect = 3.733e-10
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DL T+K ++  + Y++  +   D  L+  NCY YN PD  +++MG
Sbjct:  495 AWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMG 565          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0071122)

HSP 1 Score: 85.5001 bits (210), Expect = 2.593e-17
Identity = 45/131 (34.35%), Postives = 75/131 (57.25%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMK--NLKHKIVPLRSVKTPK 585
            TN+L  ++K ++  + ++  + PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y +  + +QDFN M  NCY+YN P + ++ M   L+     K+  MP +E +++    K      R+  TPK
Sbjct:   36 TNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPK 166          

HSP 2 Score: 80.8777 bits (198), Expect = 7.600e-16
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL S K+    + F +PVD + LGL DYH++IK P+DL T+++ MD R Y S      D+ L+  NC  YN    D+  + R+ Q  FE  Y +I  E
Sbjct:  484 CNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 587          

HSP 3 Score: 63.1586 bits (152), Expect = 3.367e-10
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            ++ F +PVD K L L DYH++IK P+D+ TI+K ++   Y S    + D   M NNC +YN    D+  + +  +  F     S+ KE+
Sbjct:   56 SWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEE 144          

HSP 4 Score: 63.1586 bits (152), Expect = 3.738e-10
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DL T+K ++  + Y++  +   D  L+  NCY YN PD  +++MG
Sbjct:  500 AWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMG 570          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0071120)

HSP 1 Score: 85.5001 bits (210), Expect = 2.593e-17
Identity = 45/131 (34.35%), Postives = 75/131 (57.25%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMK--NLKHKIVPLRSVKTPK 585
            TN+L  ++K ++  + ++  + PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y +  + +QDFN M  NCY+YN P + ++ M   L+     K+  MP +E +++    K      R+  TPK
Sbjct:   36 TNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEELELEPVTAKGGKKKQRAPATPK 166          

HSP 2 Score: 80.8777 bits (198), Expect = 7.600e-16
Identity = 40/104 (38.46%), Postives = 58/104 (55.77%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL S K+    + F +PVD + LGL DYH++IK P+DL T+++ MD R Y S      D+ L+  NC  YN    D+  + R+ Q  FE  Y +I  E
Sbjct:  484 CNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANIPDE 587          

HSP 3 Score: 63.1586 bits (152), Expect = 3.367e-10
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            ++ F +PVD K L L DYH++IK P+D+ TI+K ++   Y S    + D   M NNC +YN    D+  + +  +  F     S+ KE+
Sbjct:   56 SWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESMPKEE 144          

HSP 4 Score: 63.1586 bits (152), Expect = 3.738e-10
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DL T+K ++  + Y++  +   D  L+  NCY YN PD  +++MG
Sbjct:  500 AWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMG 570          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Match: brd2b (bromodomain containing 2b [Source:ZFIN;Acc:ZDB-GENE-070220-1])

HSP 1 Score: 97.4413 bits (241), Expect = 1.857e-22
Identity = 58/165 (35.15%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEY 693
            TN+L  + K ++  + R+  A PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y    +CLQDFN M  NCYIYN P D I+ M   L+     K+  MP DE ++ +   +    +SVK   +K +  +  +  Q P   +S++  S +     DS++
Sbjct:   72 TNQLQFLHKVLVKALWRHHFAWPFHEPVDATRLNLPDYHKIIKQPMDMGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDIVLMAQSLEKVFLQKVAQMPQDEIELPSPTPRGRGNKSVKA--RKSRGGSVTSAHQVPA--VSQSAYSPSSPETPDSQF 232          

HSP 2 Score: 58.151 bits (139), Expect = 5.024e-9
Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F EPVD   L L DYH++IK P+D+ TI+K ++   Y      + D   M  NC IYN    DI
Sbjct:   93 WPFHEPVDATRLNLPDYHKIIKQPMDMGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDI 158          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Match: brd2b (bromodomain containing 2b [Source:ZFIN;Acc:ZDB-GENE-070220-1])

HSP 1 Score: 97.8265 bits (242), Expect = 3.423e-21
Identity = 58/165 (35.15%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEY 693
            TN+L  + K ++  + R+  A PF +PVD     LPDY ++IK P+D+ TIK+RL   +Y    +CLQDFN M  NCYIYN P D I+ M   L+     K+  MP DE ++ +   +    +SVK   +K +  +  +  Q P   +S++  S +     DS++
Sbjct:   72 TNQLQFLHKVLVKALWRHHFAWPFHEPVDATRLNLPDYHKIIKQPMDMGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDIVLMAQSLEKVFLQKVAQMPQDEIELPSPTPRGRGNKSVKA--RKSRGGSVTSAHQVPA--VSQSAYSPSSPETPDSQF 232          

HSP 2 Score: 89.3521 bits (220), Expect = 1.607e-18
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  616 VSQSPVKKISENIVSSNYIPLTDSEYGK-------CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKR 1068
            +S+ P+K   +++  S   P   S  GK       C  ++ EL+S K+ +  + F +PVD  +LGL DYH++IK+P+DLSTI++ MDER Y        D+ LM +NC  YN    D+ ++ R+ Q  FE  +  +  E     V+DE     M I R
Sbjct:  331 LSRRPIKPPRKDLPDS-VRPHQPSRRGKLSKQLRYCSGVLKELLSKKHVAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTIKRKMDEREYREAQQFSADVRLMFSNCYKYNPPDHDVVSMARKLQDVFEFRFAKMPDE-----VSDEEDLSPMPIGR 482          

HSP 3 Score: 66.2402 bits (160), Expect = 4.665e-11
Identity = 33/71 (46.48%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A  L DY  +IK P+DLSTIK ++  + Y    +   D  LM  NCY YN PD  ++SM 
Sbjct:  381 AWPFYKPVDASALGLHDYHDIIKHPMDLSTIKRKMDEREYREAQQFSADVRLMFSNCYKYNPPDHDVVSMA 451          

HSP 4 Score: 58.151 bits (139), Expect = 1.550e-8
Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F EPVD   L L DYH++IK P+D+ TI+K ++   Y      + D   M  NC IYN    DI
Sbjct:   93 WPFHEPVDATRLNLPDYHKIIKQPMDMGTIKKRLENNYYRGASECLQDFNTMFTNCYIYNKPADDI 158          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Match: brd3b (bromodomain containing 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5316])

HSP 1 Score: 96.6709 bits (239), Expect = 5.802e-21
Identity = 48/112 (42.86%), Postives = 70/112 (62.50%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            TN+L  M   ++  + +++ A PF  PVD +   LPDY +VIK+P+D+ TIK+RL   +Y T G+C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   32 TNQLQYMQNVVVKTLWKHQFAWPFYTPVDAIKLNLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 143          

HSP 2 Score: 81.2629 bits (199), Expect = 6.259e-16
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYHE+IK P+DLST++K MD R Y        D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  298 CDTILKEMLSKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDSREYPDAQNFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 392          

HSP 3 Score: 67.0106 bits (162), Expect = 2.340e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  211 DIMLKKIIPFVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            D +LK+++    ++ A A PF KPVD  A +L DY ++IK P+DLST+K+++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  299 DTILKEML--SKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDSREYPDAQNFAADVRLMFSNCYKYNPPDHEVVAMA 384          

HSP 4 Score: 54.299 bits (129), Expect = 2.177e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD   L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   53 WPFYTPVDAIKLNLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Match: brd3b (bromodomain containing 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5316])

HSP 1 Score: 96.6709 bits (239), Expect = 7.140e-21
Identity = 48/112 (42.86%), Postives = 70/112 (62.50%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            TN+L  M   ++  + +++ A PF  PVD +   LPDY +VIK+P+D+ TIK+RL   +Y T G+C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   32 TNQLQYMQNVVVKTLWKHQFAWPFYTPVDAIKLNLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 143          

HSP 2 Score: 81.2629 bits (199), Expect = 6.693e-16
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYHE+IK P+DLST++K MD R Y        D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  298 CDTILKEMLSKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDSREYPDAQNFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 392          

HSP 3 Score: 66.6254 bits (161), Expect = 2.699e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  211 DIMLKKIIPFVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            D +LK+++    ++ A A PF KPVD  A +L DY ++IK P+DLST+K+++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  299 DTILKEML--SKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDSREYPDAQNFAADVRLMFSNCYKYNPPDHEVVAMA 384          

HSP 4 Score: 53.9138 bits (128), Expect = 2.593e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD   L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   53 WPFYTPVDAIKLNLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Match: brd4 (bromodomain containing 4 [Source:NCBI gene;Acc:570531])

HSP 1 Score: 96.2857 bits (238), Expect = 1.531e-20
Identity = 50/119 (42.02%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P +P   TN+L  +LK ++  + +++ A PF  PVD V   LPDY ++IK+P+D+ TIK+RL   FY +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP  E ++
Sbjct:  115 PTRPKRQTNQLQYLLKVVLKSLWKHQFAWPFHAPVDAVKLNLPDYYKIIKNPMDMGTIKKRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKVFLTKISEMPQQEVEI 233          

HSP 2 Score: 72.7886 bits (177), Expect = 3.931e-13
Identity = 35/104 (33.65%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  673 PLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            P    +   C  ++ ++ + K+ +  + F +PVDV +LGL DYH++IK+P+DLSTI+  ++ R Y        D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  435 PKQQEQLRYCSGIVKDMFAKKHAAYAWPFYKPVDVDTLGLHDYHDIIKHPMDLSTIKDKLETRQYREAQEFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 538          

HSP 3 Score: 64.3142 bits (155), Expect = 1.908e-10
Identity = 32/71 (45.07%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DLSTIK++L  + Y    +   D  LM  NCY YN PD  +++M 
Sbjct:  460 AWPFYKPVDVDTLGLHDYHDIIKHPMDLSTIKDKLETRQYREAQEFAADVRLMFSNCYKYNPPDHEVVAMA 530          

HSP 4 Score: 53.9138 bits (128), Expect = 3.918e-7
Identity = 26/64 (40.62%), Postives = 35/64 (54.69%), Query Frame = 1
Query:  757 FLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            F  PVD   L L DY+++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:  145 FHAPVDAVKLNLPDYYKIIKNPMDMGTIKKRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDI 208          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000053251.1 (bromodomain, testis-specific [Source:NCBI gene;Acc:100144959])

HSP 1 Score: 92.4337 bits (228), Expect = 2.151e-19
Identity = 49/124 (39.52%), Postives = 74/124 (59.68%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLR 567
             TN+L  + K ++  + R+  + PF +PVD     LPDY Q+IK+P+DLSTI++RL   +Y     C+QDFN M  NCYIYN P D I+ M  +L+     K+  MP +E ++  + ++ V  R
Sbjct:   29 LTNQLQYLEKVVLKALWRHHFSWPFQQPVDAAKLNLPDYYQIIKNPMDLSTIRKRLEYNYYSKALDCIQDFNTMFTNCYIYNKPGDDIVVMSQELEKVFMEKIAEMPHEEIELSVVGNRGVKSR 152          

HSP 2 Score: 58.151 bits (139), Expect = 2.177e-8
Identity = 28/67 (41.79%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            ++ F +PVD   L L DY+++IK P+DLSTI+K ++   Y   L  + D   M  NC IYN    DI
Sbjct:   50 SWPFQQPVDAAKLNLPDYYQIIKNPMDLSTIRKRLEYNYYSKALDCIQDFNTMFTNCYIYNKPGDDI 116          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Match: brd2 (bromodomain containing 2 [Source:NCBI gene;Acc:100038037])

HSP 1 Score: 92.4337 bits (228), Expect = 2.400e-19
Identity = 50/127 (39.37%), Postives = 77/127 (60.63%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKT 579
            TN+L  + K ++  + +++ + PF +PVD V   LPDY ++IK P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++ N   KI  ++  KT
Sbjct:   76 TNQLQYLHKVVMKSLWKHQFSWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKKRLENNYYWSALECMQDFNTMFTNCYIYNKPTDDIVLMAQSLEKMFLQKVAQMPQEEQEIPNTASKIKNVKISKT 202          

HSP 2 Score: 81.6481 bits (200), Expect = 6.853e-16
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL+S K+ +  + F +PVDV +LGL DY+++IK+P+DLSTI+K MD R +         + LM +NC  YN    D+  + R+ Q  FE  Y  +  E
Sbjct:  347 CNGILKELLSKKHAAYAWPFYKPVDVSALGLHDYYDIIKHPMDLSTIKKKMDNREFKDAQEFAAAVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDE 450          

HSP 3 Score: 63.5438 bits (153), Expect = 3.615e-10
Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  721 LMSSKYKST-NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            +M S +K   ++ F +PVD   LGL DYH++IK P+D+ TI+K ++   Y S L  + D   M  NC IYN    DI
Sbjct:   86 VMKSLWKHQFSWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKKRLENNYYWSALECMQDFNTMFTNCYIYNKPTDDI 162          

HSP 4 Score: 60.077 bits (144), Expect = 5.699e-9
Identity = 30/71 (42.25%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A  L DY  +IK P+DLSTIK+++  + ++   +      LM  NCY YN PD  +++M 
Sbjct:  363 AWPFYKPVDVSALGLHDYYDIIKHPMDLSTIKKKMDNREFKDAQEFAAAVRLMFSNCYKYNPPDHDVVAMA 433          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000053245.1 (bromodomain, testis-specific [Source:NCBI gene;Acc:100144959])

HSP 1 Score: 92.4337 bits (228), Expect = 3.057e-19
Identity = 51/128 (39.84%), Postives = 75/128 (58.59%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKT 579
             TN+L  + K ++  + R+  + PF +PVD     LPDY Q+IK+P+DLSTI++RL   +Y     C+QDFN M  NCYIYN P D I+ M  +L+     K+  MP +E ++      +V  R VK+
Sbjct:   29 LTNQLQYLEKVVLKALWRHHFSWPFQQPVDAAKLNLPDYYQIIKNPMDLSTIRKRLEYNYYSKALDCIQDFNTMFTNCYIYNKPGDDIVVMSQELEKVFMEKIAEMPHEEIEL-----SVVGNRGVKS 151          

HSP 2 Score: 58.151 bits (139), Expect = 2.408e-8
Identity = 28/67 (41.79%), Postives = 39/67 (58.21%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            ++ F +PVD   L L DY+++IK P+DLSTI+K ++   Y   L  + D   M  NC IYN    DI
Sbjct:   50 SWPFQQPVDAAKLNLPDYYQIIKNPMDLSTIRKRLEYNYYSKALDCIQDFNTMFTNCYIYNKPGDDI 116          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Match: brd2 (bromodomain containing 2 [Source:NCBI gene;Acc:100038037])

HSP 1 Score: 91.6633 bits (226), Expect = 4.068e-19
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKI 555
            TN+L  + K ++  + +++ + PF +PVD V   LPDY ++IK P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++ N   KI
Sbjct:   76 TNQLQYLHKVVMKSLWKHQFSWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKKRLENNYYWSALECMQDFNTMFTNCYIYNKPTDDIVLMAQSLEKMFLQKVAQMPQEEQEIPNTASKI 194          

HSP 2 Score: 81.6481 bits (200), Expect = 6.749e-16
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            C  ++ EL+S K+ +  + F +PVDV +LGL DY+++IK+P+DLSTI+K MD R +         + LM +NC  YN    D+  + R+ Q  FE  Y  +  E
Sbjct:  347 CNGILKELLSKKHAAYAWPFYKPVDVSALGLHDYYDIIKHPMDLSTIKKKMDNREFKDAQEFAAAVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDE 450          

HSP 3 Score: 63.5438 bits (153), Expect = 4.090e-10
Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  721 LMSSKYKST-NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            +M S +K   ++ F +PVD   LGL DYH++IK P+D+ TI+K ++   Y S L  + D   M  NC IYN    DI
Sbjct:   86 VMKSLWKHQFSWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKKRLENNYYWSALECMQDFNTMFTNCYIYNKPTDDI 162          

HSP 4 Score: 59.3066 bits (142), Expect = 9.769e-9
Identity = 30/71 (42.25%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A  L DY  +IK P+DLSTIK+++  + ++   +      LM  NCY YN PD  +++M 
Sbjct:  363 AWPFYKPVDVSALGLHDYYDIIKHPMDLSTIKKKMDNREFKDAQEFAAAVRLMFSNCYKYNPPDHDVVAMA 433          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Match: kif3b (kinesin family member 3B [Source:Xenbase;Acc:XB-GENE-979232])

HSP 1 Score: 87.8113 bits (216), Expect = 9.501e-18
Identity = 42/91 (46.15%), Postives = 60/91 (65.93%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            TN+L  +LK ++  + +++ A PF  PVD V   LPDY ++IK+P+D+ TIK+RL   +Y    +C+QDFN M  NCYIYN P D I+ M 
Sbjct:   62 TNQLQYLLKTVLKTLWKHQFAWPFQLPVDVVKLNLPDYHKIIKNPMDMGTIKKRLENHYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMA 152          

HSP 2 Score: 77.411 bits (189), Expect = 2.129e-14
Identity = 38/98 (38.78%), Postives = 57/98 (58.16%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            C  +I E+ S K+++  + F +PVDV +LGL DY E+IK+P+DL TI+  MD   Y       +D+ LM +NC  YN    ++  + R+ Q  FE  Y
Sbjct:  351 CAGIIREMFSKKHQAYAWPFYKPVDVDALGLHDYREIIKHPMDLGTIKVKMDNWDYKDAKEFASDVRLMFSNCYKYNPPDHEVVIMARKLQDVFEMRY 448          

HSP 3 Score: 56.9954 bits (136), Expect = 4.954e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  238 FVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            F  +++A A PF KPVD  A  L DY ++IK P+DL TIK ++    Y+   +   D  LM  NCY YN PD  ++ M 
Sbjct:  359 FSKKHQAYAWPFYKPVDVDALGLHDYREIIKHPMDLGTIKVKMDNWDYKDAKEFASDVRLMFSNCYKYNPPDHEVVIMA 437          

HSP 4 Score: 55.0694 bits (131), Expect = 2.271e-7
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVDV  L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   83 WPFQLPVDVVKLNLPDYHKIIKNPMDMGTIKKRLENHYYWNAQECIQDFNTMFTNCYIYNKPGDDI 148          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Match: Brd3 (bromodomain containing 3 [Source:MGI Symbol;Acc:MGI:1914632])

HSP 1 Score: 94.3597 bits (233), Expect = 4.262e-20
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + +++ A PF +PVD +   LPDY ++IK+P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   28 PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 146          

HSP 2 Score: 80.8777 bits (198), Expect = 9.285e-16
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYH++IK+P+DLST+++ MD R Y        DI LM +NC  YN    ++  + R+ Q  FE
Sbjct:  314 CDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFE 408          

HSP 3 Score: 65.855 bits (159), Expect = 5.810e-11
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A +L DY  +IK P+DLST+K ++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  330 AWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMA 400          

HSP 4 Score: 56.225 bits (134), Expect = 6.338e-8
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F +PVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   56 WPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI 121          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Match: Brd3 (bromodomain containing 3 [Source:MGI Symbol;Acc:MGI:1914632])

HSP 1 Score: 94.3597 bits (233), Expect = 4.262e-20
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + +++ A PF +PVD +   LPDY ++IK+P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   28 PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 146          

HSP 2 Score: 80.8777 bits (198), Expect = 9.285e-16
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYH++IK+P+DLST+++ MD R Y        DI LM +NC  YN    ++  + R+ Q  FE
Sbjct:  314 CDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFE 408          

HSP 3 Score: 65.855 bits (159), Expect = 5.810e-11
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A +L DY  +IK P+DLST+K ++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  330 AWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMA 400          

HSP 4 Score: 56.225 bits (134), Expect = 6.338e-8
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F +PVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   56 WPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI 121          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Match: Brd3 (bromodomain containing 3 [Source:MGI Symbol;Acc:MGI:1914632])

HSP 1 Score: 94.3597 bits (233), Expect = 5.040e-20
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + +++ A PF +PVD +   LPDY ++IK+P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   28 PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 146          

HSP 2 Score: 80.8777 bits (198), Expect = 9.414e-16
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYH++IK+P+DLST+++ MD R Y        DI LM +NC  YN    ++  + R+ Q  FE
Sbjct:  314 CDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFE 408          

HSP 3 Score: 65.855 bits (159), Expect = 6.344e-11
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A +L DY  +IK P+DLST+K ++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  330 AWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMA 400          

HSP 4 Score: 56.225 bits (134), Expect = 6.284e-8
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F +PVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   56 WPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI 121          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Match: Brd3 (bromodomain containing 3 [Source:MGI Symbol;Acc:MGI:1914632])

HSP 1 Score: 93.9745 bits (232), Expect = 6.257e-20
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + +++ A PF +PVD +   LPDY ++IK+P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   28 PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 146          

HSP 2 Score: 81.2629 bits (199), Expect = 7.835e-16
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYH++IK+P+DLST+++ MD R Y        DI LM +NC  YN    ++  + R+ Q  FE
Sbjct:  314 CDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFE 408          

HSP 3 Score: 65.855 bits (159), Expect = 6.272e-11
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A +L DY  +IK P+DLST+K ++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  330 AWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMA 400          

HSP 4 Score: 56.225 bits (134), Expect = 6.282e-8
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F +PVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   56 WPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI 121          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Match: Brd3 (bromodomain containing 3 [Source:MGI Symbol;Acc:MGI:1914632])

HSP 1 Score: 93.9745 bits (232), Expect = 6.257e-20
Identity = 48/119 (40.34%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + +++ A PF +PVD +   LPDY ++IK+P+D+ TIK+RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   28 PSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 146          

HSP 2 Score: 81.2629 bits (199), Expect = 7.835e-16
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYH++IK+P+DLST+++ MD R Y        DI LM +NC  YN    ++  + R+ Q  FE
Sbjct:  314 CDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMARKLQDVFE 408          

HSP 3 Score: 65.855 bits (159), Expect = 6.272e-11
Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD  A +L DY  +IK P+DLST+K ++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  330 AWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDSREYPDAQGFAADIRLMFSNCYKYNPPDHEVVAMA 400          

HSP 4 Score: 56.225 bits (134), Expect = 6.282e-8
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F +PVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   56 WPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDI 121          
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y7N0|BDF1_SCHPO (SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bdf1 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 9.468e-26
Identity = 84/269 (31.23%), Postives = 134/269 (49.81%), Query Frame = 1
Query:  229 IIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE----FKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPL---TDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            I+  + R + + PF  PVD +   +PDYP ++K+P+DL TI+++L    Y    + + D NLM  NC++YN  + P+ SMG  L+   + +L  +P  E      +K  K K       +T +         +V+ S   K +   V     P     +S+   C  ++ EL   +Y+S  + F +PVD  +    DY ++IK P+DLSTIQ  +++  Y +     +DI LM NNC  YN   T +  + R  QLE      ++FKEK
Sbjct:   96 IVRQLKRTKNSAPFKVPVDPIKQNIPDYPTIVKNPMDLGTIEKKLTSYEYSVPQEFIDDMNLMFSNCFLYNGTESPVGSMGKALQEVFERQLKQLPDAEQPAAAPVKKSKQKSASTAPPRTRRNSSVSSTSASVAASTAPKAASPAVLPEGKPRRRKNNSQMRFCSTVLKELYKRQYESFAFPFYQPVDPVACDCPDYFDVIKEPMDLSTIQSKLNKNEYSTLEEFESDILLMFNNCFTYNPPGTPVHVMGR--QLE------NVFKEK 356          
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9HGP4|YK82_SCHPO (Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC631.02 PE=1 SV=3)

HSP 1 Score: 112.464 bits (280), Expect = 3.997e-25
Identity = 72/271 (26.57%), Postives = 131/271 (48.34%), Query Frame = 1
Query:  193 PFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMP---IDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGK-CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            P T +    +  ++  + R   + PF  PVD V   +PDYP +IK+PIDL T++++     Y +    + D NLM  NC++YN  + P+  MG  L+   + +L  +P   +  +     +      RS+  PK   + +    +  +    I E +         D+   K C  ++ EL+  ++++  Y F +PV+  + G  DY ++IK+P+DL T+Q  ++   Y S  A   D+ LM  NC  +N   T +  + ++ +  F+ L+
Sbjct:  229 PMTKEQHKYIHAMLRQLRRGRDSIPFRAPVDPVKQNIPDYPTIIKNPIDLGTMQKKFSSGVYSSAQHFIDDMNLMFSNCFLYNGTESPVGVMGKNLQATFERQLKQLPSAYVTSYSRPGRR-----PRSMTAPKGGARTRRQAAMYSNSSSGIRETMYDLKPHRRKDAAEMKFCQSVLKELLKKQHEAYAYPFYKPVNPTACGCPDYFKVIKHPMDLGTMQNKLNHNEYASMKAFEADMVLMFKNCYKFNSAGTPVHLMGKKLESIFQKLW 494          
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5A4W8|BDF1_CANAL (Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BDF1 PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 2.695e-22
Identity = 83/289 (28.72%), Postives = 128/289 (44.29%), Query Frame = 1
Query:  184 PQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQS-----------PVKKISENIVSSNYIPLTDSEYGK--------CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            P+ P        +   I  V R   A PFL PVD V   +P Y   I  P+DLSTI+ ++  K YE + + + DFNLM++NC  +N     I  M   ++   +  +V +P  E         +    SV T     K K+    S S           P + I  +   S  +P       K        C   I ELMS K+ + N+ FL PVD  +L + +Y+E++K P+DL TIQ  +    Y++      D+ L+  NC ++N   TD+  +  R +  F+  +
Sbjct:  206 PENPIPQHQAKFVLNTIKAVKRNREAVPFLHPVDTVKLNVPFYYNYIPRPMDLSTIERKINLKAYEDVSQVVDDFNLMVKNCKKFNGEAAGISKMATNIQAQFEKLMVKVPPKELPAGT---NVAEATSVATSPTTNKRKSVAESSSSHQHRDSVAAARPKRTI--HPPKSKELPYETKPKNKKVAAELRFCNQTIKELMSKKHYNYNFPFLAPVDTVALNIPNYNEIVKQPMDLGTIQSKLANNEYENADDFEKDVRLVFKNCYLFNPEGTDVNMMGHRLEAVFDKKW 489          

HSP 2 Score: 64.6994 bits (156), Expect = 8.492e-10
Identity = 46/178 (25.84%), Postives = 79/178 (44.38%), Query Frame = 1
Query:  607 FLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK--CRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISVARSR 1134
            F   +  P ++   N +  N IP   +++     ++N + + K       FL PVD   L +  Y+  I  P+DLSTI++ ++ + Y+    VV+D  LM+ NC  +NG    I  +    Q +FE L   +  ++     NV +           K K + E    +  + SVA +R
Sbjct:  189 FTEPAPKPPQEPDMNNLPENPIPQHQAKF-----VLNTIKAVKRNREAVPFLHPVDTVKLNVPFYYNYIPRPMDLSTIERKINLKAYEDVSQVVDDFNLMVKNCKKFNGEAAGISKMATNIQAQFEKLMVKVPPKELPAGTNVAEATSVATSPTTNKRKSVAESSSSHQHRDSVAAAR 361          
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P35817|BDF1_YEAST (Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDF1 PE=1 SV=3)

HSP 1 Score: 100.523 bits (249), Expect = 2.943e-21
Identity = 81/289 (28.03%), Postives = 126/289 (43.60%), Query Frame = 1
Query:  184 PQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFK-------------------MKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            PQ P            I  V R + A+PFL+PVD V   +P Y   IK P+DLSTI+ +L    YE   +  +DFNLM+ N   +N P+  I  M   ++   +  ++ MP  +                      +   H   P R++  PK K     +   S+ P  K  +  +              C  ++ ELM+ K+ S NY FLEPVD  S+ L  Y + +K P+DL TI K +++  Y +      D+ L+  NC  +N   T +  +  R +  F + +
Sbjct:  145 PQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMARNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSK---DIYPYESKKPKSKRLQQAMKF------------CQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKEPMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKW 418          
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Match: sp|F1R5H6|BRD4_DANRE (Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.247e-19
Identity = 50/119 (42.02%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P +P   TN+L  +LK ++  + +++ A PF  PVD V   LPDY ++IK+P+D+ TIK+RL   FY +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP  E ++
Sbjct:   38 PTRPKRQTNQLQYLLKVVLKSLWKHQFAWPFHAPVDAVKLNLPDYYKIIKNPMDMGTIKKRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKVFLTKISEMPQQEVEI 156          

HSP 2 Score: 72.7886 bits (177), Expect = 3.094e-12
Identity = 35/104 (33.65%), Postives = 59/104 (56.73%), Query Frame = 1
Query:  673 PLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            P    +   C  ++ ++ + K+ +  + F +PVDV +LGL DYH++IK+P+DLSTI+  ++ R Y        D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  358 PKQQEQLRYCSGIVKDMFAKKHAAYAWPFYKPVDVDTLGLHDYHDIIKHPMDLSTIKDKLETRQYREAQEFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 461          

HSP 3 Score: 64.3142 bits (155), Expect = 1.516e-9
Identity = 32/71 (45.07%), Postives = 41/71 (57.75%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD     L DY  +IK P+DLSTIK++L  + Y    +   D  LM  NCY YN PD  +++M 
Sbjct:  383 AWPFYKPVDVDTLGLHDYHDIIKHPMDLSTIKDKLETRQYREAQEFAADVRLMFSNCYKYNPPDHEVVAMA 453          

HSP 4 Score: 53.9138 bits (128), Expect = 3.091e-6
Identity = 26/64 (40.62%), Postives = 35/64 (54.69%), Query Frame = 1
Query:  757 FLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            F  PVD   L L DY+++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   68 FHAPVDAVKLNLPDYYKIIKNPMDMGTIKKRLESAFYTSAQECIQDFNTMFTNCYIYNKPGDDI 131          
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Match: A0A5K3EI34 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.365e-44
Identity = 110/331 (33.23%), Postives = 166/331 (50.15%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM-------------------KNLKHKIV---------------------------PLRSV---KTPKQKLKIKNFLNVSQSPVK-------------KISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIF 1005
            TN+LD + + +I  + + + A PFLKPVDH    LPDYP+++K P+DL TIK+RL  KFY    +CL D   M  NCYI+N P D +++M +KL+   + KL  MP  E ++                    NL   IV                           PL S    K PK+K +  +  ++S +P               K+ E +V    + L +S   +C  L+ ++ S++Y+  N LFL PVDV+ LGLSDYH++I +P+DLST++  +D  +Y ++     D+ LM NNC  YNG  +D+ ++ R  Q  FE  +  I 
Sbjct:   15 TNQLDFIKRHVISVIAKDKLAWPFLKPVDHQKLNLPDYPKIVKHPMDLGTIKQRLNLKFYRRASECLDDLFTMFRNCYIFNKPGDDVVAMAMKLERVARDKLQNMPFPEVELSSQKPNTSQVPPTSNISSDSNLSMSIVNNVEDLNGSSLVPPSTPSGVALSSHPGPLTSTLNKKLPKRKPEPPSLDDISSTPHSTDDSRERRLAKKTKVEERVVGKR-VRLCES-LKQCSNLLKDISSARYRHLNQLFLHPVDVEGLGLSDYHDIITHPMDLSTVRSKLDSGIYQNKNEFAADLRLMFNNCYKYNGETSDVASVGRTLQGIFEEQFAKIL 343          
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Match: A0A0S7GB80 (BRD3 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=BRD3 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.774e-44
Identity = 99/276 (35.87%), Postives = 149/276 (53.99%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNY----IPLTDSEYGK-------CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            TN+L  M K ++  + R++ A PF +PVD V+  LPDY ++I SP+DL TIK+RL   +Y +  +CLQDFN M  NCYIYN P D I+ M + L+     K+  MP  E ++ +   K    RS+  P +K      +  + +P K        SNY    +P  ++E+G        C  ++ E++S K+ +  + F  PVD K+LG+ DYH +IK P+DLST++K MD   Y        DI L+ +NC  YN     +  + R+ Q  FE  +
Sbjct:   30 TNQLQYMEKVVVKALWRHQFAWPFYQPVDAVSLGLPDYHKIITSPMDLGTIKKRLENNYYWSSSECLQDFNTMFTNCYIYNKPTDDIVLMALALEKIFLQKVSQMPQKEEEIVSHTGKGRGKRSI--PSEKRMRPESVRRATTPTK--------SNYEARDVPNPNTEHGGLREQLKYCSNILKEMLSKKHSAYAWPFYMPVDAKALGIHDYHNIIKCPMDLSTVKKKMDGGEYQDAQQFAADIRLIFSNCYKYNPSHHTVVGMARKLQGVFEQRF 295          
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Match: A0A5K3EJH4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.638e-44
Identity = 110/331 (33.23%), Postives = 166/331 (50.15%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM-------------------KNLKHKIV---------------------------PLRSV---KTPKQKLKIKNFLNVSQSPVK-------------KISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIF 1005
            TN+LD + + +I  + + + A PFLKPVDH    LPDYP+++K P+DL TIK+RL  KFY    +CL D   M  NCYI+N P D +++M +KL+   + KL  MP  E ++                    NL   IV                           PL S    K PK+K +  +  ++S +P               K+ E +V    + L +S   +C  L+ ++ S++Y+  N LFL PVDV+ LGLSDYH++I +P+DLST++  +D  +Y ++     D+ LM NNC  YNG  +D+ ++ R  Q  FE  +  I 
Sbjct:   15 TNQLDFIKRHVISVIAKDKLAWPFLKPVDHQKLNLPDYPKIVKHPMDLGTIKQRLNLKFYRRASECLDDLFTMFRNCYIFNKPGDDVVAMAMKLERVARDKLQNMPFPEVELSSQKPNTSQVPPTSNISSDSNLSMSIVNNVEDLNGSSLVPPSTPSGVALSSHPGPLTSTLNKKLPKRKPEPPSLDDISSTPHSTDDSRERRLAKKTKVEERVV-GKRVRLCES-LKQCSNLLKDISSARYRHLNQLFLHPVDVEGLGLSDYHDIITHPMDLSTVRSKLDSGIYQNKNEFAADLRLMFNNCYKYNGETSDVASVGRTLQGIFEEQFAKIL 343          
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Match: A0A0R3UF12 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5644 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.838e-44
Identity = 110/331 (33.23%), Postives = 166/331 (50.15%), Query Frame = 1
Query:  199 TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM-------------------KNLKHKIV---------------------------PLRSV---KTPKQKLKIKNFLNVSQSPVK-------------KISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIF 1005
            TN+LD + + +I  + + + A PFLKPVDH    LPDYP+++K P+DL TIK+RL  KFY    +CL D   M  NCYI+N P D +++M +KL+   + KL  MP  E ++                    NL   IV                           PL S    K PK+K +  +  ++S +P               K+ E +V    + L +S   +C  L+ ++ S++Y+  N LFL PVDV+ LGLSDYH++I +P+DLST++  +D  +Y ++     D+ LM NNC  YNG  +D+ ++ R  Q  FE  +  I 
Sbjct:   15 TNQLDFIKRHVISVIAKDKLAWPFLKPVDHQKLNLPDYPKIVKHPMDLGTIKQRLNLKFYRRASECLDDLFTMFRNCYIFNKPGDDVVAMAMKLERVARDKLQNMPFPEVELSSQKPNTSQVPPTSNISSDSNLSMSIVNNVEDLNGSSLVPPSTPSGVALSSHPGPLTSTLNKKLPKRKPEPPSLDDISSTPHSTDDSRERRLAKKTKVEERVV-GKRVRLCES-LKQCSNLLKDISSARYRHLNQLFLHPVDVEGLGLSDYHDIITHPMDLSTVRSKLDSGIYQNKNEFAADLRLMFNNCYKYNGETSDVASVGRTLQGIFEEQFAKIL 343          
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Match: A0A315W4D6 (Uncharacterized protein OS=Gambusia affinis OX=33528 GN=CCH79_00000698 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 6.684e-44
Identity = 101/286 (35.31%), Postives = 161/286 (56.29%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGK-------CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEK 1014
            P KP   TN+L  M K ++  + R++ A PF +PVD V+  LPDY ++I SP+DL TIK+RL   +Y +  +CLQDFN M  NCYIYN P D I+ M + L+     K+  MP  E ++     K    +S+  P+++++ ++ ++ + +P K   E    +  +P  ++EYG        C  ++ E++S K+ +  + F  PVD K+LG+ DYH++IKYP+DLST++K MD   Y        DI L+ +NC  YN     +  + R+ Q  FE  +  +  E+
Sbjct:   23 PNKPGRRTNQLQYMEKVVVKALWRHQFAWPFYQPVDAVSLGLPDYHKIITSPMDLGTIKKRLKNNYYWSSSECLQDFNTMFTNCYIYNKPTDDIVLMALALEKIFLQKVSQMPQKEEEIVPHAGKGKGRKSI-PPEKRMRPED-MDQATTPTKSDFE----ARDVPNPNTEYGGLREQLKYCSNILKEMLSKKHSAYAWPFYMPVDAKALGIHDYHDIIKYPMDLSTVKKKMDGGQYQDAQQFAADIRLIFSNCYKYNPSHHTVVGMARKLQGVFEQRFAKMPDEQ 302          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Match: brd2a (bromodomain-containing protein 2-like [Source:NCBI gene;Acc:103023197])

HSP 1 Score: 100.138 bits (248), Expect = 5.657e-22
Identity = 53/135 (39.26%), Postives = 77/135 (57.04%), Query Frame = 1
Query:  160 LTMATSRCPQKP----------FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            L+ A +  P KP           TN+L  +LK +   + R++ A PF +PVD V   LPDY ++IK P+D+ TI++RL   +Y +  +CLQDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   52 LSQAPTSGPHKPPTQDPSREGRVTNQLQFLLKSVTKLLWRHQFAWPFHEPVDAVKLNLPDYHKIIKEPMDMGTIRKRLENNYYRSATECLQDFNTMFTNCYIYNKPTDDIVMMAQCLEKAFLQKVAQMPSEEVEL 186          

HSP 2 Score: 85.5001 bits (210), Expect = 3.034e-17
Identity = 43/95 (45.26%), Postives = 59/95 (62.11%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ EL+S K+ +  + F +PVD  SLG+ DYHE+IK P+DLSTI+K MD+R Y   L    DI LM +NC  YN    ++  + RR Q  FE
Sbjct:  377 CNEILKELLSKKHITYAWPFYKPVDALSLGILDYHEIIKNPMDLSTIKKKMDKREYTEALQFAADIRLMFSNCYKYNPPDHEVVAMARRLQDIFE 471          

HSP 3 Score: 65.0846 bits (157), Expect = 9.522e-11
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD ++  + DY ++IK+P+DLSTIK+++ ++ Y    +   D  LM  NCY YN PD  +++M 
Sbjct:  393 AWPFYKPVDALSLGILDYHEIIKNPMDLSTIKKKMDKREYTEALQFAADIRLMFSNCYKYNPPDHEVVAMA 463          

HSP 4 Score: 58.9214 bits (141), Expect = 7.178e-9
Identity = 28/66 (42.42%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F EPVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI
Sbjct:   96 WPFHEPVDAVKLNLPDYHKIIKEPMDMGTIRKRLENNYYRSATECLQDFNTMFTNCYIYNKPTDDI 161          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Match: BRD3 (bromodomain-containing protein 3-like [Source:NCBI gene;Acc:103046549])

HSP 1 Score: 98.5969 bits (244), Expect = 1.444e-21
Identity = 52/119 (43.70%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + R++ A PF  PVD +   LPDY +VIK+P+D+ TIK+RL   +Y T G+C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   25 PNKPGRKTNQLQYMQNVVVKTLWRHQFAWPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 143          

HSP 2 Score: 82.0333 bits (201), Expect = 2.825e-16
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYHE+IK P+DLST++K MD R Y    +   D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  299 CDTILKEMLSKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 393          

HSP 3 Score: 66.2402 bits (160), Expect = 3.075e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  211 DIMLKKIIPFVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            D +LK+++    ++ A A PF KPVD  A +L DY ++IK P+DLST+K+++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  300 DTILKEML--SKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMA 385          

HSP 4 Score: 54.299 bits (129), Expect = 1.769e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD   L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   53 WPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Match: BRD3 (bromodomain-containing protein 3-like [Source:NCBI gene;Acc:103046549])

HSP 1 Score: 98.5969 bits (244), Expect = 1.561e-21
Identity = 52/119 (43.70%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + R++ A PF  PVD +   LPDY +VIK+P+D+ TIK+RL   +Y T G+C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   25 PNKPGRKTNQLQYMQNVVVKTLWRHQFAWPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 143          

HSP 2 Score: 82.4185 bits (202), Expect = 2.754e-16
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYHE+IK P+DLST++K MD R Y    +   D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  299 CDTILKEMLSKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 393          

HSP 3 Score: 66.2402 bits (160), Expect = 3.039e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  211 DIMLKKIIPFVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            D +LK+++    ++ A A PF KPVD  A +L DY ++IK P+DLST+K+++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  300 DTILKEML--SKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMA 385          

HSP 4 Score: 54.299 bits (129), Expect = 2.054e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD   L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   53 WPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Match: BRD3 (bromodomain-containing protein 3-like [Source:NCBI gene;Acc:103046549])

HSP 1 Score: 98.5969 bits (244), Expect = 1.573e-21
Identity = 52/119 (43.70%), Postives = 73/119 (61.34%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  M   ++  + R++ A PF  PVD +   LPDY +VIK+P+D+ TIK+RL   +Y T G+C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   25 PNKPGRKTNQLQYMQNVVVKTLWRHQFAWPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL 143          

HSP 2 Score: 82.0333 bits (201), Expect = 3.215e-16
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ E++S K+ +  + F +PVD ++L L DYHE+IK P+DLST++K MD R Y    +   D+ LM +NC  YN    ++  + R+ Q  FE
Sbjct:  299 CDTILKEMLSKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFE 393          

HSP 3 Score: 66.2402 bits (160), Expect = 3.116e-11
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  211 DIMLKKIIPFVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            D +LK+++    ++ A A PF KPVD  A +L DY ++IK P+DLST+K+++  + Y        D  LM  NCY YN PD  +++M 
Sbjct:  300 DTILKEML--SKKHAAYAWPFYKPVDAEALELHDYHEIIKQPMDLSTVKKKMDGREYPDAQSFAADVRLMFSNCYKYNPPDHEVVAMA 385          

HSP 4 Score: 54.299 bits (129), Expect = 2.043e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD   L L DYH++IK P+D+ TI+K ++   Y +    + D   M  NC IYN    DI
Sbjct:   53 WPFYTPVDAIKLSLPDYHKVIKNPMDMGTIKKRLENNYYWTAGECMQDFNTMFTNCYIYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000057848.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:831065:839047:1 gene:ENSAMXG00000012049.2 transcript:ENSAMXT00000057848.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 9.246e-21
Identity = 53/149 (35.57%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKI 642
             TN+L  +LK ++  + +++ + PF  PVD V  +LPDY ++IK P+D+ TIK+RL  ++Y    +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E +++ +            P+ + + K  L  S S V K+
Sbjct:   47 MTNQLQYLLKVVLKTLWKHQFSWPFQAPVDAVKLRLPDYYKIIKCPMDMGTIKKRLENRYYRNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKMFLQKISEMPQEEAEVQPI------------PRGRGRTKQPLAFSISSVTKV 183          

HSP 2 Score: 54.6842 bits (130), Expect = 9.580e-8
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  748 NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            ++ F  PVD   L L DY+++IK P+D+ TI+K ++ R Y +    + D   M  NC IYN    DI
Sbjct:   68 SWPFQAPVDAVKLRLPDYYKIIKCPMDMGTIKKRLENRYYRNAQECIQDFNTMFTNCYIYNKPGDDI 134          

HSP 3 Score: 53.1434 bits (126), Expect = 2.360e-7
Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQ 843
            C  L+ E+M+ K+    + F  PVD  +LGL DYH++IK+ +DLSTI+
Sbjct:  281 CRGLLKEMMAKKHAGYAWPFYRPVDSNALGLHDYHDIIKHSMDLSTIK 328          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008098.1 (pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 gene:ENSPMAG00000007319.1 transcript:ENSPMAT00000008098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 1.007e-21
Identity = 47/116 (40.52%), Postives = 69/116 (59.48%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDE 525
            P  P+  TN+L  M + ++  + R+  A PFL+PVD  A  LPDY ++IK P+D+ TIK+RL   +Y +  +C+ DF  M  NCY+YN P D I  M   L+     K+  MP++E
Sbjct:   29 PGAPYQLTNQLQFMQRSVLKVLWRHHFAWPFLQPVDAAALNLPDYHKIIKQPMDMGTIKQRLESSYYWSASECISDFKTMFNNCYVYNKPGDDIAIMAQALEKAFLQKITEMPVEE 144          

HSP 2 Score: 84.3445 bits (207), Expect = 1.308e-17
Identity = 37/95 (38.95%), Postives = 59/95 (62.11%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  L+ EL+S  + +  + F  PVD ++LGL DYH++IK+P+DL TI++ ++ R Y S     +D+ LM +NC  YN  + D+  + R+ Q  FE
Sbjct:  325 CGSLLKELISKNHAAYAWPFYNPVDARALGLHDYHDIIKHPMDLGTIRRKLEAREYASGQEFASDVRLMFSNCYKYNPPEHDVVAMARKLQDVFE 419          

HSP 3 Score: 64.3142 bits (155), Expect = 2.591e-11
Identity = 28/77 (36.36%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEF 981
            + FL+PVD  +L L DYH++IK P+D+ TI++ ++   Y S    ++D   M NNC +YN    DI  + +  +  F
Sbjct:   57 WPFLQPVDAAALNLPDYHKIIKQPMDMGTIKQRLESSYYWSASECISDFKTMFNNCYVYNKPGDDIAIMAQALEKAF 133          

HSP 4 Score: 60.4622 bits (145), Expect = 4.479e-10
Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF  PVD  A  L DY  +IK P+DL TI+ +L  + Y +  +   D  LM  NCY YN P+  +++M 
Sbjct:  341 AWPFYNPVDARALGLHDYHDIIKHPMDLGTIRRKLEAREYASGQEFASDVRLMFSNCYKYNPPEHDVVAMA 411          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002730.1 (pep scaffold:Pmarinus_7.0:GL482934:3:7765:-1 gene:ENSPMAG00000002495.1 transcript:ENSPMAT00000002730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 5.836e-21
Identity = 55/144 (38.19%), Postives = 83/144 (57.64%), Query Frame = 1
Query:  184 PQKP--FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM-----KNLKHKI----VPLRSVKTP 582
            P KP   TN+L  + + ++  + +++ A PF  PVD  A  LPDY ++IK P+D+ TI+ RL   +Y + G+C+QDFN M  NCY+YN P D I+ M   L+     K+ LMP +E  +     K +K K+    V L+  +TP
Sbjct:   56 PNKPGRLTNQLQYLQRTVMKALWKHQFAWPFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDIVLMAQTLERLFLQKVALMPQEEVVLASPGPKAVKGKVGRKPVSLKGCRTP 199          

HSP 2 Score: 80.4925 bits (197), Expect = 1.014e-16
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ EL + K+ +  + F +PVD  +LGL DYH++IK+P+DLSTI+  MD R Y        D+ +M +NC  YN    D+ ++ R+ Q  FE
Sbjct:  336 CNGILKELFAKKHAAYAWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMARKLQDVFE 430          

HSP 3 Score: 64.3142 bits (155), Expect = 2.035e-11
Identity = 33/79 (41.77%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  238 FVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            F  ++ A A PF KPVD     L DY  +IK P+DLSTIK ++  + Y    +   D  +M  NCY YN PD  ++SM 
Sbjct:  344 FAKKHAAYAWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMA 422          

HSP 4 Score: 53.9138 bits (128), Expect = 3.660e-8
Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD  +L L DYH++IK P+D+ TI++ ++   Y S    + D   M  NC +YN    DI
Sbjct:   84 WPFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDI 149          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002732.1 (pep scaffold:Pmarinus_7.0:GL482934:3:7597:-1 gene:ENSPMAG00000002495.1 transcript:ENSPMAT00000002732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.540e-20
Identity = 51/139 (36.69%), Postives = 80/139 (57.55%), Query Frame = 1
Query:  184 PQKP--FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKL 594
            P KP   TN+L  + + ++  + +++ A PF  PVD  A  LPDY ++IK P+D+ TI+ RL   +Y + G+C+QDFN M  NCY+YN P D I+ M   L+     K+ LMP +E  + +   K V  +  + P + +
Sbjct:   25 PNKPGRLTNQLQYLQRTVMKALWKHQFAWPFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDIVLMAQTLERLFLQKVALMPQEEVVLASPGPKAVKGKVGRKPGETI 163          

HSP 2 Score: 80.8777 bits (198), Expect = 7.639e-17
Identity = 37/95 (38.95%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ EL + K+ +  + F +PVD  +LGL DYH++IK+P+DLSTI+  MD R Y        D+ +M +NC  YN    D+ ++ R+ Q  FE
Sbjct:  318 CNGILKELFAKKHAAYAWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMARKLQDVFE 412          

HSP 3 Score: 63.5438 bits (153), Expect = 3.288e-11
Identity = 33/79 (41.77%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  238 FVMRYEA-AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            F  ++ A A PF KPVD     L DY  +IK P+DLSTIK ++  + Y    +   D  +M  NCY YN PD  ++SM 
Sbjct:  326 FAKKHAAYAWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMA 404          

HSP 4 Score: 54.299 bits (129), Expect = 2.544e-8
Identity = 25/66 (37.88%), Postives = 37/66 (56.06%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F  PVD  +L L DYH++IK P+D+ TI++ ++   Y S    + D   M  NC +YN    DI
Sbjct:   53 WPFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDI 118          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008812.1 (pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 gene:ENSPMAG00000007951.1 transcript:ENSPMAT00000008812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 1.487e-19
Identity = 49/119 (41.18%), Postives = 74/119 (62.18%), Query Frame = 1
Query:  184 PQKP--FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            P KP   TN+L  + K ++  + +++ A PF  PVD     LPDY  +IK+P+D+ TIK+RL   FY T  +C+QDF+ M  NCYIYN P+D I+ M   L+ +   K+  MP++E ++
Sbjct:   24 PVKPGRLTNQLQYLQKVVMKALWKHQFAWPFHHPVDAAKLNLPDYYNIIKNPMDMGTIKKRLESNFYFTAVECIQDFSTMFTNCYIYNRPNDDIVLMAQTLEKFFLQKVAEMPVEEIEL 142          

HSP 2 Score: 63.1586 bits (152), Expect = 6.689e-11
Identity = 24/56 (42.86%), Postives = 42/56 (75.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLY 867
            C  +I E+++ K+ +  + F +PVD +SLGL DYH++IK+P+DLSTI+ +++ R +
Sbjct:  304 CSSIIKEMLAKKHAAYAWPFYKPVDAESLGLHDYHDIIKHPMDLSTIKTFLEGRRF 359          

HSP 3 Score: 56.6102 bits (135), Expect = 7.412e-9
Identity = 35/105 (33.33%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  658 SSNYIPLTDSEYGKCYILINEL-------MSSKYKST-NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            S+N  P   S   K   L N+L       M + +K    + F  PVD   L L DY+ +IK P+D+ TI+K ++   Y + +  + D   M  NC IYN    DI
Sbjct:   13 SANPAPPETSSPVKPGRLTNQLQYLQKVVMKALWKHQFAWPFHHPVDAAKLNLPDYYNIIKNPMDMGTIKKRLESNFYFTAVECIQDFSTMFTNCYIYNRPNDDI 117          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010200.1 (pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 gene:ENSPMAG00000009229.1 transcript:ENSPMAT00000010200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.104e-11
Identity = 34/83 (40.96%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  193 PFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYN 441
            P T +    LK+I+  +  ++ A PFL+PVD    + P Y +VIK P+DLSTI++RL  +FY  L + + D   M +NC  YN
Sbjct: 2751 PLTERDYDGLKRILRSMQVHKMAWPFLEPVDE--EEAPGYYEVIKEPMDLSTIEKRLSSRFYSKLAEFVGDMTKMFDNCRYYN 2831          

HSP 2 Score: 56.6102 bits (135), Expect = 9.188e-9
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 1
Query:  607 FLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYN 930
            F++    P  + +E+++++   PLT+ +Y     L   L S +     + FLEPVD +      Y+E+IK P+DLSTI+K +  R Y      V D+  M +NC  YN
Sbjct: 2730 FIDEYVCPNCQSAEDVMTA-LSPLTERDYDG---LKRILRSMQVHKMAWPFLEPVDEEEA--PGYYEVIKEPMDLSTIEKRLSSRFYSKLAEFVGDMTKMFDNCRYYN 2831          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Yeast
Match: BDF1 (Protein involved in transcription initiation; functions at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p; BDF1 has a paralog, BDF2, that arose from the whole genome duplication [Source:SGD;Acc:S000004391])

HSP 1 Score: 100.523 bits (249), Expect = 4.238e-23
Identity = 81/289 (28.03%), Postives = 126/289 (43.60%), Query Frame = 1
Query:  184 PQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFK-------------------MKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY 993
            PQ P            I  V R + A+PFL+PVD V   +P Y   IK P+DLSTI+ +L    YE   +  +DFNLM+ N   +N P+  I  M   ++   +  ++ MP  +                      +   H   P R++  PK K     +   S+ P  K  +  +              C  ++ ELM+ K+ S NY FLEPVD  S+ L  Y + +K P+DL TI K +++  Y +      D+ L+  NC  +N   T +  +  R +  F + +
Sbjct:  145 PQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMARNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSK---DIYPYESKKPKSKRLQQAMKF------------CQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKEPMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKW 418          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Yeast
Match: BDF2 (Protein involved in transcription initiation; acts at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p; protein abundance increases in response to DNA replication stress; BDF2 has a paralog, BDF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002228])

HSP 1 Score: 95.1301 bits (235), Expect = 2.326e-21
Identity = 77/279 (27.60%), Postives = 139/279 (49.82%), Query Frame = 1
Query:  232 IPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPI-------------DEFKMKNLKHKIVPLRSVKTPKQKL-KIKNFLNVSQSPVKKI-----SENI--VSSNYIPLTDS---EYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYY 996
            I    R + A+PFLKPVD +A  +P Y   +++P+DLS I+ +L    Y ++ +   DF  M++NC  +N P+  I SM  +++ Y + KL  MP              +  K +++   +V  RSV T    + +  N   VS    K+      S+++  +  N  P + +   ++  C  ++  LMS K    N+ FL+PVD  +L L +Y +++K P+DL TI   +    Y +    V+D+ L+  NC  +N    ++ ++ ++ + E  N ++
Sbjct:  146 IKATKRLKDARPFLKPVDPIALNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSISSMAKRIQKYFEKKLSAMPPRVLPASALKKTSRNRKKNEDMDSPLVIRRSVSTTNDNIGESGNREGVSGGRPKRTIHPPKSKDLFDIYENSKPKSKTLQKKFRTCLKILKVLMSKKNSDINFPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLK-ELFNFHW 423          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 54.6842 bits (130), Expect = 1.498e-8
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 1
Query:  187 QKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNA 444
            Q+P     D  ++ I+  +  + AA PFL+PV+    ++PDY   IK P+DLST++ +L    Y+ +   + D  L+  NC +YN 
Sbjct:  325 QRPKRGPHDAAIQNILTELQNHAAAWPFLQPVN--KEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNG 408          

HSP 2 Score: 48.1358 bits (113), Expect = 1.729e-6
Identity = 26/82 (31.71%), Postives = 43/82 (52.44%), Query Frame = 1
Query:  742 STNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFEN 987
            +  + FL+PV+ + +   DY++ IK P+DLST++  ++   Y      + D  L+ NNC +YNG  T       R +  F N
Sbjct:  347 AAAWPFLQPVNKEEV--PDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNN 426          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Match: EDO31845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWS2])

HSP 1 Score: 88.9669 bits (219), Expect = 4.174e-19
Identity = 44/100 (44.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:  184 PQKPF-----TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISM 468
            PQ+P      TN+L  +LK ++  + R+  A PF +PVD V   LPDY  +IK P+DL TIK++L    Y    +C++DF LM+ NCY YN P D I+ M
Sbjct:    6 PQQPAPKTRTTNQLQFLLKTVLKGLWRHHHAWPFREPVDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFRLMINNCYTYNKPGDDIVLM 105          

HSP 2 Score: 79.337 bits (194), Expect = 5.833e-16
Identity = 39/113 (34.51%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  673 PLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKE 1011
            PLT+ +   C  ++ ++ S K+ +  + F +PVD ++LGL DYH++IK P+D++ I+  ++ R YDS      DI LM +NC  YN    D+  + R+ Q  FE  +  + +E
Sbjct:  282 PLTE-QLKYCSTILKDMFSKKHYAYAWPFYKPVDAEALGLHDYHDIIKQPMDMTEIKNKLENRAYDSPSEFAADIRLMFSNCYRYNPPDHDVVKMARQLQDVFEMKFAKMPEE 393          

HSP 3 Score: 66.6254 bits (161), Expect = 7.175e-12
Identity = 40/107 (37.38%), Postives = 54/107 (50.47%), Query Frame = 1
Query:  175 SRCPQKPFTNKL--------DIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            SR  +KP T +L        D+  KK       Y  A PF KPVD  A  L DY  +IK P+D++ IK +L  + Y++  +   D  LM  NCY YN PD  ++ M 
Sbjct:  276 SRGKKKPLTEQLKYCSTILKDMFSKK------HYAYAWPFYKPVDAEALGLHDYHDIIKQPMDMTEIKNKLENRAYDSPSEFAADIRLMFSNCYRYNPPDHDVVKMA 376          

HSP 4 Score: 63.929 bits (154), Expect = 5.030e-11
Identity = 31/71 (43.66%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICR 963
            + F EPVD   L L DYH +IK P+DL TI+K ++   Y      + D  LMINNC  YN    DI  +C+
Sbjct:   37 WPFREPVDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFRLMINNCYTYNKPGDDIVLMCQ 107          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Match: EDO38859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV1])

HSP 1 Score: 78.9518 bits (193), Expect = 1.668e-15
Identity = 75/276 (27.17%), Postives = 120/276 (43.48%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRY---EAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGR-QTDIGNICRRFQLEFENLYYSIFKE 1011
            F    D M  +I+  V R      A PF+ PVD  AY  PDY  V+  PIDL TI E+L  +FY      + D   +  N  +YN  D  I++   +L            + EF   +    ++ L   +    +     + +  Q+  +KI E       + +  S      IL+N LMS +       FL PV++      DY + ++ P+D ST+ +   E  Y     +V+DI L+ +N   YN + ++ I ++  R    FE+   SIF +
Sbjct: 1135 FGEGRDEMTSRIMGCVDRLCELSLAGPFVYPVDVQAY--PDYWSVVPYPIDLHTIIEKLGNRFYRRANALIWDIKQIERNARLYNEEDSQIVNNSTRLVNI---------LSEFIRDSTCRDVLSLVGEEEELAEEIEVPYKHRRQNKRQKIQEEEEPREEVHVNHSWVTSARILLNFLMSREDAEP---FLAPVNLAD--FPDYTDYVEQPMDFSTVWRKFVENQYSDPEQLVSDIRLVFSNSRAYNTQPRSRIYSMTIRLAAMFEDRVDSIFSD 1394          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 62.7734 bits (151), Expect = 6.685e-12
Identity = 31/89 (34.83%), Postives = 53/89 (59.55%), Query Frame = 1
Query:  190 KPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDP 456
            +P TN+    LK+++  +  ++ A PFL+PV  +   +P Y  VIK P+DLST+++++  K Y TL + + D   + +NC  +N  D P
Sbjct:   46 QPLTNRDHDSLKRMLRSLQSHKMAWPFLEPVSGL--DVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDTP 132          

HSP 2 Score: 50.8322 bits (120), Expect = 1.044e-7
Identity = 28/90 (31.11%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  673 PLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQT 942
            PLT+ ++     ++  L S K     + FLEPV    L +  Y+++IK P+DLST++  +  + Y +    V+D+  + +NC  +NG+ T
Sbjct:   47 PLTNRDHDSLKRMLRSLQSHK---MAWPFLEPV--SGLDVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDT 131          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Match: EDO40569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q6])

HSP 1 Score: 60.8474 bits (146), Expect = 7.459e-10
Identity = 33/81 (40.74%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  208 LDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPD 450
            L+I+L+K +  V   +  + F  PVD    ++ DY  VIK P+D ST++ R+   FY T+ +   DFNL++ENC  YNA D
Sbjct:  605 LNIVLRKTLDQVQTKDPGEIFSDPVD--TNEVLDYLDVIKQPMDFSTMRSRIDSNFYHTIEQFEADFNLIIENCMAYNAQD 683          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Match: EDO43844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH0])

HSP 1 Score: 58.5362 bits (140), Expect = 3.268e-9
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  208 LDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPD 450
            L   LK I+  V  + +A PF KPV+    + PDY + IK P+DL T+ ERL   +Y +    + D   + +NC  YN+PD
Sbjct:  654 LQTQLKNILTQVKNHASAWPFQKPVERA--EAPDYYEHIKYPMDLKTMTERLKSGYYSSKKLFVADMRRIFQNCRTYNSPD 732          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Match: brd2a (bromodomain-containing protein 2 [Source:NCBI gene;Acc:101165986])

HSP 1 Score: 96.2857 bits (238), Expect = 7.528e-21
Identity = 51/134 (38.06%), Postives = 76/134 (56.72%), Query Frame = 1
Query:  166 MATSRCPQKP---------FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKN 540
            MA S  PQ P          TN+L  + K ++  + R+  A PF +PVD     LPDY ++IK+P+D+ TI++RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E +++ 
Sbjct:   52 MAPSGPPQPPVRDPSRHGRMTNQLQFLQKVVLKSLWRHHFAWPFHEPVDAAKLNLPDYHKIIKTPMDMGTIRKRLENNYYRSASECMQDFNAMFTNCYIYNKPTDDIVLMAQSLEKAFLQKVAQMPQEEIELEG 185          

HSP 2 Score: 86.6557 bits (213), Expect = 1.027e-17
Identity = 41/95 (43.16%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ EL+S K+ +  + F +PVD  SLGL DYHE+IK+P+DLSTI++ MD R Y        D+ LM +NC  YN    D+  + R+ Q  FE
Sbjct:  330 CSGVLKELLSKKHAAYAWPFYKPVDAVSLGLHDYHEIIKFPMDLSTIKRKMDGREYREAQQFSADVRLMFSNCYKYNPPDHDVVAMARKLQDVFE 424          

HSP 3 Score: 65.4698 bits (158), Expect = 6.659e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD V+  L DY ++IK P+DLSTIK ++  + Y    +   D  LM  NCY YN PD  +++M 
Sbjct:  346 AWPFYKPVDAVSLGLHDYHEIIKFPMDLSTIKRKMDGREYREAQQFSADVRLMFSNCYKYNPPDHDVVAMA 416          

HSP 4 Score: 59.6918 bits (143), Expect = 3.565e-9
Identity = 29/77 (37.66%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEF 981
            + F EPVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI  + +  +  F
Sbjct:   93 WPFHEPVDAAKLNLPDYHKIIKTPMDMGTIRKRLENNYYRSASECMQDFNAMFTNCYIYNKPTDDIVLMAQSLEKAF 169          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Match: brd2a (bromodomain-containing protein 2 [Source:NCBI gene;Acc:101165986])

HSP 1 Score: 95.9005 bits (237), Expect = 1.154e-20
Identity = 51/132 (38.64%), Postives = 75/132 (56.82%), Query Frame = 1
Query:  166 MATSRCPQKP---------FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
            MA S  PQ P          TN+L  + K ++  + R+  A PF +PVD     LPDY ++IK+P+D+ TI++RL   +Y +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:  104 MAPSGPPQPPVRDPSRHGRMTNQLQFLQKVVLKSLWRHHFAWPFHEPVDAAKLNLPDYHKIIKTPMDMGTIRKRLENNYYRSASECMQDFNAMFTNCYIYNKPTDDIVLMAQSLEKAFLQKVAQMPQEEIEL 235          

HSP 2 Score: 86.6557 bits (213), Expect = 1.202e-17
Identity = 41/95 (43.16%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  ++ EL+S K+ +  + F +PVD  SLGL DYHE+IK+P+DLSTI++ MD R Y        D+ LM +NC  YN    D+  + R+ Q  FE
Sbjct:  444 CSGVLKELLSKKHAAYAWPFYKPVDAVSLGLHDYHEIIKFPMDLSTIKRKMDGREYREAQQFSADVRLMFSNCYKYNPPDHDVVAMARKLQDVFE 538          

HSP 3 Score: 65.4698 bits (158), Expect = 6.716e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF KPVD V+  L DY ++IK P+DLSTIK ++  + Y    +   D  LM  NCY YN PD  +++M 
Sbjct:  460 AWPFYKPVDAVSLGLHDYHEIIKFPMDLSTIKRKMDGREYREAQQFSADVRLMFSNCYKYNPPDHDVVAMA 530          

HSP 4 Score: 59.6918 bits (143), Expect = 4.477e-9
Identity = 29/77 (37.66%), Postives = 41/77 (53.25%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEF 981
            + F EPVD   L L DYH++IK P+D+ TI+K ++   Y S    + D   M  NC IYN    DI  + +  +  F
Sbjct:  145 WPFHEPVDAAKLNLPDYHKIIKTPMDMGTIRKRLENNYYRSASECMQDFNAMFTNCYIYNKPTDDIVLMAQSLEKAF 221          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000020210.2 (bromodomain-containing protein 2 [Source:NCBI gene;Acc:101162475])

HSP 1 Score: 95.1301 bits (235), Expect = 1.991e-20
Identity = 48/113 (42.48%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
             TN+L  + K ++  + R+E A PF +PVD    +LPDY ++IK P+D+ TIK+RL   FY +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   65 MTNQLQYLQKTLMKCLWRHEFAWPFHEPVDAYRLKLPDYYKIIKQPMDMGTIKKRLENSFYRSASECIQDFNTMFTNCYIYNKPKDDIVLMAQSLEKIFLQKVAQMPQEELEL 177          

HSP 2 Score: 81.6481 bits (200), Expect = 3.853e-16
Identity = 38/95 (40.00%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  L+ +++S K+ +  + F  PVD  +LGL DYH++IK P+DLSTI++ MD R Y       +D+ LM +NC  YN    D+  + R+ Q  FE
Sbjct:  312 CSGLLKDMLSKKHAAYAWPFYTPVDAAALGLHDYHDIIKCPMDLSTIKRKMDCREYRDAQQFASDVRLMFSNCYKYNPPDHDVVGMARKLQDVFE 406          

HSP 3 Score: 62.7734 bits (151), Expect = 4.260e-10
Identity = 31/71 (43.66%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF  PVD  A  L DY  +IK P+DLSTIK ++  + Y    +   D  LM  NCY YN PD  ++ M 
Sbjct:  328 AWPFYTPVDAAALGLHDYHDIIKCPMDLSTIKRKMDCREYRDAQQFASDVRLMFSNCYKYNPPDHDVVGMA 398          

HSP 4 Score: 56.9954 bits (136), Expect = 2.992e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F EPVD   L L DY+++IK P+D+ TI+K ++   Y S    + D   M  NC IYN  + DI
Sbjct:   87 WPFHEPVDAYRLKLPDYYKIIKQPMDMGTIKKRLENSFYRSASECIQDFNTMFTNCYIYNKPKDDI 152          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000032890.1 (bromodomain-containing protein 2 [Source:NCBI gene;Acc:101162475])

HSP 1 Score: 94.7449 bits (234), Expect = 2.774e-20
Identity = 48/113 (42.48%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  196 FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM 534
             TN+L  + K ++  + R+E A PF +PVD    +LPDY ++IK P+D+ TIK+RL   FY +  +C+QDFN M  NCYIYN P D I+ M   L+     K+  MP +E ++
Sbjct:   71 MTNQLQYLQKTLMKCLWRHEFAWPFHEPVDAYRLKLPDYYKIIKQPMDMGTIKKRLENSFYRSASECIQDFNTMFTNCYIYNKPKDDIVLMAQSLEKIFLQKVAQMPQEELEL 183          

HSP 2 Score: 82.0333 bits (201), Expect = 3.433e-16
Identity = 38/95 (40.00%), Postives = 57/95 (60.00%), Query Frame = 1
Query:  700 CYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFE 984
            C  L+ +++S K+ +  + F  PVD  +LGL DYH++IK P+DLSTI++ MD R Y       +D+ LM +NC  YN    D+  + R+ Q  FE
Sbjct:  372 CSGLLKDMLSKKHAAYAWPFYTPVDAAALGLHDYHDIIKCPMDLSTIKRKMDCREYRDAQQFASDVRLMFSNCYKYNPPDHDVVGMARKLQDVFE 466          

HSP 3 Score: 62.3882 bits (150), Expect = 5.176e-10
Identity = 31/71 (43.66%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  259 AKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMG 471
            A PF  PVD  A  L DY  +IK P+DLSTIK ++  + Y    +   D  LM  NCY YN PD  ++ M 
Sbjct:  388 AWPFYTPVDAAALGLHDYHDIIKCPMDLSTIKRKMDCREYRDAQQFASDVRLMFSNCYKYNPPDHDVVGMA 458          

HSP 4 Score: 56.9954 bits (136), Expect = 3.066e-8
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDI 948
            + F EPVD   L L DY+++IK P+D+ TI+K ++   Y S    + D   M  NC IYN  + DI
Sbjct:   93 WPFHEPVDAYRLKLPDYYKIIKQPMDMGTIKKRLENSFYRSASECIQDFNTMFTNCYIYNKPKDDI 158          
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000040370.1 (pep primary_assembly:ASM223467v1:12:23030393:23034086:1 gene:ENSORLG00000022284.1 transcript:ENSORLT00000040370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.198e-19
Identity = 42/88 (47.73%), Postives = 57/88 (64.77%), Query Frame = 1
Query:  184 PQKPF--TNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYN 441
            P KP   TN+L  M   +I  + R+  A PF +PVD VA  LPDY ++I SP+D+ TIK+RL   +Y +  +C++DFN M  NCYIYN
Sbjct:   55 PDKPGRRTNQLKYMHNVVIKSLWRHPFAWPFYQPVDAVALGLPDYHKIITSPMDMGTIKKRLENNYYWSASECMEDFNTMFTNCYIYN 142          

HSP 2 Score: 56.9954 bits (136), Expect = 2.955e-9
Identity = 25/60 (41.67%), Postives = 36/60 (60.00%), Query Frame = 1
Query:  751 YLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYN 930
            + F +PVD  +LGL DYH++I  P+D+ TI+K ++   Y S    + D   M  NC IYN
Sbjct:   83 WPFYQPVDAVALGLPDYHKIITSPMDMGTIKKRLENNYYWSASECMEDFNTMFTNCYIYN 142          
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Match: SMESG000080341.1 (SMESG000080341.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 379/383 (98.96%), Postives = 382/383 (99.74%), Query Frame = 1
Query:  166 MATSRCPQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISVARSRIDMIVNLFXXXXXXXXXXXXXXXXXXXPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY 1314
            MATSRCPQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFK+KNLK+KIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKS NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISV+RSRIDMIVNLFENNKELLKKERKRKMMMKLPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY
Sbjct:    1 MATSRCPQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFKVKNLKNKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSINYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISVSRSRIDMIVNLFENNKELLKKERKRKMMMKLPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY 383          
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Match: SMESG000080341.1 (SMESG000080341.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 362/366 (98.91%), Postives = 365/366 (99.73%), Query Frame = 1
Query:  217 MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISVARSRIDMIVNLFXXXXXXXXXXXXXXXXXXXPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY 1314
            MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFK+KNLK+KIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKS NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISV+RSRIDMIVNLFENNKELLKKERKRKMMMKLPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY
Sbjct:    1 MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFKVKNLKNKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSINYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMIRINSEKISVSRSRIDMIVNLFENNKELLKKERKRKMMMKLPDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY 366          
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Match: SMESG000080341.1 (SMESG000080341.1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 290/293 (98.98%), Postives = 292/293 (99.66%), Query Frame = 1
Query:  217 MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMI 1095
            MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFK+KNLK+KIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKS NYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMI
Sbjct:    1 MLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIKLKLYLKAKLVLMPIDEFKVKNLKNKIVPLRSVKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSINYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIKRKHKEIEEMI 293          
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Match: SMESG000075694.1 (SMESG000075694.1)

HSP 1 Score: 164.466 bits (415), Expect = 4.943e-44
Identity = 115/379 (30.34%), Postives = 190/379 (50.13%), Query Frame = 1
Query:  181 CPQKP-----FTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM---------------------------KNLKHKIVPLRS--------------------VKTPKQKLKIKNFLNVSQSPVKKISENIVSSNYIPLT---DSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLY-----------YSIFKEKCR-ENVNDEAFYFLMKIKRKHKEIEEMIRINSEKI 1116
            C  KP      TN+L  + KKI+P +MR++ + PFL PVDH A  +PDYP++I  P+D +T+K RLI+KFY    +C+ D  L+ +NCYI+N P+  +ISM + L+    +KL  +P  E  +                           K+L+     L+S                     K+  +K K+++  ++S +P   IS    S + IP+      E   C  ++ ++ S++Y+  N +F+EPV V+   LSDY  +IK P+DLSTI+K +D+  Y ++     D+ L+ +NC  YNG+ +DI  + +  Q  F+ L+           + +   K + E+VN++    L KI ++ K + E     +EKI
Sbjct:   20 CSGKPRPANISTNRLQFIKKKILPQLMRHKYSFPFLHPVDHAALNIPDYPKIIHYPMDFTTVKNRLIKKFYYNADECITDIRLVFQNCYIFNPPEIDLISMTLTLENIFNSKLDKLPSQENDISSSNSKKDTKSNSINNDSSSEPVCDIKKSLRPTTKRLKSNSNYNETTSTNASNCSISPDAKSKAKKRKVESCYDLSPTPSPSISLKNESLDEIPIKPKLSEELKMCSNILRDISSNRYRHLNDMFMEPVAVRFPNLSDYSSIIKKPMDLSTIRKNLDDGSYKTKNDFSEDVKLIFDNCYDYNGKDSDISKLAKDLQNIFDELFSKQFNLSKPQPFQVQNSKIKSESVNEDTLQLLQKIHKEQKSLVETHNKVAEKI 398          
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Match: SMESG000040270.1 (SMESG000040270.1)

HSP 1 Score: 159.458 bits (402), Expect = 4.680e-42
Identity = 104/307 (33.88%), Postives = 164/307 (53.42%), Query Frame = 1
Query:  184 PQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYPQVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIISMGIXXXXXXXXXXXXMPIDEFKM--KNLKHKIVPLR-----------SVKTPKQ------------KLKIKNFLNVSQSPVKKISENIVSSNYI-------PLTDSEYGKCYILINELMSSKYKSTNYLFLEPVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINNCNIYNGRQTDIGNICRRFQLEFENLYYSIFK 1008
            P K  TNKL+ + K+IIP +++   A PF K VD++   LPDYP++IK P+D+S IK RL +K+Y     C+QD   +  NCYIYN P   I++M   L++  + KL +MPI+E+++    +KH+    +           SV +P+             + KI +  ++S +P   I ++ + S +        P    +   C  L+ E+M+ +Y+  N +FLEPV  K   L DY  +IK PIDL TI+  ++   Y ++   +ND+ LM NNC  YNG ++D+  + R  Q  F+  Y   FK
Sbjct:   17 PAKILTNKLEYIKKQIIPVILKNPHAYPFAKAVDYINLNLPDYPEIIKGPMDISKIKVRLAQKYYRRASDCIQDLFQIFCNCYIYNPPGTDIVNMARALEILTREKLKMMPIEEYEVVSTKVKHEDGSKKGRIANHKSDKSSVGSPQNSVSSSKAASSAKRAKIDSCYDMSPTPSPPIFKSKLKSEFSDDHHLKRPRLSDDLRLCAALLKEIMAVRYRHLNEMFLEPVTQKFPSLKDYLSIIKNPIDLGTIKDKLENYQYKTKDEFLNDVQLMFNNCYAYNGMESDVSRLARDLQKIFDEAYSKQFK 323          
The following BLAST results are available for this feature:
BLAST of Bromodomain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRDT1.229e-2142.73bromodomain testis associated [Source:HGNC Symbol;... [more]
BRDT1.412e-2142.73bromodomain testis associated [Source:HGNC Symbol;... [more]
BRDT1.412e-2142.73bromodomain testis associated [Source:HGNC Symbol;... [more]
BRDT2.907e-2142.73bromodomain testis associated [Source:HGNC Symbol;... [more]
BRDT7.197e-2042.73bromodomain testis associated [Source:HGNC Symbol;... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13C5.22.184e-1635.77pep chromosome:WBcel235:X:593960:596289:1 gene:WBG... [more]
bet-14.890e-1433.65Bromodomain-containing protein bet-1 [Source:UniP... [more]
bet-16.191e-1433.65Bromodomain-containing protein bet-1 [Source:UniP... [more]
cbp-11.364e-931.13pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-11.373e-931.13pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fs(1)h4.151e-1934.75gene:FBgn0004656 transcript:FBtr0071119[more]
fs(1)h4.192e-1934.75gene:FBgn0004656 transcript:FBtr0333307[more]
fs(1)h2.589e-1734.35gene:FBgn0004656 transcript:FBtr0333308[more]
fs(1)h2.593e-1734.35gene:FBgn0004656 transcript:FBtr0071122[more]
fs(1)h2.593e-1734.35gene:FBgn0004656 transcript:FBtr0071120[more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brd2b1.857e-2235.15bromodomain containing 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
brd2b3.423e-2135.15bromodomain containing 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
brd3b5.802e-2142.86bromodomain containing 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
brd3b7.140e-2142.86bromodomain containing 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
brd41.531e-2042.02bromodomain containing 4 [Source:NCBI gene;Acc:570... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000053251.12.151e-1939.52bromodomain, testis-specific [Source:NCBI gene;Acc... [more]
brd22.400e-1939.37bromodomain containing 2 [Source:NCBI gene;Acc:100... [more]
ENSXETT00000053245.13.057e-1939.84bromodomain, testis-specific [Source:NCBI gene;Acc... [more]
brd24.068e-1940.34bromodomain containing 2 [Source:NCBI gene;Acc:100... [more]
kif3b9.501e-1846.15kinesin family member 3B [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Brd34.262e-2040.34bromodomain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Brd34.262e-2040.34bromodomain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Brd35.040e-2040.34bromodomain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Brd36.257e-2040.34bromodomain containing 3 [Source:MGI Symbol;Acc:MG... [more]
Brd36.257e-2040.34bromodomain containing 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y7N0|BDF1_SCHPO9.468e-2631.23SWR1 complex bromodomain subunit bdf1 OS=Schizosac... [more]
sp|Q9HGP4|YK82_SCHPO3.997e-2526.57Bromodomain-containing protein C631.02 OS=Schizosa... [more]
sp|Q5A4W8|BDF1_CANAL2.695e-2228.72Bromodomain-containing factor 1 OS=Candida albican... [more]
sp|P35817|BDF1_YEAST2.943e-2128.03Bromodomain-containing factor 1 OS=Saccharomyces c... [more]
sp|F1R5H6|BRD4_DANRE1.247e-1942.02Bromodomain-containing protein 4 OS=Danio rerio OX... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EI341.365e-4433.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0S7GB804.774e-4435.87BRD3 (Fragment) OS=Poeciliopsis prolifica OX=18813... [more]
A0A5K3EJH45.638e-4433.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UF125.838e-4433.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A315W4D66.684e-4435.31Uncharacterized protein OS=Gambusia affinis OX=335... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brd2a5.657e-2239.26bromodomain-containing protein 2-like [Source:NCBI... [more]
BRD31.444e-2143.70bromodomain-containing protein 3-like [Source:NCBI... [more]
BRD31.561e-2143.70bromodomain-containing protein 3-like [Source:NCBI... [more]
BRD31.573e-2143.70bromodomain-containing protein 3-like [Source:NCBI... [more]
ENSAMXT00000057848.19.246e-2135.57pep primary_assembly:Astyanax_mexicanus-2.0:12:831... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008098.11.007e-2140.52pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 g... [more]
ENSPMAT00000002730.15.836e-2138.19pep scaffold:Pmarinus_7.0:GL482934:3:7765:-1 gene:... [more]
ENSPMAT00000002732.11.540e-2036.69pep scaffold:Pmarinus_7.0:GL482934:3:7597:-1 gene:... [more]
ENSPMAT00000008812.11.487e-1941.18pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 ge... [more]
ENSPMAT00000010200.11.104e-1140.96pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 g... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
BDF14.238e-2328.03Protein involved in transcription initiation; func... [more]
BDF22.326e-2127.60Protein involved in transcription initiation; acts... [more]
GCN51.498e-833.72Catalytic subunit of ADA and SAGA histone acetyltr... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO318454.174e-1944.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388591.668e-1527.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449026.685e-1234.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405697.459e-1040.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438443.268e-938.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brd2a7.528e-2138.06bromodomain-containing protein 2 [Source:NCBI gene... [more]
brd2a1.154e-2038.64bromodomain-containing protein 2 [Source:NCBI gene... [more]
ENSORLT00000020210.21.991e-2042.48bromodomain-containing protein 2 [Source:NCBI gene... [more]
ENSORLT00000032890.12.774e-2042.48bromodomain-containing protein 2 [Source:NCBI gene... [more]
ENSORLT00000040370.11.198e-1947.73pep primary_assembly:ASM223467v1:12:23030393:23034... [more]
back to top
BLAST of Bromodomain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080341.10.000e+098.96SMESG000080341.1[more]
SMESG000080341.10.000e+098.91SMESG000080341.1[more]
SMESG000080341.10.000e+098.98SMESG000080341.1[more]
SMESG000075694.14.943e-4430.34SMESG000075694.1[more]
SMESG000040270.14.680e-4233.88SMESG000040270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034033 ID=SMED30034033|Name=Bromodomain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1368bp
GCTATTATCTTACTTTATAAATCAATTATTTAAGTTAAAAAGTGACTAGA
TTTCTTTTGAAATCTATGTATTATTTTGAAATTTAAAAATTATTATTTTA
AAAATTTCTTAGTTTTAAGACTTCAAAGTTAATTGAAATTTCTGTATAGT
ATGTGATTTTTGACAATGGCGACATCAAGATGTCCTCAAAAACCATTTAC
TAACAAACTAGATATAATGTTAAAAAAAATTATCCCTTTTGTTATGAGAT
ATGAAGCTGCAAAGCCGTTTTTGAAACCTGTTGATCACGTTGCCTATCAA
TTACCGGATTATCCACAAGTTATAAAAAGTCCTATTGATTTAAGTACAAT
AAAAGAGAGATTAATTAGAAAATTTTATGAGACTCTTGGAAAATGTTTAC
AGGATTTTAATTTAATGCTAGAAAACTGTTACATTTACAATGCACCGGAT
GATCCAATTATATCTATGGGAATAAAATTAAAATTGTATTTAAAAGCAAA
ACTAGTTCTAATGCCAATTGACGAATTTAAAATGAAAAACCTTAAACATA
AAATTGTGCCTTTAAGAAGCGTAAAAACTCCTAAGCAAAAATTAAAAATA
AAAAATTTTTTAAATGTATCTCAATCGCCAGTAAAAAAAATATCTGAAAA
TATAGTTTCTTCTAATTATATTCCATTGACGGATTCGGAATACGGAAAGT
GCTATATATTAATTAATGAATTGATGTCATCAAAATACAAATCAACTAAT
TACTTATTTCTTGAACCCGTTGATGTGAAATCTCTCGGACTATCCGATTA
TCATGAGTTAATAAAATATCCTATTGATTTAAGTACGATCCAAAAATATA
TGGACGAACGTCTTTATGACAGCAGATTGGCTGTTGTCAATGATATTTAT
TTGATGATCAATAATTGTAACATCTACAACGGCCGCCAAACTGATATTGG
AAATATTTGTCGTCGCTTTCAGTTGGAATTTGAAAATCTTTACTACTCTA
TTTTTAAAGAAAAATGCCGAGAAAATGTTAACGACGAGGCATTTTATTTC
CTGATGAAAATTAAAAGGAAACATAAAGAAATCGAAGAAATGATTCGTAT
AAATAGCGAAAAGATTTCAGTTGCCCGTTCAAGAATTGACATGATTGTCA
ATTTATTTGAAAATAATAAAGAACTTCTAAAAAAAGAAAGGAAAAGGAAA
ATGATGATGAAATTACCAGATGTTTGTTCTTCACAGTTCGACAGCGTTAG
CACAGTTAAAAAGTTAAAAACCCGATTGAAAGAAAGATCTTTCATGTTGG
AATCTGATGTATATTGAATTTTCTGACAAATTTTTGTATAGAAATTATAC
AAAGAAATTATTTTTAAA
back to top

protein sequence of SMED30034033-orf-1

>SMED30034033-orf-1 ID=SMED30034033-orf-1|Name=SMED30034033-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=384bp
MATSRCPQKPFTNKLDIMLKKIIPFVMRYEAAKPFLKPVDHVAYQLPDYP
QVIKSPIDLSTIKERLIRKFYETLGKCLQDFNLMLENCYIYNAPDDPIIS
MGIKLKLYLKAKLVLMPIDEFKMKNLKHKIVPLRSVKTPKQKLKIKNFLN
VSQSPVKKISENIVSSNYIPLTDSEYGKCYILINELMSSKYKSTNYLFLE
PVDVKSLGLSDYHELIKYPIDLSTIQKYMDERLYDSRLAVVNDIYLMINN
CNIYNGRQTDIGNICRRFQLEFENLYYSIFKEKCRENVNDEAFYFLMKIK
RKHKEIEEMIRINSEKISVARSRIDMIVNLFENNKELLKKERKRKMMMKL
PDVCSSQFDSVSTVKKLKTRLKERSFMLESDVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR001487Bromodomain
IPR018359Bromodomain_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003682chromatin binding
GO:0070577lysine-acetylated histone binding
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0016569covalent chromatin modification
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 30..43
score: 37.42
coord: 62..80
score: 28.83
coord: 80..99
score: 37.39
coord: 46..62
score: 54.48
IPR001487BromodomainSMARTSM00297bromo_6coord: 172..281
e-value: 1.4E-23
score: 94.4
coord: 8..118
e-value: 8.8E-25
score: 98.3
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 19..99
e-value: 3.4E-18
score: 65.5
coord: 184..264
e-value: 8.5E-14
score: 51.4
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 27..99
score: 18.985
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 190..262
score: 16.929
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 2..130
e-value: 1.8E-30
score: 107.5
coord: 150..292
e-value: 1.1E-24
score: 88.7
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 9..112
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 155..281
NoneNo IPR availablePANTHERPTHR22880FALZ-RELATED BROMODOMAIN-CONTAINING PROTEINScoord: 11..343
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 195..254