Sperm surface protein Sp17

Overview
NameSperm surface protein Sp17
Smed IDSMED30034016
Length (bp)1425
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm surface protein Sp17 (SMED30034016) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm surface protein Sp17 (SMED30034016) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm surface protein Sp17 (SMED30034016) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm surface protein Sp17 (SMED30034016) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034016

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034016SMESG000046919.1 Contig367uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034016SMESG000046919.1 Contig367newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034016SMESG000062750.1 Contig367uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034016SMESG000062750.1 Contig367newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30034016SMESG000046919.1 SmedASXL_015865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034016SMESG000046919.1 SmedASXL_015863SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig3808uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig3808newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000004166.1 Contig3808uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000004166.1 Contig3808newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig10753uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig10753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig36377newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig36377uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig26910uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034016SMESG000046919.1 Contig26910newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30034016SMESG000046919.1 dd_Smed_v6_4783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30034016SMESG000046919.1 Contig26910uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034016SMESG000046919.1 Contig26910newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30034016SMESG000046919.1 dd_Smed_v4_4783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: SPA17 (sperm autoantigenic protein 17 [Source:HGNC Symbol;Acc:HGNC:11210])

HSP 1 Score: 97.8265 bits (242), Expect = 1.486e-23
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: SPA17 (sperm autoantigenic protein 17 [Source:HGNC Symbol;Acc:HGNC:11210])

HSP 1 Score: 97.8265 bits (242), Expect = 1.486e-23
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 4.566e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 226
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 4.566e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 226
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Match: CABYR (calcium binding tyrosine phosphorylation regulated [Source:HGNC Symbol;Acc:HGNC:15569])

HSP 1 Score: 51.6026 bits (122), Expect = 4.566e-8
Identity = 25/51 (49.02%), Postives = 31/51 (60.78%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYD 226
            S  RL VP G + +LEG++R VL+  P NI  FAA YF+EL   R  T  D
Sbjct:    4 SKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMD 54          
BLAST of Sperm surface protein Sp17 vs. Ensembl Celegans
Match: F39H12.3 (pep chromosome:WBcel235:X:838144:841493:-1 gene:WBGene00018214.1 transcript:F39H12.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39H12.3)

HSP 1 Score: 65.4698 bits (158), Expect = 5.320e-12
Identity = 56/193 (29.02%), Postives = 93/193 (48.19%), Query Frame = 2
Query:   92 VPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQE--------TGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFER-------QNQKPNSNEEIDLNNSQINQEDEEID---IDLNDPEVEKAAVKIQSVYKGFRSRKTTERI 616
            VP   + +LE LAREVLR QP ++  F   +F+E L+ R+E          Y+   +  A L+ +F                          +E  R A+   +DT     AA  IQA+F+GH  R        + + +S+E++D  N++ +Q+   +    ID++ PE ++AA KIQS  +GF +RK  +++
Sbjct:    9 VPHDLRPILEALAREVLRSQPSDVAEFGHMFFDEYLKHRRENRNILKDPAAYE---VFRADLQKKF--------------------------AEVERPAS--PMDT-----AATKIQAAFKGHLVRAHPEKYGMSTRTSSSEKLDSANNKKDQKRHSVGGYTIDVDTPE-DRAATKIQSEIRGFLTRKHVDKM 164          
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Match: igl (gene:FBgn0013467 transcript:FBtr0087362)

HSP 1 Score: 58.151 bits (139), Expect = 3.206e-10
Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 2
Query:  401 AAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQE-DEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            AA+ IQ++FRGH  R+    ++ E+ D+   +I ++  EE+DIDL DPE+ KAA KIQ+ ++G ++RK
Sbjct:   52 AALKIQSTFRGHLARKLVNKDAPEDEDI--QEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 117          
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Match: igl (gene:FBgn0013467 transcript:FBtr0332267)

HSP 1 Score: 58.151 bits (139), Expect = 3.206e-10
Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 2
Query:  401 AAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQE-DEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            AA+ IQ++FRGH  R+    ++ E+ D+   +I ++  EE+DIDL DPE+ KAA KIQ+ ++G ++RK
Sbjct:   52 AALKIQSTFRGHLARKLVNKDAPEDEDI--QEITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 117          
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Match: igl (gene:FBgn0013467 transcript:FBtr0087361)

HSP 1 Score: 58.151 bits (139), Expect = 2.972e-9
Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 2
Query:  401 AAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQE-DEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            AA+ IQ++FRGH  R+    ++ E+ D+   +I ++  EE+DIDL DPE+ KAA KIQ+ ++G ++RK
Sbjct:  170 AALKIQSTFRGHLARKLVNKDAPEDEDIQ--EITKKVAEELDIDLTDPELNKAATKIQASFRGHKTRK 235          
BLAST of Sperm surface protein Sp17 vs. Ensembl Zebrafish
Match: spa17 (sperm autoantigenic protein 17 [Source:ZFIN;Acc:ZDB-GENE-061027-337])

HSP 1 Score: 106.301 bits (264), Expect = 5.459e-24
Identity = 48/70 (68.57%), Postives = 57/70 (81.43%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 268
            MAVP+SNT LR+P+GF N+LEGL REVLR QPE+I +FAA YF ELL+ R+E+G  D A  GAKLEDRFY
Sbjct:    1 MAVPFSNTHLRIPRGFGNLLEGLTREVLREQPEDIATFAAVYFTELLKAREESGL-DPAEWGAKLEDRFY 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Xenopus
Match: mettl4 (methyltransferase like 4 [Source:Xenbase;Acc:XB-GENE-992320])

HSP 1 Score: 95.9005 bits (237), Expect = 1.257e-20
Identity = 59/148 (39.86%), Postives = 85/148 (57.43%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEE--------QQSAAVKIQSEYRRFAAKK-------EVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL REVLR QP++I  F A YF +LL+ RQ+T + D A  GA LEDRFYNN+ F++        E        ++S ++   S+    +          E D  ++ +AA  IQA+FRG+  R   K
Sbjct:    1 MSIPFSNTHYRIPRGFANLLEGLTREVLRHQPKDIPLFGAKYFSQLLQQRQDTDF-DPAQWGAALEDRFYNNYDFQHTELKKYTSEPSELKKSKRKSFSMLDNSDTYPLSPSTSLEQKEIETDDMRKMQAATTIQAAFRGYNVRHKVK 147          
BLAST of Sperm surface protein Sp17 vs. Ensembl Xenopus
Match: ENSXETT00000015907.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460425.1:107652:107837:1 gene:ENSXETG00000009842.1 transcript:ENSXETT00000015907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 5.502e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = 2
Query:  503 QEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKT 604
            + +EEIDIDLN PE EKAA+ IQS ++ F+ RKT
Sbjct:   24 KAEEEIDIDLNAPETEKAALAIQSKFRRFQKRKT 57          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Spa17 (sperm autoantigenic protein 17 [Source:MGI Symbol;Acc:MGI:1333778])

HSP 1 Score: 95.9005 bits (237), Expect = 5.029e-23
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVAREEVK 133          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Spa17 (sperm autoantigenic protein 17 [Source:MGI Symbol;Acc:MGI:1333778])

HSP 1 Score: 93.9745 bits (232), Expect = 1.588e-22
Identity = 61/131 (46.56%), Postives = 89/131 (67.94%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQ 448
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R+
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVARE 130          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 53.9138 bits (128), Expect = 5.432e-8
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 232
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 53.9138 bits (128), Expect = 9.086e-8
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 232
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Match: Cabyr (calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2) [Source:MGI Symbol;Acc:MGI:1918382])

HSP 1 Score: 54.6842 bits (130), Expect = 1.706e-7
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 2
Query:   74 SNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDI 232
            S  RL VP G + +LEG++R +L+  P NI  FAA YF+EL+  R+     DI
Sbjct:    4 SKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDI 56          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|P36425|SP17_RABIT (Sperm surface protein Sp17 OS=Oryctolagus cuniculus OX=9986 GN=SPA17 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.329e-28
Identity = 65/133 (48.87%), Postives = 90/133 (67.67%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK++DRFYNNH+F+   +     E++S +V  + E        E D  KEE AA+ IQA+FRGH  R++ K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTNFDP-AEWGAKVDDRFYNNHAFQEHESEKCEAEEKSQSV-TEEETPVLTIDSEDDKDKEEMAALKIQAAFRGHLAREDVK 131          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|O19021|SP17_MACFA (Sperm surface protein Sp17 OS=Macaca fascicularis OX=9541 GN=SPA17 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.401e-23
Identity = 63/143 (44.06%), Postives = 87/143 (60.84%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQ----------SAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       ++ +Q           A+V I         K+EV       AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQIPGKEEEASVTILDSSEEDKEKEEV-------AAVKIQAAFRGHVAREEVK 135          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q15506|SP17_HUMAN (Sperm surface protein Sp17 OS=Homo sapiens OX=9606 GN=SPA17 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.136e-23
Identity = 63/136 (46.32%), Postives = 88/136 (64.71%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAK 135          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q95230|SP17_PAPHA (Sperm surface protein Sp17 OS=Papio hamadryas OX=9557 GN=SPA17 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.063e-22
Identity = 66/154 (42.86%), Postives = 94/154 (61.04%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXX---XXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQED 511
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  G+K+EDRFYNNH+F+       +   +E+   + K +          E D +KEE AA+ IQA+FRGH  R+  K    + +     + N ED
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDP-AEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQVSGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHVAREEVKKMKTDSLQNEEKEENSED 153          
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Match: sp|Q62252|SP17_MOUSE (Sperm surface protein Sp17 OS=Mus musculus OX=10090 GN=Spa17 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.517e-22
Identity = 62/134 (46.27%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQS-AAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQK 457
            M++P+SNT  R+P+GF N+LEGL RE+LR QP+NI +FAA YFE LL  R++T +D  A  GAK+EDRFYNNH+FK        E++ + ++ + ++    F    E + ++EE AA+ IQ+ FRGH  R+  K
Sbjct:    1 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDP-AEWGAKVEDRFYNNHAFKEQEQVEKCEQELAKSSGREETPVTPFEESTEEEREQEEAAALKIQSLFRGHVAREEVK 133          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: K1PZL4 (Sperm surface protein Sp17 OS=Crassostrea gigas OX=29159 GN=CGI_10005609 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.263e-56
Identity = 154/386 (39.90%), Postives = 230/386 (59.59%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQN----QKPNS----NEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHES-EDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXX----XVEKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFR 1177
            MAVP+SNT+LRVPKGFQN+LEGLARE LR QPENIY F A YF++L+++R++TG+D  A+ GA+LEDRFYNN SF++P+T+  + +QQ AA+KIQ+E+RR  A++EV+  KEE+AA+ IQ+ FRG  +RQ     + P +     EE D   S+     + +DIDL+DPEV +AAVKIQ+ +KG+++RK  +     A T+  +++ +           E E+ D     +     H   Q+ +E   +  + ML E   S  EN +    A     +   E K L + +  +  + ++       +VE+AA+KIQ+ FKG+++RK  E  +     +  E++     + ++V         DIDLNDPDV  AAVKIQ+   GFR
Sbjct:    1 MAVPFSNTKLRVPKGFQNILEGLARECLRSQPENIYEFGAKYFQQLIQVREQTGHDP-AVHGARLEDRFYNNDSFQSPSTDPGDPQQQEAALKIQTEFRRHHAEQEVEHMKEEDAAVKIQSGFRGFQDRQKVLEMKDPEAYAKQKEEADERLSKGGSSKDSVDIDLDDPEVAEAAVKIQAGFKGYKARKEVKDKKEKASTDSKSDSQLP---------SEKEMADAATKIQAGFRGHKTRQDMKEKKEKGKEDMLSEINKSELENAVVHIQAGFRGYQARKEMKHLMDSQPAKQPEEEVDIDLNDPDVEQAALKIQAGFKGYKTRKEFESKKM----ESSEVINAGKNEEEEV---------DIDLNDPDVANAAVKIQA---GFR 360          

HSP 2 Score: 88.9669 bits (219), Expect = 4.416e-15
Identity = 109/372 (29.30%), Postives = 171/372 (45.97%), Query Frame = 2
Query:  326 AAVKIQSEYRRFAAKKEVDTKKEE------------------EAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQIN----------------------------------QEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDES-KSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRK------------TLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXX-----------------LNDPDVEKAAVKIQSVYKGFRNRKTIK 1195
            AAVKIQ+ ++ + A+KEV  KKE+                  +AA  IQA FRGH  RQ+ K    +  +   S+IN                                  Q +EE+DIDLNDP+VE+AA+KIQ+ +KG+++RK  E            +  +E + ++++  +E E +D               +  + D+ ++   +    ++ +K    DT  + VT  E +P    + E + +E+IDIDL DPEVEKAA+KIQ+ FKGFR  K            +  E +T  ++   E  E  L+     + +   + +                    LNDPDVE+AA+KIQ+ +KG++ RK IK
Sbjct:  173 AAVKIQAGFKGYKARKEVKDKKEKASTDSKSDSQLPSEKEMADAATKIQAGFRGHKTRQDMKEKKEKGKEDMLSEINKSELENAVVHIQAGFRGYQARKEMKHLMDSQPAKQPEEEVDIDLNDPDVEQAALKIQAGFKGYKTRKEFE------------SKKMESSEVINAGKNEEEEVDI--------------DLNDPDVANAAVKIQAGFRAHIKAKKSDTAKSSVTK-ESSP----VAEQESEEVIDIDLNDPEVEKAALKIQAGFKGFRKAKKATTQDQTDKTESKPEEETSSKAADKETEEAALKIQAGFRGYKTRQEVKEQMAKEEKKGEEQEEVDIDLNDPDVEQAALKIQAGFKGYQARKEIK 513          

HSP 3 Score: 61.2326 bits (147), Expect = 3.284e-6
Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 2
Query:  314 EQQSAAVKIQSEYRRFAAKKEVDT---------------------KKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            E + AA+KIQ+ ++ F   K+  T                     K+ EEAA+ IQA FRG+  RQ  K     E      +  +E EE+DIDLNDP+VE+AA+KIQ+ +KG+++RK
Sbjct:  399 EVEKAALKIQAGFKGFRKAKKATTQDQTDKTESKPEEETSSKAADKETEEAALKIQAGFRGYKTRQEVK-----EQMAKEEKKGEEQEEVDIDLNDPDVEQAALKIQAGFKGYQARK 510          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A210PVC9 (Sperm surface protein Sp17 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22352 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 4.443e-52
Identity = 105/182 (57.69%), Postives = 140/182 (76.92%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID-LNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            MAVP+SNT+LRVPKGFQN+LEGLAREVLR QPENIY F A YF++LLR+R ETG+D  A+ GA++EDRFYNN +F++P  ++ + +QQ AA+KIQ+EYRR +AKKEVD  +EE+AA  IQA  RGH +RQ        ++D +   +   +  E+DI+L DPEVE AAVKIQ+ +KG+++RK
Sbjct:    1 MAVPFSNTKLRVPKGFQNILEGLAREVLRNQPENIYEFGAKYFDQLLRVRDETGHDP-AVHGARMEDRFYNNDAFRSPGVDSGDPQQQDAALKIQTEYRRHSAKKEVDDMREEDAATTIQAGVRGHQDRQ--------KVDEIKEGEARLKSAEVDINLEDPEVEAAAVKIQAGFKGYKARK 173          

HSP 2 Score: 94.3597 bits (233), Expect = 1.630e-16
Identity = 100/282 (35.46%), Postives = 138/282 (48.94%), Query Frame = 2
Query:  395 EEAAIVIQASFRGHFERQNQKPN----------SNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNN----TDIEENTLVHSNID----EPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRK 1186
            E+AA+ IQ+SF+G   R+++  +          SN       S   ++ EEIDIDLNDPEVEKAAVKIQ+ +KG +SR+   +    + TN  NN    T   +   V   ID    +PE+                       I+ +   L   K    +    +P  P+ N   NP P        ++ IDIDL DPEV KAA+KIQSTFKG +SRK   +  T     ++E            +       +DIDLNDP+VEKAA+KIQS +KG ++RK
Sbjct:  419 EKAAVKIQSSFKGLRARKSKTASAASTSVESEPSNTTPPCPLSVKTEQQEEIDIDLNDPEVEKAAVKIQATFKGLKSRRFGAK--KSSPTNNLNNMKPVTPPVDKVPVEEEIDIDLNDPEVAKAA-----------------LKIQSTFKGLKSRKFGKNKTSQSSP--PINN--VNPTPSPPVTAPVEDEIDIDLNDPEVAKAAVKIQSTFKGLKSRKIKTKQSTQSPPSNIEPSPPPPVPVPTEEE------VDIDLNDPEVEKAALKIQSTFKGLKSRK 671          

HSP 3 Score: 89.7373 bits (221), Expect = 4.628e-15
Identity = 99/344 (28.78%), Postives = 157/344 (45.64%), Query Frame = 2
Query:  314 EQQSAAVKIQSEY-----RRFAAKKEVDTKKE----------------------------EEAAIVIQASFRG----HFERQNQKPNSNEEIDLNNSQIN-QEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDA--QTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVE--KAAIKIQSTFKGFRSRKTLEEM--QTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXX------LNDPDVEKAAVKIQSVYKGFRNRKTIK 1195
            E + AA+KIQS +     R+F AKK   T  E                            E+AA+ IQA+F+G     F  +   P+   +I      +N   +EEIDIDLNDPEVEKAAVKIQ+ +KG +SRK  +  P     Q    N+ D + + +   +ID                        + D+E +   +  S   L+        A  T +++   PK  ++  E +  +ID+   + E  +AA+KIQ+ F+G+++RK ++E     GD+++  +  EE     +       +     +      LNDP+V KAA KIQ+ +KG++ RK +K
Sbjct:  652 EVEKAALKIQSTFKGLKSRKFGAKKSSPTNIENVSPPVPPPPVTPPVKEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGSKKSSPSLVNKIPTPPPTVNIPSEEEIDIDLNDPEVEKAAVKIQATFKGLKSRKFGKSKPVAPLKQPPSSNHVDAKSSEVEEIDID----------------------LTDPDVEKAAVKIQASFKGLR--------ARKTKNQQEAAPKEAEKKTEAQEEEIDIDLNDPETAQAALKIQAGFRGYKTRKEVKENLESEGDKTEGEKPSEETKTTEEAKPEEEAKTEKTKEEPVDIDLNDPEVAKAATKIQAGFKGYKVRKDMK 965          

HSP 4 Score: 82.4185 bits (202), Expect = 8.850e-13
Identity = 108/327 (33.03%), Postives = 160/327 (48.93%), Query Frame = 2
Query:  326 AAVKIQSEYRRFAAKKEVDTKKE--------------------------EEAAIVIQASFRGHFERQNQKPN-SNEEIDLNNSQINQEDEE---------IDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIE----ENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRK 1186
            AA KIQ+ ++ +  +KE++ K+                            +AA  IQA+F+GH  R+  + N S  E D  ++ I+  D++         IDIDL+DPEVEKAA KIQ+ YKG ++R+  + I     T+      +E    E  ++  ++ +PE+           A     +++      S+T    S S   E    TP  P++   E  E            IDIDL DPEVEKAA+KIQ+TFKG +SR+     +    + +L  ++      DKV     EE IDIDLNDP+V KAA+KIQS +KG ++RK
Sbjct:  253 AATKIQAGFKGYKTRKEMNGKQPLSDKDSRTSGLDKCDTDDIDFNDPDVAKAATKIQANFKGHQVRKEIRKNQSAPETDRGHTDIHCSDDKHVMDDDNNEIDIDLSDPEVEKAATKIQAGYKGLKTRRELKSIQEPKSTSIPVRDSMENVPTEEEIIDIDLTDPEVEKA--------AVKIQSSFKGLRARKSKTASAASTSVESEPSNTTPPCPLSVKTEQQE-----------EIDIDLNDPEVEKAAVKIQATFKGLKSRRF--GAKKSSPTNNLNNMKPVTPPVDKVPV---EEEIDIDLNDPEVAKAALKIQSTFKGLKSRK 555          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A267EAR1 (RIIa domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011073g1 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.822e-47
Identity = 98/181 (54.14%), Postives = 134/181 (74.03%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            M+VP+S+T+LRVP+GFQ++LEGLAREVLR QP +IY+F A YFEEL+R R+ETG DD A L AK+EDRFYNN SF+ P  + ++ +QQ A+  IQ+ +RR AA+KE    +E++AA  IQ++ RGH ER+  K ++ E+            EE+DIDLNDPEVE AA KIQ+ +KG+++RK
Sbjct:    3 MSVPFSSTKLRVPRGFQSLLEGLAREVLRSQPADIYTFGAMYFEELIRRREETGDDDPAQLAAKVEDRFYNNTSFQQPTIDPSDPQQQDASKVIQTNFRRHAAQKEAAKLREDKAASEIQSAVRGHQEREAIKQSAPEQGSA---------EEVDIDLNDPEVEAAAAKIQAGFKGYKTRK 174          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A267EEY9 (RIIa domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023834g1 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.965e-47
Identity = 98/181 (54.14%), Postives = 134/181 (74.03%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            M+VP+S+T+LRVP+GFQ++LEGLAREVLR QP +IY+F A YFEEL+R R+ETG DD A L AK+EDRFYNN SF+ P  + ++ +QQ A+  IQ+ +RR AA+KE    +E++AA  IQ++ RGH ER+  K ++ E+            EE+DIDLNDPEVE AA KIQ+ +KG+++RK
Sbjct:    3 MSVPFSSTKLRVPRGFQSLLEGLAREVLRSQPADIYTFGAMYFEELIRRREETGDDDPAQLAAKVEDRFYNNTSFQQPTIDPSDPQQQDASKVIQTNFRRHAAQKEAAKLREDKAASEIQSAVRGHQEREAIKQSAPEQGSA---------EEVDIDLNDPEVEAAAAKIQAGFKGYKTRK 174          
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Match: A0A1I8GWL3 (RIIa domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.931e-46
Identity = 98/181 (54.14%), Postives = 134/181 (74.03%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            M+VP+S+T+LRVP+GFQ++LEGLAREVLR QP +IY+F A YFEEL+R R+ETG DD A L AK+EDRFYNN SF+ P  + ++ +QQ A+  IQ+ +RR AA+KE    +E++AA  IQ++ RGH ER+  K ++ E+            EE+DIDLNDPEVE AA KIQ+ +KG+++RK
Sbjct:    1 MSVPFSSTKLRVPRGFQSLLEGLAREVLRSQPADIYTFGAMYFEELIRRREETGDDDPAQLAAKVEDRFYNNTSFQQPTIDPSDPQQQDASKVIQTNFRRHAAQKEAAKLREDKAASEIQSAVRGHQEREAIKQSAPEQGSA---------EEVDIDLNDPEVEAAAAKIQAGFKGYKTRK 172          
BLAST of Sperm surface protein Sp17 vs. Ensembl Cavefish
Match: ENSAMXT00000046795.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:22320681:22325023:1 gene:ENSAMXG00000038900.1 transcript:ENSAMXT00000046795.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.279e-23
Identity = 46/70 (65.71%), Postives = 55/70 (78.57%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 268
            M+VP+SNT LRVP GF N+LEGLAREVLR QP++I +FAA YF  LL+ R E+G D  A  GA+LEDRFY
Sbjct:    1 MSVPFSNTNLRVPHGFGNILEGLAREVLREQPDDIPTFAAVYFTALLKQRDESGLDP-AEWGARLEDRFY 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Match: EDO46037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR24])

HSP 1 Score: 102.834 bits (255), Expect = 4.941e-26
Identity = 62/138 (44.93%), Postives = 85/138 (61.59%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKK-----EEEAAIVIQASFRGHFERQNQK 457
            MAV Y+ T+LRVP GFQN+LEGLAREVLR QP++I  FAA YF+  L +R+ETG DD     AK  +        +  + + ++ E Q AA KIQ+ +R    ++++   K     EE AA+ IQ+SFRGH  R+  K
Sbjct:    1 MAVQYAPTKLRVPPGFQNLLEGLAREVLREQPDDIVQFAAQYFKNQLSIREETGKDD-----AKRGENLEKLMKGEEVDIDIDDPEVQKAATKIQASFRGHKTREQIKQDKQQKDEEEAAALKIQSSFRGHKAREEVK 133          

HSP 2 Score: 45.4394 bits (106), Expect = 6.517e-6
Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 2
Query:  512 EEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQ 631
            EE+DID++DPEV+KAA KIQ+    FR  KT E+I  D Q
Sbjct:   71 EEVDIDIDDPEVQKAATKIQA---SFRGHKTREQIKQDKQ 107          
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Match: EDO35043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMM3])

HSP 1 Score: 73.559 bits (179), Expect = 1.043e-15
Identity = 58/173 (33.53%), Postives = 81/173 (46.82%), Query Frame = 2
Query:   83 RLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRK 601
            +L VP GF+N+LE L  E+LR +P+NI SFAAD+F E L  RQ  GYDD  LLG+++ D FY            N E  +    K +S             KK +E          GH+E    K N   +    N+   +  ++   + +    E AA KIQ+ Y G+  RK
Sbjct:    7 KLSVPSGFRNLLESLTVEILRVRPDNIPSFAADFFRERLAARQRNGYDD-CLLGSQI-DGFY------------NFEPDRPGNFKDKS-------------KKVKE---------HGHYEPARAKLNDTAD---GNNNCGESKKQTTSEDDGERCETAATKIQAGYHGYTCRK 140          
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Match: ENSORLT00000038630.1 (sperm autoantigenic protein 17 [Source:NCBI gene;Acc:105355434])

HSP 1 Score: 83.9593 bits (206), Expect = 7.572e-17
Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 268
            M+  +    LRVP+G   V+EGLAREVLR QPENI  +AA+YF  LLR R+E+G  D A   AKLEDR++
Sbjct:    1 MSAHFFTAHLRVPRGLGAVIEGLAREVLRDQPENIPEYAANYFNGLLRQREESGV-DPAAWAAKLEDRYH 69          
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Match: ENSORLT00000038228.1 (sperm autoantigenic protein 17 [Source:NCBI gene;Acc:105355434])

HSP 1 Score: 83.9593 bits (206), Expect = 8.044e-17
Identity = 39/70 (55.71%), Postives = 49/70 (70.00%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFY 268
            M+  +    LRVP+G   V+EGLAREVLR QPENI  +AA+YF  LLR R+E+G  D A   AKLEDR++
Sbjct:    1 MSAHFFTAHLRVPRGLGAVIEGLAREVLRDQPENIPEYAANYFNGLLRQREESGV-DPAAWAAKLEDRYH 69          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 291/335 (86.87%), Postives = 291/335 (86.87%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLE 1063
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKSSLKENDMDTPIAPVTNDEENP                                           EEMQTGDESQHLEIVEENLE
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDMDTPIAPVTNDEENP-------------------------------------------EEMQTGDESQHLEIVEENLE 292          

HSP 2 Score: 57.3806 bits (137), Expect = 1.691e-8
Identity = 38/82 (46.34%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  944 EKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFXXXXXXXXXLNDPDVEKAAVKIQSVYKGFRNRKT 1189
            E+AAI IQ++F+G   R+     Q  + ++ +++    + + D+         IDIDLNDP+VEKAAVKIQSVYKGFR+RKT
Sbjct:  113 EEAAIVIQASFRGHFERQN----QKPNSNEEIDLNNSQINQEDE--------EIDIDLNDPEVEKAAVKIQSVYKGFRSRKT 182          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.012e-148
Identity = 248/335 (74.03%), Postives = 248/335 (74.03%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLE 1063
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID                                           RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKSSLKENDMDTPIAPVTNDEENP                                           EEMQTGDESQHLEIVEENLE
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID-------------------------------------------RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDMDTPIAPVTNDEENP-------------------------------------------EEMQTGDESQHLEIVEENLE 249          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 435.647 bits (1119), Expect = 1.330e-147
Identity = 262/350 (74.86%), Postives = 269/350 (76.86%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXVEKAAIKIQSTFKGFRSRKT---------------LEEMQTGDESQHLEIVEENLE 1063
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID                                           RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKSSLKENDM              +P+ LQ    +EIIDIDLTDP+VEKAA+KIQS FKGF++RK                 EEMQTGDESQHLEIVEENLE
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID-------------------------------------------RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDM--------------KPEELQ--NSEEIIDIDLTDPDVEKAAVKIQSAFKGFKTRKANEDTPIAPVTNDEENPEEMQTGDESQHLEIVEENLE 291          
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Match: SMESG000046919.1 (SMESG000046919.1)

HSP 1 Score: 431.795 bits (1109), Expect = 2.651e-146
Identity = 244/334 (73.05%), Postives = 253/334 (75.75%), Query Frame = 2
Query:   59 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYXXXXXXXXXXXXXXEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQEDEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESKSSLKENDMDTPIAPVTNDEENPEPKRLQXXXXXXXXXXXXXXXXV---------------------EKAAIKIQSTFKGFRSRK 997
            MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID                                           RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDS TMLDESKSSLKENDMDTPIAPVTNDEENPE  +  +  +   I  +  +  V                     EKAA+KIQS +KG+R+RK
Sbjct:    1 MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMRQETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRRFAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEID-------------------------------------------RIPSDAQTNQHNNTDIEENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSHTMLDESKSSLKENDMDTPIAPVTNDEENPEEMQTGDESQHLEIVEENLEGPVAGGHGDYVETHEEIHLYDETSEKAAVKIQSVYKGYRTRK 291          
The following BLAST results are available for this feature:
BLAST of Sperm surface protein Sp17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPA171.486e-2346.32sperm autoantigenic protein 17 [Source:HGNC Symbol... [more]
SPA171.486e-2346.32sperm autoantigenic protein 17 [Source:HGNC Symbol... [more]
CABYR4.566e-849.02calcium binding tyrosine phosphorylation regulated... [more]
CABYR4.566e-849.02calcium binding tyrosine phosphorylation regulated... [more]
CABYR4.566e-849.02calcium binding tyrosine phosphorylation regulated... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F39H12.35.320e-1229.02pep chromosome:WBcel235:X:838144:841493:-1 gene:WB... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
igl3.206e-1044.12gene:FBgn0013467 transcript:FBtr0087362[more]
igl3.206e-1044.12gene:FBgn0013467 transcript:FBtr0332267[more]
igl2.972e-944.12gene:FBgn0013467 transcript:FBtr0087361[more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spa175.459e-2468.57sperm autoantigenic protein 17 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mettl41.257e-2039.86methyltransferase like 4 [Source:Xenbase;Acc:XB-GE... [more]
ENSXETT00000015907.15.502e-661.76pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spa175.029e-2346.27sperm autoantigenic protein 17 [Source:MGI Symbol;... [more]
Spa171.588e-2246.56sperm autoantigenic protein 17 [Source:MGI Symbol;... [more]
Cabyr5.432e-845.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
Cabyr9.086e-845.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
Cabyr1.706e-745.28calcium-binding tyrosine-(Y)-phosphorylation regul... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36425|SP17_RABIT1.329e-2848.87Sperm surface protein Sp17 OS=Oryctolagus cuniculu... [more]
sp|O19021|SP17_MACFA5.401e-2344.06Sperm surface protein Sp17 OS=Macaca fascicularis ... [more]
sp|Q15506|SP17_HUMAN7.136e-2346.32Sperm surface protein Sp17 OS=Homo sapiens OX=9606... [more]
sp|Q95230|SP17_PAPHA1.063e-2242.86Sperm surface protein Sp17 OS=Papio hamadryas OX=9... [more]
sp|Q62252|SP17_MOUSE3.517e-2246.27Sperm surface protein Sp17 OS=Mus musculus OX=1009... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PZL43.263e-5639.90Sperm surface protein Sp17 OS=Crassostrea gigas OX... [more]
A0A210PVC94.443e-5257.69Sperm surface protein Sp17 OS=Mizuhopecten yessoen... [more]
A0A267EAR11.822e-4754.14RIIa domain-containing protein (Fragment) OS=Macro... [more]
A0A267EEY94.965e-4754.14RIIa domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8GWL33.931e-4654.14RIIa domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000046795.11.279e-2365.71pep primary_assembly:Astyanax_mexicanus-2.0:2:2232... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO460374.941e-2644.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350431.043e-1533.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000038630.17.572e-1755.71sperm autoantigenic protein 17 [Source:NCBI gene;A... [more]
ENSORLT00000038228.18.044e-1755.71sperm autoantigenic protein 17 [Source:NCBI gene;A... [more]
back to top
BLAST of Sperm surface protein Sp17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000046919.11.691e-886.87SMESG000046919.1[more]
SMESG000046919.12.012e-14874.03SMESG000046919.1[more]
SMESG000046919.11.330e-14774.86SMESG000046919.1[more]
SMESG000046919.12.651e-14673.05SMESG000046919.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034016 ID=SMED30034016|Name=Sperm surface protein Sp17|organism=Schmidtea mediterranea sexual|type=transcript|length=1425bp
CGTAAATTAATATCGAAAATTTTGTTGATTACTTATTAAAAGATTTTTAT
AATTAAATATGGCAGTTCCATATTCAAACACAAGATTAAGAGTGCCAAAA
GGTTTTCAAAATGTGTTAGAAGGTCTTGCACGTGAAGTCTTAAGATGCCA
ACCAGAAAATATTTATAGTTTTGCTGCTGATTATTTTGAAGAGTTATTAA
GAATGCGTCAAGAAACTGGTTATGACGATATAGCACTGTTAGGAGCGAAA
TTAGAAGACAGATTTTATAATAATCATAGTTTTAAAAATCCTAATACAAA
TACAAATAATGAAGAACAACAATCGGCTGCTGTTAAAATTCAATCGGAAT
ACCGTCGATTTGCCGCGAAAAAAGAAGTCGATACGAAGAAAGAAGAAGAG
GCTGCAATCGTTATACAAGCTTCATTCAGAGGGCATTTTGAAAGGCAGAA
CCAAAAACCAAATTCAAATGAAGAAATTGATTTAAATAATTCCCAAATTA
ATCAAGAAGATGAGGAAATTGACATCGACCTCAATGATCCGGAAGTCGAG
AAAGCCGCTGTTAAAATCCAGTCCGTTTATAAAGGTTTTCGAAGCCGTAA
AACGACAGAGAGAATTCCTTCCGATGCTCAAACTAATCAGCACAATAATA
CAGATATAGAAGAAAATACATTGGTACATTCAAACATTGATGAGCCAGAA
ATTATGGATAAACATGAATCTGAAGATCTTCCTCCGGCACATGGTGAAAA
TCAAAATTATCAAGAATATGATATAGAAGACTCTCAAACTATGCTCGACG
AATCTAAATCAAGTCTCAAAGAAAACGACATGGATACTCCAATAGCTCCG
GTAACTAACGATGAAGAAAATCCTGAGCCTAAAAGACTTCAAGAAATAAA
AGAAGATGAAATAATTGATATAGATTTAACCGATCCAGAGGTTGAGAAGG
CAGCAATAAAAATACAGTCGACATTTAAAGGTTTTCGAAGTCGAAAGACA
TTAGAGGAAATGCAAACTGGAGATGAATCTCAACATCTTGAAATAGTCGA
GGAAAATCTTGAAAAAAGTGATAAAGTTAAAGCATTCATCGATGAAGAGA
TCATTGATATAGATCTGAACGATCCTGACGTAGAGAAAGCAGCTGTCAAA
ATACAATCGGTTTATAAAGGTTTTCGAAATCGTAAAACTATTAAGGTTTG
AGCAGTAAAAGTATCATAGTATGTTATGCATCCGATCTGTGGGAGCACAA
GTGAAATTTGATTGATGTTTGTCTTAGATGTTAGAGATAAATTTTTATGA
TTATATATATAATTTCACCTTTTTTTACTTTATATTCTGAAATAATATAT
TTATCAATAGTGTAATATAAAAGTGCATGAGTAATTATTTTTTATTGAAT
TTTATTCTTTTTCATATCTTTCTGC
back to top

protein sequence of SMED30034016-orf-1

>SMED30034016-orf-1 ID=SMED30034016-orf-1|Name=SMED30034016-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MAVPYSNTRLRVPKGFQNVLEGLAREVLRCQPENIYSFAADYFEELLRMR
QETGYDDIALLGAKLEDRFYNNHSFKNPNTNTNNEEQQSAAVKIQSEYRR
FAAKKEVDTKKEEEAAIVIQASFRGHFERQNQKPNSNEEIDLNNSQINQE
DEEIDIDLNDPEVEKAAVKIQSVYKGFRSRKTTERIPSDAQTNQHNNTDI
EENTLVHSNIDEPEIMDKHESEDLPPAHGENQNYQEYDIEDSQTMLDESK
SSLKENDMDTPIAPVTNDEENPEPKRLQEIKEDEIIDIDLTDPEVEKAAI
KIQSTFKGFRSRKTLEEMQTGDESQHLEIVEENLEKSDKVKAFIDEEIID
IDLNDPDVEKAAVKIQSVYKGFRNRKTIKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000048IQ_motif_EF-hand-BS
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007339binding of sperm to zona pellucida
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainSMARTSM00394akam_3coord: 14..51
e-value: 4.1E-13
score: 59.6
IPR003117cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domainPFAMPF02197RIIacoord: 14..50
e-value: 4.0E-14
score: 52.0
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 357..379
e-value: 0.12
score: 21.5
coord: 294..316
e-value: 0.027
score: 23.6
coord: 111..133
e-value: 3.3E-4
score: 30.0
coord: 162..184
e-value: 0.25
score: 20.4
coord: 86..108
e-value: 0.9
score: 18.6
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 164..181
e-value: 5.5E-4
score: 19.5
coord: 359..377
e-value: 0.0011
score: 18.5
coord: 89..106
e-value: 0.035
score: 13.9
coord: 296..314
e-value: 4.5E-4
score: 19.8
coord: 114..131
e-value: 0.0021
score: 17.7
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 164..192
score: 8.297
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 296..324
score: 9.359
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 359..380
score: 8.773
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 87..116
score: 7.821
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 112..141
score: 9.304
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 8..51
e-value: 3.2E-14
score: 54.0
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 294..378
e-value: 3.0E-9
score: 38.5
coord: 87..131
e-value: 1.5E-12
score: 49.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 186..204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 177..204
NoneNo IPR availablePANTHERPTHR10699NEUROMODULINcoord: 337..379
coord: 266..323
coord: 108..222
coord: 1..93
NoneNo IPR availableCDDcd12100DD_CABYR_SP17coord: 12..50
e-value: 5.06886E-19
score: 77.6609
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 8..50