Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30033999
Length (bp)785
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30033999) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30033999) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033999

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033999 Contig7687newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033999 Contig7687uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033999 Contig6342newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033999 Contig6342uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
reproductive organSMED30033999 Contig18734newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033999 Contig18734uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 72.4034 bits (176), Expect = 8.086e-14
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +KK  ++  K+EKS  H      WR  E         D L +     +I+     LK  ++  LFL ++ L  RG+   +   N GNFL +LE+  R     E   +++  SQ++       Y S  IQ++ I      +   I+ E      +S+I D T  SA  EQ +  +RY      S    IKERFL FV+  + TG  +   I   L++  + + +   Q YD+ +N+
Sbjct:  503 WKKTLEKFRKHEKSEMHLKSLEFWR--EYQFCDGAVSDDLSIHS--KQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEM--RAKDKGEETFRLM-NSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYP--QKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNL 722          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 72.4034 bits (176), Expect = 8.086e-14
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +KK  ++  K+EKS  H      WR  E         D L +     +I+     LK  ++  LFL ++ L  RG+   +   N GNFL +LE+  R     E   +++  SQ++       Y S  IQ++ I      +   I+ E      +S+I D T  SA  EQ +  +RY      S    IKERFL FV+  + TG  +   I   L++  + + +   Q YD+ +N+
Sbjct:  503 WKKTLEKFRKHEKSEMHLKSLEFWR--EYQFCDGAVSDDLSIHS--KQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEM--RAKDKGEETFRLM-NSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYP--QKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNL 722          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 72.4034 bits (176), Expect = 8.086e-14
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +KK  ++  K+EKS  H      WR  E         D L +     +I+     LK  ++  LFL ++ L  RG+   +   N GNFL +LE+  R     E   +++  SQ++       Y S  IQ++ I      +   I+ E      +S+I D T  SA  EQ +  +RY      S    IKERFL FV+  + TG  +   I   L++  + + +   Q YD+ +N+
Sbjct:  503 WKKTLEKFRKHEKSEMHLKSLEFWR--EYQFCDGAVSDDLSIHS--KQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEM--RAKDKGEETFRLM-NSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYP--QKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNL 722          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 72.4034 bits (176), Expect = 8.086e-14
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +KK  ++  K+EKS  H      WR  E         D L +     +I+     LK  ++  LFL ++ L  RG+   +   N GNFL +LE+  R     E   +++  SQ++       Y S  IQ++ I      +   I+ E      +S+I D T  SA  EQ +  +RY      S    IKERFL FV+  + TG  +   I   L++  + + +   Q YD+ +N+
Sbjct:  503 WKKTLEKFRKHEKSEMHLKSLEFWR--EYQFCDGAVSDDLSIHS--KQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEM--RAKDKGEETFRLM-NSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYP--QKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNL 722          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 118.242 bits (295), Expect = 1.339e-29
Identity = 56/181 (30.94%), Postives = 104/181 (57.46%), Query Frame = 2
Query:  242 LLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +L R +D++L+LA +G AFRG       AN GNF+ +++ +++YD +++ HL  +++ Q   ++ QV  LS   QN+ I     ++ + I  E +  + +S+++D T + +H EQ +F++RYV       + E+KERFL        TG+++ N+++  L+   + +   R Q YD  +NM
Sbjct:  306 ILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYVR------DMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAANM 480          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 2.335e-37
Identity = 80/235 (34.04%), Postives = 130/235 (55.32%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +K    R+ ++E+S  HK CY++ +   + IS    ID L +++   E++ W ++LKR +     L+ RGL FRG+    G   NGN+L +LE ++ +DP L  H+K    +          YLS  +  EFI   A  +   I+ E +  KYYS+ VD+TP+ +H +Q  FI+ YV      ++   KERF+ F+       E++ + +++TL++Y+I I +CR Q YDN SNM
Sbjct:  102 WKNASVRLNEHEESKFHKDCYLRMQN-RAKISGR--IDQLFLEKQNQEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTG----STSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYV-----KNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNM 324          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 55.8398 bits (133), Expect = 2.414e-8
Identity = 53/243 (21.81%), Postives = 100/243 (41.15%), Query Frame = 2
Query:   68 PDRGYKKLYDRIPKYEKSTHHKSCY---IQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILEL-VSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            P   Y+  ++   K+  +T HK  Y     +  V S+    ++I C +   +++++++    L   L   +F     +A RG +     + +GN   + +  +   D +L+ HLK           +   Y S  ++NE I                 +  +SVI D + + +  EQ +  +R+V +       +I+E FL F          IAN+I+E   K+ + + +   Q YD  S M
Sbjct:   70 PFLKYRDFHNSARKHSLTTCHKQAYDDATNFINVRSH--PEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKT-----STSGNVQALFDFCIESGDEILKNHLK--------NAPVNARYTSVRVENELI----------------VLSGFSVIADESADISGHEQLSLGVRFVDLT--ITPVKIREEFLGFATLKAVDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTM 279          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000005329.1 (uncharacterized LOC100494784 [Source:NCBI gene;Acc:100494784])

HSP 1 Score: 51.2174 bits (121), Expect = 9.691e-7
Identity = 53/235 (22.55%), Postives = 112/235 (47.66%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRE-RETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSN 781
            +KK  ++   ++KS  H+  +  W+ + +  ++ R       +++R  I   +  L + +    FL  RG  F+  SH   ++   +   +L+ V + + +    L +  Q          ++ S ++Q E IS  +  + + I ++  +   YYSVIVD   ++   +Q +  LRY+       E + +E F+ F++  ++TG   ANLIL+ L++ ++PI   R   ++  ++
Sbjct:  240 WKKAREKFGYHQKSKSHE--FATWKLMHALQNQKREAALEQQRKVRQAIP--SICLNKLICAVRFLIHRGHTFQ--SH---ESIEESLFELLKFVGQDNEMFRYWL-LTNQ----------NFTSTEVQYEIISLMSHEIISLITKDVNQGSVYYSVIVDCI-QNTDSQQLSLCLRYLD-----SEMQAQEEFIGFLDPVEETGTSAANLILDILDRNSLPIDLLRGIAFEASTS 448          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 48.9062 bits (115), Expect = 4.600e-6
Identity = 44/202 (21.78%), Postives = 82/202 (40.59%), Query Frame = 2
Query:  182 RTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILEL-VSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            ++I C +   +++++++    L   L   +F     +A RG +     + +GN   + +  +   D +L+ HLK    + +                     C D L   I+        +SVI D + + +  EQ +  +R+V +       +I+E FL F          IAN+I+E   K+ + I +   Q YD  S M
Sbjct:   55 QSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKT-----STSGNVQALYDFRIESGDEILKNHLKNAPVNAL--------------------LCEDILRERIISAANNSVGFSVIADESADISGHEQLSLGVRFVDLT--ITPVKIREEFLGFATLKAFDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTM 229          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 57.7658 bits (138), Expect = 5.234e-9
Identity = 63/265 (23.77%), Postives = 106/265 (40.00%), Query Frame = 2
Query:    2 CRLFYNFR-EDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSR----YDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSN 781
            C LF+  +   +R   AT    Q    ++K+     K+E+S  H      WR  +        I C        +I+     L+  ++  LFL ++ L  +G+   +   N G+FL +LEL +R       L+ +H+                Y S  +Q E I    D +   I+ E      +S+I +    SA   Q +  +RY           +KERFL FV   + TG  +   I   L++  +  ++   Q YD+ +N
Sbjct:  322 CYLFFQKKFSCRREAFAT----QGTADWEKMLGNFRKHEESDVHLKSLQFWRQYQFL----DAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVDF--------------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYP--QKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATN 562          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 57.7658 bits (138), Expect = 5.234e-9
Identity = 63/265 (23.77%), Postives = 106/265 (40.00%), Query Frame = 2
Query:    2 CRLFYNFR-EDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSR----YDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSN 781
            C LF+  +   +R   AT    Q    ++K+     K+E+S  H      WR  +        I C        +I+     L+  ++  LFL ++ L  +G+   +   N G+FL +LEL +R       L+ +H+                Y S  +Q E I    D +   I+ E      +S+I +    SA   Q +  +RY           +KERFL FV   + TG  +   I   L++  +  ++   Q YD+ +N
Sbjct:  322 CYLFFQKKFSCRREAFAT----QGTADWEKMLGNFRKHEESDVHLKSLQFWRQYQFL----DAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVDF--------------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYP--QKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATN 562          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 56.6102 bits (135), Expect = 1.057e-8
Identity = 60/254 (23.62%), Postives = 101/254 (39.76%), Query Frame = 2
Query:   32 QRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSR----YDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSN 781
            +R   AT    Q    ++K+     K+E+S  H      WR  +        I C        +I+     L+  ++  LFL ++ L  +G+   +   N G+FL +LEL +R       L+ +H+                Y S  +Q E I    D +   I+ E      +S+I +    SA   Q +  +RY           +KERFL FV   + TG  +   I   L++  +  ++   Q YD+ +N
Sbjct:  235 RREAFAT----QGTADWEKMLGNFRKHEESDVHLKSLQFWRQYQFL----DAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRARDRGEVFQLMSSHVDF--------------YSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYP--QKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDFNKICGQAYDSATN 464          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.883e-13
Identity = 66/235 (28.09%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +KK  ++  K+EKS  H      WR  E         D L +     +I+     LK  ++  LFL ++ L  RG+   +   N GNFL +LE+  R     E   +++  SQ++       Y S  IQ++ I      +   I+ E      +S+I D T  SA  EQ +  +RY      S    IKERFL FV+  + TG  +   I   L++  + + +   Q YD+ +N+
Sbjct:  503 WKKTLEKFRKHEKSEMHLKSLEFWR--EYQFCDGAVSDDLSIHS--KQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEM--RAKDKGEETFRLM-NSQVD------FYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYP--QKSSKAILIKERFLGFVDTEEMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNL 722          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A1S3T8U7 (uncharacterized protein LOC106752924 OS=Vigna radiata var. radiata OX=3916 GN=LOC106752924 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.098e-73
Identity = 117/248 (47.18%), Postives = 165/248 (66.53%), Query Frame = 2
Query:   35 RSVLATELGWQPDRG-YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQ--VHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYD 769
            RS LA   G+ P++  +KKLYDR+P +E ++ H++CY +W++++ ++S  + +D  L +Q + E +KW  +L+R LDVTLFLA RGL F+G S LIGD +NGNFLG LEL+ +YD ++  HL  +K  Q++   +Q   HYLS   QNEFIS C D +   IL ER    YY +I DATP+ + IEQ   ILRYV  N  ++++E+ ERFL F++ N K GEDI   IL  LE+  IP+ +CRAQ YD
Sbjct:   16 RSDLAKRKGFCPEKTLWKKLYDRLPSHESTSEHRNCYTEWKSLKCSLS-GKGLDSELRKQEKCEAEKWKAILRRILDVTLFLASRGLPFQGDSTLIGDVHNGNFLGTLELMGKYDEVIREHLAKIKAKQLDGGNMQGQAHYLSWKSQNEFISLCGDKVLEAILDERLKTIYYGIIADATPDISKIEQNVLILRYVFKNGCTEKFEVCERFLKFIDFNDKKGEDITLKILSALEELKIPLEDCRAQGYD 262          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A1B6I4X1 (DUF4371 domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.57005 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.161e-69
Identity = 102/184 (55.43%), Postives = 135/184 (73.37%), Query Frame = 2
Query:  233 WTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            W D+ +R L V +FL ERGLA RG+S  IGD NNGNFLG++EL++ YDPLL  H+  VK++Q E +R+Q HYLS D QNEFI  C + +   +L ER+  KYY++I D+TP+++H EQTT ILRY+   +   E++I ERFL FV+CNKKTG D+A LI+  L K++IP+ ECR Q YDNGSNM
Sbjct:    1 WRDIFQRLLSVVMFLGERGLALRGTSEKIGDPNNGNFLGLIELLAEYDPLLREHIAKVKKAQEEGKRVQAHYLSKDSQNEFIQVCGERVRQKVLEERKKSKYYAIIADSTPDASHTEQTTLILRYLL--DCESEFKICERFLNFVDCNKKTGMDVAKLIISELNKHSIPLKECRGQGYDNGSNM 182          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A3B1IJ48 (Uncharacterized protein OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 8.028e-64
Identity = 116/268 (43.28%), Postives = 173/268 (64.55%), Query Frame = 2
Query:    2 CRLF-YNFREDQRSVLATELGWQ-PDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDE-----YEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C LF +      +S L ++ G +  D  ++K+Y + P++EK T HK CY++W++++ ++     +D  L +Q++ E +K T +L+R LDVTL LA R LAFRG +  + D +NGNFLG LEL++ YDP +  HL+ VKQ + +  RL  HYLS D QNEFI  C   + + IL+ERE   YYSVI D+TP+ +H EQ   ++RYV    H D+     ++I ERF+ F + +KKTG++I+ +I+E L+   IP+ ECR Q YDNG+NM
Sbjct:  107 CLLFSHEQTRPSKSALNSKDGLKLSDIKWQKMYRKFPEHEKHTPHKQCYVKWKSLQHSLLVATGVDGHLQKQLQTEAEKHTKILERLLDVTLHLASRNLAFRGKTSNLDDVHNGNFLGTLELLAHYDPFIHEHLEKVKQKK-KGSRL-THYLSPDTQNEFIELCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYV----HQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGANM 368          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A164HKP6 (Putative 52 kDa repressor of the inhibitor of the protein kinase (Fragment) OS=Daphnia magna OX=35525 GN=APZ42_003374 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 9.881e-64
Identity = 103/236 (43.64%), Postives = 153/236 (64.83%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRG-SSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            ++KLYDR+  ++ S  H+  Y+ W+T  ++++ +  ID  L + I  E+ KW ++L+  LDVTLFLA R LAFRG SS +I +  NGNF+G L+++S+++ +++ HL+ V + Q E  R+Q HYLS   QNEFI  CA  +   +L+E +   YY++I D TP+ +H EQ TF+LR+V       ++EI+ERFL   +  KK G DIANLI + L +  I +  CR Q YDNGSNM
Sbjct:  103 WRKLYDRVSSHQGSQIHQKYYLDWKTCLASLADHTGIDSSLQKAITAEVAKWREILRGILDVTLFLASRNLAFRGQSSSVIDEQGNGNFIGALQMISKHNHVIKHHLENVARHQQEGSRMQAHYLSWQSQNEFIKECASIVKESVLKEIKASIYYTIITDGTPDESHTEQITFVLRFVFFKTDEKKWEIRERFLGVEDMEKKKGVDIANLIFDVLAREKIDLQNCRGQGYDNGSNM 338          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A3N0Y6Q5 (Zinc finger MYM-type protein 1 OS=Anabarilius grahami OX=495550 GN=DPX16_3497 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.569e-63
Identity = 115/267 (43.07%), Postives = 175/267 (65.54%), Query Frame = 2
Query:    2 CRLFYNFREDQR-SVLATELGWQP-DRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMV---KQSQIE-KQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C LF + ++    S LA++ G++     ++ +Y+++P +E+S  H+ CY++W+ ++ ++ +++ ID LL ++ + EI+K   +L++ LDVTL LA R L FRG +  + D +NGNFLG LEL+S YDPLL+ H + +   KQ + E KQ    HYLS++ QNEFI+ C   +   IL+ERE   YY+VI DATP+ +H EQ   +LRYV  +   DE+EI ERFL F +  KKTG +IA +I   L ++ I +S+CR Q YDNG+NM
Sbjct:  175 CVLFSSIQKKPSCSALASQNGFKMCHVKWRHMYNKLPIHERSDAHRDCYLRWKNLQRSVLQDKGIDSLLNREFQTEIEKNRAILEKLLDVTLHLASRNLPFRGKTSDLDDVHNGNFLGTLELLSHYDPLLKEHFQKIRDNKQKKKEGKQTRLTHYLSSESQNEFINLCGRRVLKRILQEREDAIYYAVIADATPDISHTEQNVVVLRYVKYDKEKDEWEITERFLEFKDFYKKTGSEIAKMIESVLCEHGIDVSDCRGQGYDNGANM 441          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 3.041e-67
Identity = 116/268 (43.28%), Postives = 173/268 (64.55%), Query Frame = 2
Query:    2 CRLF-YNFREDQRSVLATELGWQ-PDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDE-----YEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C LF +      +S L ++ G +  D  ++K+Y + P++EK T HK CY++W++++ ++     +D  L +Q++ E +K T +L+R LDVTL LA R LAFRG +  + D +NGNFLG LEL++ YDP +  HL+ VKQ + +  RL  HYLS D QNEFI  C   + + IL+ERE   YYSVI D+TP+ +H EQ   ++RYV    H D+     ++I ERF+ F + +KKTG++I+ +I+E L+   IP+ ECR Q YDNG+NM
Sbjct:  107 CLLFSHEQTRPSKSALNSKDGLKLSDIKWQKMYRKFPEHEKHTPHKQCYVKWKSLQHSLLVATGVDGHLQKQLQTEAEKHTKILERLLDVTLHLASRNLAFRGKTSNLDDVHNGNFLGTLELLAHYDPFIHEHLEKVKQKK-KGSRL-THYLSPDTQNEFIELCGKRVLSTILKEREDAIYYSVICDSTPDISHTEQNVILVRYV----HQDKEDRGVWKIVERFIEFKDFHKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGANM 368          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.022 bits (445), Expect = 1.472e-50
Identity = 93/230 (40.43%), Postives = 135/230 (58.70%), Query Frame = 2
Query:   95 DRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +RI ++E S  H++C +         +   TID  +V+QI  E Q W ++LKR + V  FL ERGLAFRG   L+G A+NGNFLGI+EL++++DP L  HL+        K +  V YLS+ +  EFI          I+ E +  KY+SVIVD+TP+ AH++Q TFI R+V+ + H     + ERFLAF      +G+ +A  ++  +E   + +S CR Q YDN SNM
Sbjct:   78 ERIGEHEGSVEHRACMLALYNRSRGTA---TIDSDIVKQIDAERQYWREVLKRVVAVIQFLGERGLAFRGDDELLGSAHNGNFLGIIELLAKFDPFLAEHLQRFGG----KGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNEIKESKYFSVIVDSTPDLAHVDQLTFIFRFVNNDGH-----VVERFLAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNM 295          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 4.766e-45
Identity = 91/233 (39.06%), Postives = 133/233 (57.08%), Query Frame = 2
Query:   86 KLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            K  +RI ++E S  H++C +    + +      TID  +V+QI  E Q W D+LKR + V  FL ERGL       L+G A+NGNFLGI+EL+S++DP L  HL+        K +  V YLS+ +  EFI          I+ + +  KY+SVIVD+TP+ AH++Q TFI R+V+ + H     + ERFLAF      +G+ +A  ++  +E   + +S CR Q YDN SNM
Sbjct:  239 KHSERIGEHEGSVEHRACML---ALYNRSRGTATIDSDIVKQIDAERQYWRDVLKRVVAVIQFLGERGL-----DELLGSAHNGNFLGIIELLSKFDPFLAEHLQRFGG----KGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNKIKESKYFSVIVDSTPDLAHVDQPTFIFRFVNNDAH-----VVERFLAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNM 454          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.614 bits (405), Expect = 1.683e-44
Identity = 83/226 (36.73%), Postives = 133/226 (58.85%), Query Frame = 2
Query:  110 YEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFIS-CCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +E S  H  C +QWR ++  + KN  ID   +  +  E ++W D+LKR   +TL LA R L FRGSS  +   +NGNFL  +EL++++D + E H+     ++I+    + HYL    QNE I   C+  + T + + ++  KYY++I+D TP+ +H EQ + ++R V +     E  I+E FL ++N  + TG +++N++LE L    IP  +CR Q YDNG+NM
Sbjct:  195 HEGSPDHTKCMLQWRELDRRLRKNLAIDQQELSLMEAERKRWHDVLKRLFSITLSLATRNLPFRGSSQSLYVQDNGNFLKEVELLAQFDSVTEGHV-----ARIKDDASRTHYLGQQTQNEIIEIICSQTIQTIVAKIKQ-AKYYAIILDCTPDISHKEQMSLVVRIVEL---VPEPHIREYFLGYMNVVETTGLNLSNVVLEKLRALGIPFEDCRGQAYDNGANM 411          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 6.644e-44
Identity = 82/235 (34.89%), Postives = 135/235 (57.45%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            +K L   + ++E S  H      W  ++  +    TID      ++ EI+ W  +++R + +   LAER  A RG++  + D +NGNFL  +EL++++DP++  H++     +I+ Q  +VHYLS  IQNE I+   + +   I+R  +  KYYSVI+D TP+ +H EQ + +LR V   N      I E F  F++    +G+ +  ++L+ L+K+N+ IS+CR Q YDNGSNM
Sbjct:  159 WKNLTYHLKEHEYSKGHCDNMRNWHELQRRLQNKTTIDQRQQALMQIEIEHWKAVIRRVIAIICHLAERNQALRGTTSELYDPHNGNFLAQVELMAKFDPVMNEHIR-----RIQNQEAKVHYLSGTIQNEIIALIGNKVLEEIVRRAQRAKYYSVIMDCTPDISHKEQLSVVLRLV---NCDPSVSIAEHFFGFIDVEDTSGKGLTEVLLDHLQKHNLSISDCRGQSYDNGSNM 385          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 144.436 bits (363), Expect = 9.753e-39
Identity = 81/261 (31.03%), Postives = 140/261 (53.64%), Query Frame = 2
Query:    2 CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C+LF N     +++  T  G      +K     +  +EKS  H +C   W+ +   I   +TID   +  +  E  +W  +L R + +   LA R LA RG +  +  ++NGNFL  +EL++R+DP+++ HL  V +           Y+   +QNE I   +  + + I+ + +  KY+S+I+D T + +H EQ + I+R VS+    ++ +I+E F+ F+   + TG+ +A++IL  LE+  I   +CR Q YDNG+NM
Sbjct:  198 CKLFSN-----KNINLTTSG---TANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHN----SYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANM 443          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 144.436 bits (363), Expect = 9.753e-39
Identity = 81/261 (31.03%), Postives = 140/261 (53.64%), Query Frame = 2
Query:    2 CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C+LF N     +++  T  G      +K     +  +EKS  H +C   W+ +   I   +TID   +  +  E  +W  +L R + +   LA R LA RG +  +  ++NGNFL  +EL++R+DP+++ HL  V +           Y+   +QNE I   +  + + I+ + +  KY+S+I+D T + +H EQ + I+R VS+    ++ +I+E F+ F+   + TG+ +A++IL  LE+  I   +CR Q YDNG+NM
Sbjct:  198 CKLFSN-----KNINLTTSG---TANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHN----SYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANM 443          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 144.436 bits (363), Expect = 9.753e-39
Identity = 81/261 (31.03%), Postives = 140/261 (53.64%), Query Frame = 2
Query:    2 CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C+LF N     +++  T  G      +K     +  +EKS  H +C   W+ +   I   +TID   +  +  E  +W  +L R + +   LA R LA RG +  +  ++NGNFL  +EL++R+DP+++ HL  V +           Y+   +QNE I   +  + + I+ + +  KY+S+I+D T + +H EQ + I+R VS+    ++ +I+E F+ F+   + TG+ +A++IL  LE+  I   +CR Q YDNG+NM
Sbjct:  198 CKLFSN-----KNINLTTSG---TANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHN----SYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSL---MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANM 443          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 5.529e-15
Identity = 65/262 (24.81%), Postives = 117/262 (44.66%), Query Frame = 2
Query:    2 CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPI-SECRAQRYDNGSNM 784
            CR F        SVL +E G++  +        +  + +S  H +  + W   E + S   ++   L  +    +++  + +K   +  L  A + +A RG      D+  GNFL I+EL+++ +P+++   KM  Q            L  D QNE I C A+ + + I  E    + +S++VD T + +  EQ +F++RY    +      + E FLAF    +     ++  I+E L+K+ +   +    Q YD  S M
Sbjct:  145 CRHF-GLPASGESVLTSEEGFKNWKKATFKDGGLLGHARSEAHTTAMLAWAEYEKSTSGTASLSASLDAEYSKLVKENREYIKVVGETLLLTATQNIAQRGHKESEVDSK-GNFLAIMELLAKNNPIVKR--KMAGQRN-------ATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYYYNGS------VCECFLAFEAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVM 389          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 72.4034 bits (176), Expect = 4.567e-14
Identity = 50/173 (28.90%), Postives = 90/173 (52.02%), Query Frame = 2
Query:  209 QIRNE-IQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNC-NKKTGEDIANLILETL 721
            ++ NE ++K  ++LKR +D  LFL ++ L+FRG     G +N GN+  +L +++  +  L  HL   +              S  IQ++ IS   + +   I RE +   + SV+V+ T ++++  Q    LRYV+ +       +KERF+ F +  + K  +DIA L+++ L
Sbjct:  142 ELHNEKVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSVIAESNTDLHYHLSTNE---------AFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTRSG------VKERFVRFEDVTSGKRADDIAGLVIKFL 299          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000060573.1 (SMESG000060573.1)

HSP 1 Score: 156.377 bits (394), Expect = 1.802e-44
Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 2
Query:  542 SVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            S   DATP+SAHIEQTTFILRYVSVN+HSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPIS+CRAQ YDNGSNM
Sbjct:   74 SPTADATPDSAHIEQTTFILRYVSVNSHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISKCRAQGYDNGSNM 154          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000069312.1 (SMESG000069312.1)

HSP 1 Score: 155.606 bits (392), Expect = 2.746e-43
Identity = 94/265 (35.47%), Postives = 141/265 (53.21%), Query Frame = 2
Query:    2 CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIG---DANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFI-LRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            C LF     +QRS L    G+   R  +K+      +E S  H++ +  W+  E  I   + ID  L  Q++NE QKW D+LKR L    FLA + LA RG +  +     +N GNFL  L+L++ YDPLL  H+   +Q+        V YLS   QNE IS  A  +   +L + +  KYY ++ D+TP+ AH E  + + +RYV+V   +    IKE FL F+  + K    + ++I +TLE  N+ + +CR+Q YDN + M
Sbjct:  193 CLLFPKSINNQRSGLTLPEGFNKLRKPEKM----SAHENSPTHRASFTAWKEAERRIMSGKGIDAELQAQMQNEKQKWRDVLKRLLSCVKFLASQNLALRGHAESLATNNSSNVGNFLATLKLLAEYDPLLSNHIDHARQNPG-----SVSYLSPQTQNESISLLASKVRNKLLNDIKRNKYYGILFDSTPDQAHRELLSRVSMRYVNVYFSNKTVTIKESFLGFIELHAKDAATLEHVIADTLEADNLRLDDCRSQCYDNAALM 448          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000036749.1 (SMESG000036749.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.118e-41
Identity = 77/200 (38.50%), Postives = 120/200 (60.00%), Query Frame = 2
Query:  185 TIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            TID  + +    E ++W  ++KR + +  FLA + LAFRGSS  + + NNGNFL  +E++ ++D ++  H+K V++    K R+  HYL    QNE I+  A  +   IL   +  KY+SVI+D TP++ H+EQ T ++RYV + N+  E E++E F+ F    K TGE   + +++ L    + IS+ R Q YDNGSNM
Sbjct:  160 TIDKNMQRYYDAEKKRWCQIIKRMISMVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMP-HYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKNY--EVEVRENFIGFYQAKKCTGESFYDFLIQKLNYIELNISDMRGQGYDNGSNM 356          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000047334.1 (SMESG000047334.1)

HSP 1 Score: 145.976 bits (367), Expect = 2.000e-39
Identity = 80/235 (34.04%), Postives = 129/235 (54.89%), Query Frame = 2
Query:   80 YKKLYDRIPKYEKSTHHKSCYIQWRTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSNM 784
            ++ + D + ++EK+T H   Y  W+ +E N+ +  TID  + +    E ++W  ++KR + V  FLA + LAFRGSS ++ + NNGNFL  +E++ ++D ++  H+K V++    K R+  HYL    QNE I+  A  +   IL   +  KY+SVI+D TP++ H+EQ T ++RYV + N    YE++  +L                         + IS+ R Q YDNGSNM
Sbjct:  326 WQHISDNLSRHEKTTLHIENYTCWKKLELNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGILYEKNNGNFLKAIEMIGKFDDIMADHIKRVQEPNAPKNRMP-HYLGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQITMVIRYVHIKN----YEVELNYL------------------------ELNISDMRGQGYDNGSNM 531          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000067268.1 (SMESG000067268.1)

HSP 1 Score: 134.035 bits (336), Expect = 1.706e-38
Identity = 79/210 (37.62%), Postives = 113/210 (53.81%), Query Frame = 2
Query:  170 ISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFRGSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYLSADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFILRYV------SVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISECRAQRYDNGSN 781
            IS ++ +DCL  +    E++ W ++LKR +   L +A   +AFRGS   +   NNG F  ++EL SR+DP LE  +K V ++       + HYL  +IQ E I   A      IL   +   Y+SVIVD TP+++H EQ + +LRY+       VNN S   EIKE FL F+N    TG  +   IL  L++  + I     Q YDNG+N
Sbjct:    3 ISSDQAVDCLANKLYLIEVEHWDEVLKRIMSFILMMASENIAFRGSLERLFTENNGKFFKLVELFSRFDPELEKDVKRVAENP-----QKTHYLGKNIQQEIILLLAKATKHNILEMVKNAMYFSVIVDCTPDASHKEQISIVLRYIHITKSTEVNNAS--VEIKESFLEFINILDSTGAKMTEEILNFLKQNGLSIMNLCGQGYDNGAN 205          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ZMYM18.086e-1428.09zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.086e-1428.09zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.086e-1428.09zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.086e-1428.09zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.11.339e-2930.94pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000043220.12.335e-3734.04pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
slc10a62.414e-821.81solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000005329.19.691e-722.55uncharacterized LOC100494784 [Source:NCBI gene;Acc... [more]
tbx184.600e-621.78T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym15.234e-923.77zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym15.234e-923.77zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym11.057e-823.62zinc finger, MYM domain containing 1 [Source:MGI S... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5SVZ6|ZMYM1_HUMAN3.883e-1328.09Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3T8U72.098e-7347.18uncharacterized protein LOC106752924 OS=Vigna radi... [more]
A0A1B6I4X11.161e-6955.43DUF4371 domain-containing protein (Fragment) OS=Ho... [more]
A0A3B1IJ488.028e-6443.28Uncharacterized protein OS=Astyanax mexicanus OX=7... [more]
A0A164HKP69.881e-6443.64Putative 52 kDa repressor of the inhibitor of the ... [more]
A0A3N0Y6Q51.569e-6343.07Zinc finger MYM-type protein 1 OS=Anabarilius grah... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033195.13.041e-6743.28pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
ENSAMXT00000042715.11.472e-5040.43pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000035531.14.766e-4539.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036272.11.683e-4436.73pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000044961.16.644e-4434.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028133.19.753e-3931.03zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.19.753e-3931.03zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.19.753e-3931.03zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.15.529e-1524.81pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
ENSORLT00000041223.14.567e-1428.90zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060573.11.802e-4491.36SMESG000060573.1[more]
SMESG000069312.12.746e-4335.47SMESG000069312.1[more]
SMESG000036749.11.118e-4138.50SMESG000036749.1[more]
SMESG000047334.12.000e-3934.04SMESG000047334.1[more]
SMESG000067268.11.706e-3837.62SMESG000067268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033999 ID=SMED30033999|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=785bp
TTGTCGTTTATTTTATAATTTTCGAGAAGATCAAAGATCAGTTTTGGCTA
CGGAATTGGGTTGGCAGCCTGATAGAGGATATAAAAAACTATATGATAGA
ATACCTAAGTATGAAAAATCAACCCACCATAAATCTTGTTATATCCAGTG
GCGAACTGTAGAAAGTAATATTAGTAAAAATAGAACAATTGATTGCCTTT
TAGTACAACAAATACGAAATGAGATACAAAAATGGACAGATTTATTAAAA
CGATTCTTAGATGTAACTTTATTTTTGGCTGAACGAGGTTTGGCTTTCAG
GGGCAGTTCACATTTGATTGGAGATGCAAACAATGGAAATTTTCTCGGAA
TATTAGAACTTGTCAGTCGTTATGATCCACTTTTGGAAGCACATTTAAAA
ATGGTTAAACAATCACAAATCGAGAAACAGAGATTGCAAGTACATTATTT
ATCGGCAGACATTCAAAATGAATTCATATCATGCTGTGCCGATTATTTGA
GTACTTGCATTTTGAGGGAAAGAGAAACTGTAAAATATTATTCTGTAATT
GTAGATGCAACTCCTGAATCCGCCCATATAGAACAAACTACATTTATTTT
ACGATACGTCTCTGTAAATAATCATTCAGATGAATACGAAATTAAGGAAA
GATTTCTTGCATTTGTAAACTGCAATAAGAAGACTGGAGAAGATATTGCA
AATTTAATTCTCGAAACGCTTGAAAAATATAATATTCCTATAAGCGAATG
TCGTGCACAAAGGTACGATAATGGATCCAATATGA
back to top

protein sequence of SMED30033999-orf-1

>SMED30033999-orf-1 ID=SMED30033999-orf-1|Name=SMED30033999-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
CRLFYNFREDQRSVLATELGWQPDRGYKKLYDRIPKYEKSTHHKSCYIQW
RTVESNISKNRTIDCLLVQQIRNEIQKWTDLLKRFLDVTLFLAERGLAFR
GSSHLIGDANNGNFLGILELVSRYDPLLEAHLKMVKQSQIEKQRLQVHYL
SADIQNEFISCCADYLSTCILRERETVKYYSVIVDATPESAHIEQTTFIL
RYVSVNNHSDEYEIKERFLAFVNCNKKTGEDIANLILETLEKYNIPISEC
RAQRYDNGSNM
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371