Steroid 17-alpha-hydroxylase/17,20 lyase

Overview
NameSteroid 17-alpha-hydroxylase/17,20 lyase
Smed IDSMED30033976
Length (bp)1629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30033976) t-SNE clustered cells

Violin plots show distribution of expression levels for Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30033976) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30033976) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30033976) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033976

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033976SMESG000080703.1 dd_Smed_v4_4331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033976SMESG000080703.1 Contig38679newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033976SMESG000080703.1 Contig38679uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 124.02 bits (310), Expect = 9.529e-30
Identity = 111/458 (24.24%), Postives = 198/458 (43.23%), Query Frame = 3
Query:  114 PPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSD-----YGPLWKTLQRNLHKGLRHCA-NLDRLNEIMYKCFDKFKETVEYRRGSK-NGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQY-----AEECDFPNDKP--------SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKH---SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNY 1418
            PPGP R     +F + +       VQ ++ KYG + +L       V I  +    E  +            ++G + ++  R +I   +      G  WK  +R     LR+       L E + +      E ++   G   +   +++N +     N+I  + F E F   D   +Q  ++++ +      ++ C   N  P          ++ F + +KL+   + +I       D+HRK  D+  A  +  DF+     + +L   SK  G   +  H ++   S +D+ FA  E    +  W    +ALYP IQE ++ EI++         T   +  MPYTNAV+ E+QR  +            D  +  Y +PK ++I+ NL A+H D  +W  PD  +P +FL E+G+ FK+R+ F+P+ +G R C+G   +   LF+    ++  +
Sbjct:   44 PPGPWRLPFLGNFFLVDFEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHM--------DQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAV----SNIICSITFGERFEYQD-SWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMI-------DKHRK--DWNPA--ETRDFI-----DAYLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAA-RESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFL-ENGQ-FKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKF 469          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2R1 (cytochrome P450 family 2 subfamily R member 1 [Source:HGNC Symbol;Acc:HGNC:20580])

HSP 1 Score: 115.931 bits (289), Expect = 1.777e-28
Identity = 57/173 (32.95%), Postives = 93/173 (53.76%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHW--KSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            S+ ++I A  E   N   W    +ALYPNIQ  ++ EI+     N       W  K KMPYT AVL E+ R+ +      FH+T +D  +  Y IPK + ++ NLY++H D+K W++P++  P+ FL   G  F +++  VP+ LG R C+G   +   +F+    ++  + +
Sbjct:   70 SVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP---SWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSG-YFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHL 238          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2U1 (cytochrome P450 family 2 subfamily U member 1 [Source:HGNC Symbol;Acc:HGNC:20582])

HSP 1 Score: 116.701 bits (291), Expect = 3.742e-27
Identity = 104/465 (22.37%), Postives = 215/465 (46.24%), Query Frame = 3
Query:  156 INEKLIYKKIVQKYIPK-YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQG----AIEVIPQ----YAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIR 1517
            I+  +I  +++  ++ + YG I + +     VV ++D  +  E  V++ ++  S R       I++  +  ++ + YGP+W+  ++  H  LRH   L +L+ +  K  ++FK      +          + +     N+I  L F + F+  + ++KK  G     +E+           C +    P     F   ++L+++   +   L+  I +H++  D +    D  D  LL +EE     +         + ++ + + D+  A  +   NS +W    ++L P++QE +  EI +    N    +L  K++MPYT A + E+QR          H T ++  +  Y IPK +LI+ NL+++H D   W+ P+   P  FL + G+  K ++ F+P+G+G R C+G   ++  LF++ + ++ ++     ++  + ++  +  + +    PFNI   R
Sbjct:   96 IDPSVIGPQVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQ-AEVFSDRPRVPLISIVTKEKG-VVFAHYGPVWRQQRKFSHSTLRHFG-LGKLS-LEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLP-----FGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQ-DFIDMYLLHMEEE----RKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAP-SLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIK-KETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAP-HPFNITISR 543          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2R1 (cytochrome P450 family 2 subfamily R member 1 [Source:HGNC Symbol;Acc:HGNC:20580])

HSP 1 Score: 115.931 bits (289), Expect = 4.934e-27
Identity = 57/173 (32.95%), Postives = 93/173 (53.76%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHW--KSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            S+ ++I A  E   N   W    +ALYPNIQ  ++ EI+     N       W  K KMPYT AVL E+ R+ +      FH+T +D  +  Y IPK + ++ NLY++H D+K W++P++  P+ FL   G  F +++  VP+ LG R C+G   +   +F+    ++  + +
Sbjct:  303 SVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP---SWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSG-YFAKKEALVPFSLGRRHCLGEHLARMEMFLFFTALLQRFHL 471          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP21A2 (cytochrome P450 family 21 subfamily A member 2 [Source:HGNC Symbol;Acc:HGNC:2600])

HSP 1 Score: 114.775 bits (286), Expect = 1.436e-26
Identity = 96/455 (21.10%), Postives = 195/455 (42.86%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKF-KETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFND-----VDYKKYQGAIEVIPQYAEECD--------FPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKK---GDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWK--SKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQF 1511
            K+GPI  L+     VV +N   T  E  V+K +   +GR      K++S N  ++   DY  LWK      HK L   A L  + + M    ++  +E  E  R      + ++ +   +  ++I  L F +   D       YK  Q  ++    ++ +          FPN           + +L++   +   ++++++ +H++    G ++    D+ D++L  V +  ++  S +L     + HV  + +D++    E   N+  W    L  +P IQ+ ++ E++           + +K  +++P  NA + E+ R          H T    +I  Y+IP+ ++I+ NL   H D+  W+ P    P  FL E G++ +     + +G G R C+G   +   LFV++  ++  + ++   +    +    +   I  ++PF ++ 
Sbjct:   54 KFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWAD-FAGRPEPLTYKLVSKNYPDLSLGDYSLLWKA-----HKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPN---------PGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWR----DMMDYMLQGVAQPSMEEGSGQL----LEGHVHMAAVDLLIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWERPHEFWPDRFL-EPGKNSRA----LAFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL 480          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C9 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16482])

HSP 1 Score: 103.219 bits (256), Expect = 3.807e-23
Identity = 105/445 (23.60%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  180 KIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQR-NLHKGLRHCANLDRLNE-IMYKCFDKFKETVEYRRGSKNGGIEVD-NDLFWMA-DNVITMLLFNEIFNDVDYKKYQ-------------GAIEVIPQY-AEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIID 1460
            K   ++  KYG I T +    P + ++  E   E F++        +  ++ E    G+   +  +  GP W+  +R  +H+        DR+ + IM +  D F          K  G  VD  D+F  A  NVI  +LF   F++    +++              +  +  Q+      +    P+    FK   K QK F    E    +I+ H+K+ D+++   + +D+V   ++E      S       +   + +  +D+ FA+     N+  W F     Y + Q+ +  E+++        +    K  +PYTNA + EIQR A+       H T  D  +  Y IPK + +V  +  + +D+  +  P I  P+ FL +DG+  K+ +  VP+ +G R C+G   +   LF+ I    + Y++V   N    IID
Sbjct:   49 KAFARWTAKYGDIYTFWLGTRPYILVSSYEALKETFIKDGETYADKKPMAFQESFRGGSYGVVETN--GPFWREHRRFAIHQFRDFGLGKDRMEQRIMLEVEDIFNNC------DKTIGEGVDLTDIFDRAVGNVINQMLFGYRFDETRADEFRTIRAFFNFNSGEFASFSMRVQFFLPWMGYIMPGPTILDRFK---KYQKGFT---EFFGTQIENHKKEIDFELE--ENSDYVEAFLKEQRKREASGDFE-SFSTKQLSNMCLDLWFAALMTTSNTMTWCFAYTLNYLDAQQKLHEELDRVIGSER-HINTADKPNLPYTNAYINEIQRTANLVPLNLLHMTTRDTVLKGYNIPKGTGVVAQISTVMYDENVFPEPYIFKPERFLDDDGK-LKKVEQLVPFSVGKRQCLGEGLARMELFLFIANFFNRYRVVPDAN-GPPIID 473          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-23A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27465])

HSP 1 Score: 99.3673 bits (246), Expect = 6.669e-22
Identity = 100/429 (23.31%), Postives = 187/429 (43.59%), Query Frame = 3
Query:  183 IVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKC-FDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN-DVDYKKY-------QGAIEVIPQYAEECDFP--NDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHR---KKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLT---DLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNY 1418
            + Q +  +YG I T++    P+V ++D+ T  + F++  +   S R  ++    +    N I+  D G  W+  +R     LR       L E M           +E   G     + +   +     N+I  +LF   FN D  Y          Q    + P       FP  +  P    ++    +L  + N+L+E L+ +I+ HR   K    +    D+T   ++ VE      K K+ G  +    D  +K  L+D+ FA  E    +  W F L+A    +Q+N++ E++         + +  ++++PY  A + EIQR A+        +  +DI I  Y   K  LI+  +  + +D + ++NP+  +P  FL ED  + K+  +F+P+ +G R C+G + +   L+++   ++ N+
Sbjct:   81 LFQSWKQQYGGIFTVWIGPIPLVMVSDLPTIKKYFIQH-ADSFSNRWRNFVTDSIMEGSNGIVQID-GNKWREQRRFALHTLRDFGVGKPLMEQMITLEVTSLMNHMEKSCGLDGKELHLCPSIAVCVGNIINNMLFGLRFNQDNSYMHRLHQLLDDQSHTVMQPIMGAYIAFPVTSKIPIINGEWN---RLMGIKNELLEFLETQIEGHRMNWKDEMIEQEPEDLTYAYMIEVE------KRKRNGEDVGFFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAELDSI---GQPMIEIQHRTRLPYVQATINEIQRIANILPINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFLDEDN-NVKKIDEFLPFSIGRRQCLGESLARAELYLVFANLIQNF 494          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-34A10 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O61204])

HSP 1 Score: 98.9821 bits (245), Expect = 9.150e-22
Identity = 105/425 (24.71%), Postives = 189/425 (44.47%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRK---LSKQVSGRSASY---GEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETV-EYRRGS-KNGGIEVDNDLFW--MADNVITMLLFNEIF--NDVDYKKYQGAIEVIPQYAEECD--FPN---DKPSKKSDFKSVEKLQKVFNQLIEVLQIRID---EHRKKGDYKI--ACFDITDFVLLAVE--EYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVV 1409
            YG + T++    P V+I+D +  +E  +++    S + +  + +Y   G  I++ N         G  W+  +R     LR+   L R N +  K  +++   + +Y+R   KNG IE+    F+  +  ++I  LL +E F   D +++K + ++ +  +     D  FP    D P  K   K   K+ + F+ + EV +  +    E  K GD+ I     D  D  +L ++  E    P +  L   + D+       D+  A QE    +  W F  L  +PN+ + +R E+ K    N   V L+ ++  PY NAV  E+QR AS      F     D  I    +    ++   +  +H D + +KNP    P+ FL  +       K  +P+G+G R+C G + +   L++++  V+
Sbjct:   62 YGKVFTIWMGPLPSVYISDYDVAHESHIKRANIFSTRFAHGTTNYIREGRGIIAAN---------GDFWQDHRRFALTTLRNFG-LGR-NLMEEKIMEEYNYRISDYKRTHLKNGAIEIHAGTFFDLLVGSIINQLLISERFEQGDQEFEKIKTSLALSLENFGIIDIFFPTAILDSPLMKWRQK---KIFEPFDFIYEVSKRNLTKRMEAVKSGDHVIEDGGRDFVDAYILKIQKDENSGAPSTFNLETMIIDV------FDLWQAGQETTSTTLTWAFCCLLNHPNVVKKLRAELMKLTGGNR-HVGLNDRADTPYLNAVCNEVQRIASILNINLFRKIEQDTEIAGQPLASGCVVTTQMSMLHTDVEVYKNPTEFRPERFLENN----TLEKKLIPFGIGKRSCPGESLARAELYLILSNVI 461          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44706])

HSP 1 Score: 97.0561 bits (240), Expect = 3.573e-21
Identity = 107/477 (22.43%), Postives = 203/477 (42.56%), Query Frame = 3
Query:  111 LPPGPNRNSDEADF--IINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCA---NLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKS-----VEKLQKVF----------NQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFI 1481
             PPGP       +   I N    Y+   +++  KYG I T +   TP + IN  +   E ++R  ++  + +       +  G    I++S+ G  W+  +R     +R      NL + N I+ +  D F   ++ + GS+    EV +       NV+  LLF   F      +YQ    +I       + P D   K   F +     + KL   F          +        +I+ HR++ D      + TDFV   ++E     +S+      +++ + +  +D+ FA      N+  W    +  +P +Q+ +  E++K    + + +T   K+ +PY NA + E QR  +       H+T  D  I  ++IPK + +V  +  + ++++ + +P   +P  F+ E G+  KR ++  P+ +G R+C G   +   LF+ I   ++ YK ++   +    +D  N   I
Sbjct:   25 FPPGPCPLPVFGNLLSIANPPPGYEAF-ERWTKKYGDIYTFWIGNTPHIMINTWDKIKETYIRD-AETYTNKVRLPALDLFRGGEYGIIDSN-GATWREHRRFALSTMRDFGLGKNLMQEN-ILMEVQDVFAR-LDAKLGSETDIPEVFDH---AVANVVNQLLFGYRFVGPKESEYQELKRII-------EAPTDLFGKPHMFLAMNIPVIAKLMPEFMYEGPFKDFRDTAFAFFNKQIEAHRQEVDLNDLNSESTDFVETFLKEQKRR-ESEGDSETFSNVQLSNVCMDLWFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRL-ITTADKNDLPYFNAFINEAQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRFIDEHGK-LKRVEELAPFSVGKRSCPGEGLARMELFLFIANFLNRYK-IYPSKEGPPSMDKSNGALI 482          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-31A3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q9N574])

HSP 1 Score: 96.2857 bits (238), Expect = 6.605e-21
Identity = 70/277 (25.27%), Postives = 129/277 (46.57%), Query Frame = 3
Query:  702 DFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKI-ACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQR-YASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDD---KNAVFIRDVEPFNIQFIR 1517
            D ++ EK  ++ +   + + +   E  ++ DYK+       D +L  V+   +D           +  V+  +   +F   +      +W   LL  +P +Q  ++ E+++   D+  +VT+   S+M Y    L E  R + S    T   S  DD  IG   IPK    +LNLY +H D  QWK+PD+ DP  FL E+  + ++   F+P+  G R C+G  F+     V++  ++ N+ +     K+ E++ +   K  + +R V P +++  R
Sbjct:  232 DGRTHEKCLRILHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMD-----------ETDVQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDE-DVTIEHLSRMKYLECALKEALRLFPSVPIITRELS--DDQVIGGVNIPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIA-RKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNV-----KAVELMHEVRPKMEIIVRPVTPIHMKLTR 488          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 96.6709 bits (239), Expect = 6.117e-21
Identity = 47/204 (23.04%), Postives = 104/204 (50.98%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHW--KSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIR 1517
            +++D   A  +   N+      +LA+ P++QE + +++       + +   H   +    Y +A + E+QR+      T     +    +G Y+IPK++ I+++L ++H DK+ WK+P    P+ F+   G+ FK  + F+P+G+G R C+G+  +   +F  ++ +V ++ +V    +S  ++           +P+ +QF++
Sbjct:  302 TILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFK-DEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSMVLLPGITL--TPKPYKVQFVK 502          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 95.5153 bits (236), Expect = 1.294e-20
Identity = 50/176 (28.41%), Postives = 87/176 (49.43%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKN 1439
             L+D  F +   +G     +   L LYP +   ++ EI++      +   L  +  +P+T A + E  R  +       H  ++D  +  Y IPKD+++V +LYA H D + W +P+   P+ FL  DG+   +    +P+G G R C G TF+ N+LF++   +  ++  V G N
Sbjct:  308 GLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLP-NLEDRKNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWSDPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLGPN 482          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 90.5077 bits (223), Expect = 7.089e-19
Identity = 91/445 (20.45%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  108 KLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLN---EIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQ----------GAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKL-GIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVL 1394
            KLPPGP         +      + + ++    +YG + +        V ++D +   E F R+   + +GR  +   + L+G    I+NS  G LWK  +R LH  LR        N   ++  +   +  E + +   S    +++   +     NVI  L+ +  F+  D  ++++           G I  +        FP+   +K    ++  ++Q+ +  +I       D+H++  D      D+ DF L  +E+   +    +L   K  +  +   +ID+  A  E +  + +W+   +   P     ++ E+++    + +  T+     +P T + + E  R +S       HS   D+ +  Y IP  S ++  + ++H D   W+ P+   P  F+  +G+  ++ + F+P+G+G R C+G+  +   LF+ 
Sbjct:   52 KLPPGPWGLPVIGYLLFMGSEKHTRFME-LAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE---EFTGRPDTPFMQTLNGY--GIINST-GKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVI-------DDHKRSFDPN-NIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP-TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGK-VRKPEYFIPFGVGRRMCLGDVLARMELFLF 479          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 90.5077 bits (223), Expect = 7.089e-19
Identity = 91/445 (20.45%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  108 KLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLN---EIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQ----------GAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKL-GIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVL 1394
            KLPPGP         +      + + ++    +YG + +        V ++D +   E F R+   + +GR  +   + L+G    I+NS  G LWK  +R LH  LR        N   ++  +   +  E + +   S    +++   +     NVI  L+ +  F+  D  ++++           G I  +        FP+   +K    ++  ++Q+ +  +I       D+H++  D      D+ DF L  +E+   +    +L   K  +  +   +ID+  A  E +  + +W+   +   P     ++ E+++    + +  T+     +P T + + E  R +S       HS   D+ +  Y IP  S ++  + ++H D   W+ P+   P  F+  +G+  ++ + F+P+G+G R C+G+  +   LF+ 
Sbjct:   52 KLPPGPWGLPVIGYLLFMGSEKHTRFME-LAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE---EFTGRPDTPFMQTLNGY--GIINST-GKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVI-------DDHKRSFDPN-NIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP-TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGK-VRKPEYFIPFGVGRRMCLGDVLARMELFLF 479          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 80.8777 bits (198), Expect = 8.077e-16
Identity = 53/199 (26.63%), Postives = 89/199 (44.72%), Query Frame = 3
Query:  918 IDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFI 1514
            +D+  A  E    S  + F  L L P IQE    EI +      +      ++K+PY  A+  E  R     TF   H  + D  +  YEIPKD++++     +  +   + +P+  +P  +L  DG   K  + F P+G G   C+G+      LF+    V+ N+KMV    +  E +  + A     V+P++I  +
Sbjct:  305 LDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLF-DGH-LKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGAT--AAVKPYDIMLV 499          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x8 (cytochrome P450, family 2, subfamily X, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-040704-28])

HSP 1 Score: 145.976 bits (367), Expect = 1.252e-37
Identity = 127/457 (27.79%), Postives = 220/457 (48.14%), Query Frame = 3
Query:  111 LPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKL--QKVFNQLIEVLQIR----IDEH---RKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQ 1448
             PPGP+      + +        K  +++  KYG I +LY    P VF+N      E  V K ++  SGR   +    L+  +  +L +DYGPLWK  +R     LR+     +  E   +   +    V Y    KN G  VD  + +  +A NVI+++LF   F D + +  Q  I++I + ++  + P +       F  +  L  +K F+  ++VL+      IDEH   R  G  +       DF+   ++E  LD +  ++     D  + + ++D+ FA  +   N+ +  F  L  +P +Q   + EI+   +  + +V+   +  MPYT AV+ E+QR A+    + FH T  D  +  Y IPK +LI+ NL  +  ++ QWK P   +P NFL+E G+ F++ + F+P+  G R C+G   +   LF++ + ++  YK VW ++  +
Sbjct:   27 FPPGPSPLPIFGNLLHFNLANPLKEFERFAEKYGNIFSLYTGSRPAVFLNSFAVIKEALVTK-AQDFSGRPQDFMISHLTECKGVVL-ADYGPLWKDHRRFALMTLRNFGLGKQSME--ERILGEISHVVGYL--DKNIGKTVDPQVMFHNVASNVISLVLFGRRF-DYNSETLQCYIQLITEISKILNGPWNMIYDTLPFLRILPLPFKKGFDH-VKVLKGMNLKLIDEHKSTRVPGKPR-------DFIDCYLDE--LDKRKNEVSTFSEDQLLMY-ILDLYFAGTDTTSNTLLTAFLYLMNHPEVQVKCQQEIDDVLEGKD-QVSYEDRDNMPYTLAVIHEVQRVANTVPLSVFHCTTRDTELMGYSIPKGTLIIPNLTIVLKEEGQWKFPHEFNPANFLNEQGQ-FEKPEAFIPFSTGPRVCLGEGLARMELFLVFVTLLRRYKFVWPRDAGK 463          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x8 (cytochrome P450, family 2, subfamily X, polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-040704-28])

HSP 1 Score: 145.591 bits (366), Expect = 1.872e-37
Identity = 126/457 (27.57%), Postives = 220/457 (48.14%), Query Frame = 3
Query:  111 LPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKL--QKVFNQLIEVLQIR----IDEH---RKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQ 1448
             PPGP+      + +        K  +++  KYG I +LY    P VF+N      E  V K ++  SGR   +    L+  +  +L +DYGPLWK  +R     LR+     +  E   +   +    V Y    KN G  VD  + +  +A NVI+++LF   F D + +  Q  I++I + ++  + P +       F  +  L  +K F+  ++VL+      IDEH   R  G  +       DF+   ++E  LD +  ++    ++  +   ++D+ FA  +   N+ +  F  L  +P +Q   + EI+   +  + +V+   +  MPYT AV+ E+QR A+    + FH T  D  +  Y IPK +LI+ NL  +  ++ QWK P   +P NFL+E G+ F++ + F+P+  G R C+G   +   LF++ + ++  YK VW ++  +
Sbjct:   27 FPPGPSPLPIFGNLLHFNLANPLKDFERFAEKYGNIFSLYTGSRPAVFLNSFAVIKEALVNK-AQDFSGRPQDFMISHLTECKGVVL-ADYGPLWKDHRRFALMTLRNFGLGKQSME--ERILGEISHVVCYL--DKNIGKTVDPQVMFHNVASNVISLVLFGRRF-DYNSETLQCYIQLITEISKILNGPWNMIYDTLPFLRILPLPFKKGFDH-VKVLKGMNLKLIDEHKSTRVPGKPR-------DFIDCYLDE--LDKRKNEVS-TFSEDQLLMYILDLYFAGTDTTSNTLLTAFLYLMNHPEVQVKCQQEIDDVLEGKD-QVSYEDRDNMPYTLAVIHEVQRVANTVPLSVFHCTTRDTELMGYSIPKGTLIIPNLTIVLKEEGQWKFPHEFNPANFLNEQGQ-FEKPEAFIPFSTGPRVCLGEGLARMELFLVFVTLLRRYKFVWPRDAGK 463          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x7 (cytochrome P450, family 2, subfamily X, polypeptide 7 [Source:ZFIN;Acc:ZDB-GENE-110114-2])

HSP 1 Score: 142.51 bits (358), Expect = 2.361e-36
Identity = 126/454 (27.75%), Postives = 218/454 (48.02%), Query Frame = 3
Query:  189 QKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDK-------------PSKKSDFKSVEKLQKVFNQLIEVLQIRIDEH---RKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEP 1496
            ++   KYG I +LY    P VF+N+ E   E  V K ++  SGR        L+GN+  +L +DYGPLWK  +R     LR+     +  E   +   +    V++    KN G  VD  + +  +A NVI ++LF   F D + +  +G I+ I +     + P +              P KK+ F +V+ ++ +  +LI       DEH   R  G  +       DF+   ++E  LD K K      ++  +  +++D+ FA  +   N+ +  F  L  +P++Q   + EI+   +  + +VT   +  MPYT AV+ E+QR A+    +  H T  D  +  Y IPK ++I+ NL  +  ++ QWK P   +P NFL+E G+ F++ + F+P+  G R C+G   +   LF++ + ++  ++ VW ++  +    D   VF   + P
Sbjct:   53 ERLAEKYGNIFSLYTGSKPAVFLNNFEVIKEALVTK-AQDFSGRPQDLMISHLTGNKGVVL-ADYGPLWKDHRRFALMTLRNFGLGKQSME--ERILGEISHIVDFL--DKNTGKTVDPQIMFHNIASNVINLVLFGCRF-DYNNEFLRGYIQRIAENLRILNGPWNMIYDTFPLLRILPLPFKKA-FDNVKIIKSMNRKLI-------DEHKSTRVPGQPR-------DFIDCYLDE--LD-KVKNCVSTFSEDQLIMNIMDMSFAGTDTTSNTLLAAFLYLMNHPDVQVKCQQEIDDVLEGKD-QVTYEDRHNMPYTLAVIHEVQRVANIVPLSVLHCTTRDTELMGYSIPKGTVIIPNLTVVLKEEGQWKFPHEFNPANFLNEQGQ-FEKPEAFIPFSTGPRVCLGEGLARMELFLIFVTLLRRFQFVWPEDAGKP---DYTPVFGLTMTP 476          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x6 (cytochrome P450, family 2, subfamily X, polypeptide 6 [Source:ZFIN;Acc:ZDB-GENE-050320-144])

HSP 1 Score: 141.739 bits (356), Expect = 3.303e-36
Identity = 120/443 (27.09%), Postives = 217/443 (48.98%), Query Frame = 3
Query:  189 QKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKL--QKVFN--QLIEVLQIR-IDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEP 1496
            +K+  KYG I +LY    P V +N      E  V K ++  SGR   +     + N+  +L +DYGP+ K  +R     +R+     +  E   +   +    V+Y    KN G  VD  + +  +A NVI++LLF   F D + +  Q  I++  + ++  + P +          +  L  +K F+  ++I+ + ++ IDEH+             DF+   ++E  LD K K      ++  +  S++D+ FA  + + N+ +  F  L  +P +Q   + EI+   +  + +VT   +  MPYT AV+ E+QR A+    + FH T  D  +  Y IPK ++I+ NL ++  ++ QWK P   +P NFL+E G+ F++ + F+P+  GLR C+G   +   LF++ + ++  ++ VW ++  +    D   VF   + P
Sbjct:   53 EKFAEKYGEIFSLYTGSRPAVILNSFAVIKEALVTK-AQDFSGRPQDFMISHATENKGIVL-ADYGPVLKDHRRFALMTMRNFGLSKQSME--ERILGEISHVVDYL--DKNAGKRVDPHIMFHNVASNVISLLLFGCRF-DYNSEFLQCYIQLSNEISKIINGPWNMIYDTFPLLRILPLPFKKAFDHVKVIKSMNLKLIDEHKSTRP--------RDFIDCYLDE--LD-KGKNCVSTFSEDKLLMSIMDLHFAGTDTISNTLLTAFLYLMNHPEVQVKCQQEIDDVLEGKD-QVTYEDRHNMPYTLAVIHEVQRVANTVPLSVFHCTTRDTELMGYSIPKGTIIIPNLTSVLKEEGQWKFPHEFNPANFLNEQGQ-FEKPEAFIPFSTGLRMCLGEGLARMELFLIFVTLLRRFQFVWPEDAGKP---DYTPVFGLTLTP 472          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x7 (cytochrome P450, family 2, subfamily X, polypeptide 7 [Source:ZFIN;Acc:ZDB-GENE-110114-2])

HSP 1 Score: 141.739 bits (356), Expect = 3.663e-36
Identity = 126/454 (27.75%), Postives = 217/454 (47.80%), Query Frame = 3
Query:  189 QKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDK-------------PSKKSDFKSVEKLQKVFNQLIEVLQIRIDEH---RKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEP 1496
            ++   KYG I +LY    P VF+N+ E   E  V K ++  SGR        L+GN+  +L +DYGPLWK  +R     LR+     +  E   +   +    V++    KN G  VD  + +  +A NVI ++LF   F D + +  +G I+ I +     + P +              P KK+ F +V+ ++ +  +LI       DEH   R  G  +       DF+   ++E  LD K K      ++  +  +++D+ FA  +   N+ +  F  L  +P +Q   + EI+   +  + +VT   +  MPYT AV+ E+QR A+    +  H T  D  +  Y IPK ++I+ NL  +  ++ QWK P   +P NFL+E G+ F++ + F+P+  G R C+G   +   LF++ + ++  ++ VW ++  +    D   VF   + P
Sbjct:   53 ERLAEKYGNIFSLYTGSKPAVFLNNFEVIKEALVTK-AQDFSGRPQDLMISHLTGNKGVVL-ADYGPLWKDHRRFALMTLRNFGLGKQSME--ERILGEISHIVDFL--DKNTGKTVDPQIMFHNIASNVINLVLFGCRF-DYNNEFLRGYIQRIAENLRILNGPWNMIYDTFPLLRILPLPFKKA-FDNVKIIKSMNRKLI-------DEHKSTRVPGQPR-------DFIDCYLDE--LD-KVKNCVSTFSEDQLIMNIMDMSFAGTDTTSNTLLAAFLYLMNHPEVQVKCQQEIDDVLEGKD-QVTYEDRHNMPYTLAVIHEVQRVANIVPLSVLHCTTRDTELMGYSIPKGTVIIPNLTVVLKEEGQWKFPHEFNPANFLNEQGQ-FEKPEAFIPFSTGPRVCLGEGLARMELFLIFVTLLRRFQFVWPEDAGKP---DYTPVFGLTMTP 476          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: ENSXETT00000043988.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:50332813:50396253:-1 gene:ENSXETG00000002382.1 transcript:ENSXETT00000043988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 4.533e-31
Identity = 106/457 (23.19%), Postives = 212/457 (46.39%), Query Frame = 3
Query:  111 LPPGPNRNSDEADFIINEKLIYKKIVQKY--IPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWK-----TLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN---DVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKL----QKVFNQL---IEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVW 1430
            LPP P R++  +D+++    + ++    Y  +  YGP+ ++Y   TP V +  +++  EV V K     +GR  +    ++S ++  ++ + YG  WK     TL      GL   +  DR+ E        FK  V +             D  ++ +N ++ ++ + +F    D +   +Q  + ++ +  +    P+      + F  ++ L    +K+F  +      L   ++EH++     +   +  D++   +EE  L       G+   + ++   + D+  A  E   +S  W    +  +P IQE    EI++   + N  +    + +MPYT AVL E+QR+AS       HS + D+++  + IPK ++I+ +L ++H+DK  WK P   +P+NFL+E+G   K  + F+P+  G R C+G   +   +F+    ++ +++  W
Sbjct:    4 LPPSPGRSA--SDWLVRMFSLEQETGSCYTHVHLYGPVYSIYLGFTPAVVVRGLKSIKEVLVNK-GTDFAGRPQNRITDVISKSKGLVV-APYGQAWKEHRRFTLSTLRSFGLGKKSMEDRIQEENMHLIQAFKNNVLF-------------DPHFVLENAVSNIICSIVFGRRYDYNDTSFQNILNLVHENMKLSS-PSTSCLLYNAFGFIQFLPLPHKKIFQNVDVVFAFLGKVVEEHKET----LLPGEPRDYIDCYLEE--LKKADATRGMTFDEENLFSCVADLFVAGTETTTSSLEWCLLYMLKFPEIQEKCHEEIDRVFGNKNC-LEYEDRERMPYTQAVLQEVQRHASVVPLGVSHSPIRDVHLNGFFIPKGTVIITDLSSVHYDKTHWKYPHEFNPENFLNENGELIK-TEAFLPFSAGPRVCLGENLARMEIFLFFTAMLQHFEFHW 434          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: foxh1.2 (forkhead box H1, gene 2 [Source:Xenbase;Acc:XB-GENE-478064])

HSP 1 Score: 122.865 bits (307), Expect = 2.176e-29
Identity = 118/469 (25.16%), Postives = 205/469 (43.71%), Query Frame = 3
Query:  108 KLPPGPNRNSDEADFI-INEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQR-------NLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFN--DVDYKKYQGAIE---------------VIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSL---IDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            KLPPGP       +F+ +  + ++K +++ +  KYGP+ T++    PVV +   +   E       +  +       EKI  G    + ++  G  WK L+R       N   G R     +R+ E  +   ++FK T          G  VD   ++     NVI  ++F + F   D ++ +  G +                + P+   +   P++       FKSV  LQ+   Q I + Q  +D    +        D  D  L+ +++    P+        T+ H++ +L    D+  A  E +  +  +   +L  +P+I+E I+ EI+     N     +  +S+MPYT+AV+ EIQR+         H    DI    Y IPK + +   L ++ HD KQ+K PDI +P +F+ E+G+ F +   F+P+  G R CVG   +   LF+ I  ++ NY +
Sbjct:   33 KLPPGPTPLPFLGNFLQLRGEEVFKSLLE-FGKKYGPVYTIHLGMEPVVVLCSFDIVKEALNDNGDEFGARGHMPLLEKISHGGHGVVASN--GERWKQLRRFSLMTLRNFGMGKRSIE--ERIQEEAHFLTNEFKYT---------KGQPVDPTFYFSKAVSNVICSVVFGDRFEYEDTEFLRLLGLLNQVFRGFSSVWGQLYNIFPKVMGKLPGPHNM-----IFKSVNSLQEFIMQRINMHQETLDPSSPR--------DFIDCFLIKMQQEKDVPQ--------TEFHMQGALNTTFDMFGAGTETVSTTLRYGLLILLKHPDIEERIQKEIDSVIGRNRAPC-IEDRSRMPYTDAVIHEIQRFVDIIPMGIPHKVTRDIQFQGYFIPKGTTVYPMLSSVLHDPKQFKYPDIFNPGHFIDENGK-FCKNDGFMPFSSGKRICVGEGLARMELFLFITTILQNYTL 464          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: cyp2u1 (cytochrome P450 family 2 subfamily U member 1 [Source:NCBI gene;Acc:100127656])

HSP 1 Score: 122.479 bits (306), Expect = 4.066e-29
Identity = 117/485 (24.12%), Postives = 223/485 (45.98%), Query Frame = 3
Query:  108 KLPPGPNRNSDEADFIINEKLIYKKIVQKYIPK-YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGG---IEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAE-----------ECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIR 1517
            ++P G  R             +Y  IV   + K YG I  LY     +V +ND  +  +  V   S+  S R +     I++  R  I+ + YGP+W+  +R  H  LR+   L +L+ +  K  ++FK          N G    E+ N+      NVI  + F + FN  D K+++  + ++ +  E            C +    P     F   ++L+++   +   L+  I EH+   D      D  D  LL ++E   + K +   I  T+ ++ + + D+  A  +   N+ +W    + LYP++QE ++ EI+     +    +L  KS+MP+T A + E+QR       +  H   +      Y IPK S+++ NL+++H D K W+ P+   P+ FL E+G+  K ++ F+P+G+G R C+G   ++  LF++ + ++ ++      +  +  ++ +  + +    PF+I+  +
Sbjct:  100 RVPAGATRRG---------AFLYPHIVLTEMAKMYGKIYGLYIGTRLMVILNDFNSVKDALVSH-SEVFSDRPSVSLVTIIT-KRKGIVFAPYGPIWRQQRRFSHSTLRYFG-LGKLS-LEPKIIEEFKYVKAEMLKFGNKGFSPFEIINN---AVSNVICSISFGKRFNYED-KEFKTMLSLMSRGLEISVNSEAVLICLCSWLYYLP-----FGPFKELRQIVIDITAFLKRIIAEHQVTLD-PANPRDFIDMYLLHIKE---EQKGQAESIFNTE-YLFYIIGDLFIAGTDTTTNTLLWSLLYMCLYPDVQEKVQAEIDTVIGRDR-PPSLTDKSQMPFTEATIMEVQRMTVVVPLSVPHMASESSVFHGYTIPKGSVVMANLWSVHRDPKVWEKPNDFMPKRFLDENGQILK-KEAFIPFGIGRRVCMGEQLAKMELFLMFVNLLQSFSFSLADDTFKPSLEGRFGLTLAPY-PFDIKITK 554          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: cyp17a1 (cytochrome P450 family 17 subfamily A member 1 [Source:NCBI gene;Acc:100145650])

HSP 1 Score: 121.709 bits (304), Expect = 5.304e-29
Identity = 100/437 (22.88%), Postives = 200/437 (45.77%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCA-NLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVD------YKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKK--GDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRS-FKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIR 1484
            KYG + +       +V +N  E   EV ++K  K   GR  +    +L+ N  +I  +DY P WK  ++ +H  L         + +I+ +      +T+   +GS    +++  +L     NV+  L FN  +   D          +G ++ + + +    FP  +     D + +++   + ++L   LQ ++ EH++   G+      D      L++E  + +  S+++G  LTD H+  ++ D+  A  E       W    L  YP +Q  I+ E++  +        L  +  +PY +A + E+ R          H  + + +IG Y IP+D+ +V+NL+++HHD  +W+NP+   P  FL E+G   +   + ++P+G G+R C+G   ++  +F+ +  ++  + +      S   +D K  V ++
Sbjct:   39 KYGSLYSFKMGSHYIVIVNHHEHAKEVLLKK-GKTFGGRPRAVTTDLLTRNAKDIAFADYSPTWKFHRKLVHAALSMFGEGTVAIEKIISREAASLCQTLITFQGSP---LDMAPELTRAVTNVVCALCFNARYKRCDPEFEEMLAYSKGIVDTVAKDSLVDIFPWLQIFPNKDLEILKRSVAIRDKL---LQKKLKEHKEAFCGEEVNDLLDALLKAKLSMENNNSN-ISQEVG--LTDDHLLMTVGDIFGAGVETTTTVLKWTVAYLLHYPKVQAKIQEELD-VKVGFGRHPVLSDRRILPYLDATISEVLRIRPVAPLLIPHVALHESSIGEYTIPQDARVVINLWSLHHDPNEWENPEEFIPDRFLDENGNHLYTPSQSYLPFGAGIRVCLGEALAKMEIFLFLSWILQRFTLEVPAGDSLPDLDGKFGVVLQ 464          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: cyp17a1 (cytochrome P450 family 17 subfamily A member 1 [Source:NCBI gene;Acc:100145650])

HSP 1 Score: 121.324 bits (303), Expect = 7.128e-29
Identity = 100/437 (22.88%), Postives = 200/437 (45.77%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCA-NLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVD------YKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKK--GDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRS-FKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIR 1484
            KYG + +       +V +N  E   EV ++K  K   GR  +    +L+ N  +I  +DY P WK  ++ +H  L         + +I+ +      +T+   +GS    +++  +L     NV+  L FN  +   D          +G ++ + + +    FP  +     D + +++   + ++L   LQ ++ EH++   G+      D      L++E  + +  S+++G  LTD H+  ++ D+  A  E       W    L  YP +Q  I+ E++  +        L  +  +PY +A + E+ R          H  + + +IG Y IP+D+ +V+NL+++HHD  +W+NP+   P  FL E+G   +   + ++P+G G+R C+G   ++  +F+ +  ++  + +      S   +D K  V ++
Sbjct:   65 KYGSLYSFKMGSHYIVIVNHHEHAKEVLLKK-GKTFGGRPRAVTTDLLTRNAKDIAFADYSPTWKFHRKLVHAALSMFGEGTVAIEKIISREAASLCQTLITFQGSP---LDMAPELTRAVTNVVCALCFNARYKRCDPEFEEMLAYSKGIVDTVAKDSLVDIFPWLQIFPNKDLEILKRSVAIRDKL---LQKKLKEHKEAFCGEEVNDLLDALLKAKLSMENNNSN-ISQEVG--LTDDHLLMTVGDIFGAGVETTTTVLKWTVAYLLHYPKVQAKIQEELD-VKVGFGRHPVLSDRRILPYLDATISEVLRIRPVAPLLIPHVALHESSIGEYTIPQDARVVINLWSLHHDPNEWENPEEFIPDRFLDENGNHLYTPSQSYLPFGAGIRVCLGEALAKMEIFLFLSWILQRFTLEVPAGDSLPDLDGKFGVVLQ 490          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2j6 (cytochrome P450, family 2, subfamily j, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1270148])

HSP 1 Score: 123.25 bits (308), Expect = 1.069e-29
Identity = 109/426 (25.59%), Postives = 195/426 (45.77%), Query Frame = 3
Query:  186 VQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCA-NLDRLNEIMYKCFDKFKETVEYRRGSK-NGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQ--YAEEC---DFPNDKP--------SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNY 1418
            +Q  + KYG I +L       V I  +    E    ++ + +  R  S  ++ +S N+N ++ S  G +WK  +R     LR+       L E M +      E +    G   N    ++N +     N+I  + F E F+  D  ++Q  + ++ +  Y E        N  P        S +  F++ EKL K+F      +   ID+HRK  +      +  DF+   ++E    P+         + ++  S +D+ FA  E    +  W    +ALYP +QE ++ EI++          L  +  MPYTNAV+ E+QR  +            D N+  + +PK ++++ NL A+H D K+W  PD+ +P++FL E+G+ FK+R+ F+P+ +G R C+G   + + LF+    ++  +
Sbjct:   68 IQPLVKKYGNIFSLNLGDITSVVITGLPLIKEALT-QMEQNIMNRPLSVMQERIS-NKNGLIFSS-GQIWKEQRRFALMTLRNFGLGKKSLEERMQEEASHLVEAIREEEGKPFNPHFSINNAV----SNIICSVTFGERFDYHD-SRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYIPGSHQKVFRNWEKL-KLF------VSCMIDDHRKDWNPD----EPRDFIDAFLKEMTKYPEKT---TSFNEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEVQEKVQAEIDRVIGQKRA-ARLADRESMPYTNAVIHEVQRMGNIIPLNVPREVAMDTNLNGFHLPKGTMVLTNLTALHRDPKEWATPDVFNPEHFL-ENGQ-FKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKF 468          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2r1 (cytochrome P450, family 2, subfamily r, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2449771])

HSP 1 Score: 117.472 bits (293), Expect = 4.654e-29
Identity = 57/171 (33.33%), Postives = 94/171 (54.97%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            S+ ++I A  E   N   W    +ALYPNIQ  +  EI+     N    +  +K KMPYT AVL E+ R+ +      FH+T +D  +  Y IPK + ++ NLY++H D+K WK+PD+  P+ FL  +G  F +++  +P+ LG R C+G   +   +F+    ++  + +
Sbjct:   94 SVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKEIDLIVGHNR-RPSWEYKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFLDSNG-YFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHL 262          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2j9 (cytochrome P450, family 2, subfamily j, polypeptide 9 [Source:MGI Symbol;Acc:MGI:1921769])

HSP 1 Score: 119.783 bits (299), Expect = 2.051e-28
Identity = 115/462 (24.89%), Postives = 201/462 (43.51%), Query Frame = 3
Query:   87 NRTISSYKLPPGPNRNS-DEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGS--KNGGIEVDN--DLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQY-----AEECDFPNDKP--------SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNY 1418
            NR   +Y  PPGP R       F ++ K  +  + Q+++ KYG + +L     P V I  +    E+F  ++      R  +   K L      I +SD    WK  +R     LR+     R  E      ++ +E   Y   +    GG   D   ++     N+I  + F E F+  D  ++Q  + ++ +      +  C   N  P        S ++ F++  KLQ   + ++       + HR+  D      D  D  L  + +Y       K      + ++  S +D+ FA  E    +  W    +ALYP +QE ++ EI++       +  L  +  MPYTNAV+ E+QR  +   F        D  +  + +PK  +++ NL A+H D  +W  PD  +P++FL E+G+ FK+R+ F+P+ +G R C+G   + + LF+ I  +   +
Sbjct:   37 NRRPKNY--PPGPMRLPFVGCLFHLDPKQPHLSL-QQFVKKYGNVLSLDFANIPSVVITGMPLIKEIFT-QMEHNFMNRPVTLLRKHLFNKNGLIFSSDQT--WKEQRRFALMTLRNFGLGKRSLE------ERIQEEAHYLVEAIRDEGGQPFDPHFNISNAVSNIICSITFGERFDYHD-SQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLPGSHQTLFRNWRKLQLFVSDIV-------NNHRRDWDPD-EPRDFIDAFLTEMTKY-----PDKTTTSFNEENLICSTLDLFFAGTETTSTTLRWALLCMALYPEVQEKMQAEIDRVIGQAR-QPNLADRDSMPYTNAVIHEVQRMGNIIPFNVPREVAVDTQLAGFNLPKGIMVLSNLTALHRDPSEWTTPDTFNPEHFL-ENGQ-FKKRESFLPFSMGKRACLGEQLARSELFIFITTLFQKF 469          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2r1 (cytochrome P450, family 2, subfamily r, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2449771])

HSP 1 Score: 118.242 bits (295), Expect = 7.128e-28
Identity = 57/171 (33.33%), Postives = 94/171 (54.97%), Query Frame = 3
Query:  912 SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            S+ ++I A  E   N   W    +ALYPNIQ  +  EI+     N    +  +K KMPYT AVL E+ R+ +      FH+T +D  +  Y IPK + ++ NLY++H D+K WK+PD+  P+ FL  +G  F +++  +P+ LG R C+G   +   +F+    ++  + +
Sbjct:  303 SVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKEIDLIVGHNR-RPSWEYKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFLDSNG-YFTKKEALIPFSLGRRHCLGEQLARMEMFLFFTSLLQQFHL 471          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2c29 (cytochrome P450, family 2, subfamily c, polypeptide 29 [Source:MGI Symbol;Acc:MGI:103238])

HSP 1 Score: 117.857 bits (294), Expect = 7.938e-28
Identity = 118/453 (26.05%), Postives = 213/453 (47.02%), Query Frame = 3
Query:  108 KLPPGPNRNSDEADFIINEKLIYKKIVQKYI---PKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGR-SASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFP-----NDKPSKKSDF--KSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKH---SLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            KLPPGP       +F+   ++  K I Q +      YGP+ TLY    P V ++  E   E  + +  ++ +GR S    EKI+ G      N   G  WK ++R     LR+     R   I  +  ++ +  VE  R +K    +    L     NVI  ++F   F+  D K++   ++ I +  +    P     N  PS   D+   S  K+ K FN L   L  +I EH++  D      +  DF+     +Y+L  + +   I+ ++  +++   ++ D+  A  E    +  +   LL  YP++   ++ EI++    +     +  +S MPYT+A++ E+QR+      +  H+   DI    Y IPK + ++ +L ++ HD K++ NP++ DP +FL+ +G +FK+   F+P+  G R C G   +   LF+++  ++ N+K+
Sbjct:   28 KLPPGPTPLPIIGNFL---QIDVKNISQSFTNFSKAYGPVFTLYLGSKPTVILHGYEAVKEALIDR-GEEFAGRGSFPMAEKIIKGFGVVFSN---GNRWKEMRRFTLMTLRNLGMGKR--NIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICSIIFQNRFDYKD-KEFLILMDKINENVKILSSPWLQVCNSFPSL-IDYCPGSHHKIVKNFNYLKSYLLEKIKEHKESLDVT----NPRDFI-----DYYLIKQKQVNHIEQSEFSLENLASTINDLFGAGTETTSTTLRYALLLLLKYPDVTAKVQEEIDRVVGRHRSPC-MQDRSHMPYTDAMIHEVQRFIDLLPTSLPHAVTCDIKFRKYLIPKGTTVITSLSSVLHDSKEFPNPEMFDPGHFLNGNG-NFKKSDYFMPFSTGKRICAGEGLARMELFLILTTILQNFKL 458          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P12394|CP17A_CHICK (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus OX=9031 GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.930e-35
Identity = 108/450 (24.00%), Postives = 211/450 (46.89%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLD-RLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKY----QGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSK---KLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHW----KSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKR-RKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQ 1508
            +YG +  L+     VV +N  +   EV ++K  K  +GR  +    +LS    +I  + YGPLWK  ++ +H  L         L +I+ +      ET+     +++  +++  +L     NV+  L FN  +   D +++      QG ++ + + +    FP  +     D   +++  KV +QL   LQ +  EH++       C D    ++ A+ +  L+ ++    + G++LTD H+  ++ D+  A  E       W    L  YP +Q+ I+ E+     D  + +  H     +  +PY  A + E  R          H ++ D +IG Y IPK + +V+NL+++HHD+K+W  P+  +P  FL E G+        ++P+G G+R C+G   ++  LF+ +  V+  + +   +++    ++ K  V ++ V+ F ++
Sbjct:   64 RYGSLYGLWMGSHYVVVVNSYQHAREVLLKK-GKAFAGRPRTVTTDLLSRGGKDIAFASYGPLWKFQRKLVHAALSMFGEGSVALEKIICREAASLCETLG---AAQDMALDMAPELTRAVTNVVCSLCFNSSYRRGDPEFEAMLEYSQGIVDTVAKESLVDIFPWLQIFPNRDLALLKRCLKVRDQL---LQQKFTEHKEA-----FCGDTVRDLMDALLQVRLNAENNSPLEPGLELTDDHLLMTVGDIFGAGVETTTTVLKWAVLYLLHYPEVQKKIQEEM-----DQKIGLARHPHLSDRPLLPYLEATISEGLRIRPVSPLLIPHVSLADTSIGEYSIPKGARVVINLWSVHHDEKEWDKPEEFNPGRFLDEQGQHIHSPSPSYLPFGAGIRVCLGEVLAKMELFLFLAWVLQRFTLECPQDQPLPSLEGKFGVVLQ-VQKFRVK 495          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|Q92113|CP17A_SQUAC (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias OX=7797 GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.096e-32
Identity = 114/431 (26.45%), Postives = 191/431 (44.32%), Query Frame = 3
Query:  183 IVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVD-----YKKY-QGAIEVIPQ------YAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNV--EVT--LHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSF-KRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            + QK    YG + +L       V IN+ +   EV ++K  K  +GR +     +LS    +I    YGP WK  ++ +   L    +     E M  C +       + R   N   ++  D+     NVI +L FN  +   D      +KY QG +  + +      +     FPN+         ++  L++       +LQ + ++H  K +Y     +    +LL  +    +  S      LTD H+  ++ D+  A  E    +F W+   L  +P +Q+ I+ EI     D+N+  E T  +  K  M + NA + EI R          H  + D +IG Y IPK + +++NL+AIHHD+K+WKNPD  DP  FL EDG+      + ++P+G G R C+G   +   LF+    ++  + +
Sbjct:   57 LFQKLQKTYGNLFSLMMGPHYAVVINNHQHAKEVLLKK-GKIFAGRPSMVTTDLLSRGGKDIAFGKYGPAWKFHRKLVLSALHLFGDGSAGIEKMI-CQEATSMCSTFER-LNNAAHDMMPDVTRAVTNVICLLCFNSTYEKEDPEFQTMRKYSQGIVNTVAKDSLIDIFPWLQFFPNE---------NLHTLKQCIATRDSILQKKFEDH--KANYSSDSANDLFNILLKAKMNAENNNSSVHEAGLTDDHMVMTVADIFGAGVETSSTAFAWMIIYLIHHPEVQKKIQEEI-----DSNIGFERTPKMSDKGNMNFLNATIHEILRIQPVSPLLIPHVALADSSIGDYTIPKGTRVIINLWAIHHDEKEWKNPDAFDPGRFLDEDGKYVCSSSESYLPFGAGTRVCLGEMLARMELFLFTSWILQRFTV 468          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P70085|CP17A_ORYLA (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes OX=8090 GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.989e-32
Identity = 105/458 (22.93%), Postives = 208/458 (45.41%), Query Frame = 3
Query:  168 LIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGL----RHCANLDRLNEIMYKCFDKFKETVEYRRGSKNG-GIEVDNDLFWMADNVITMLLFNEIFNDVD------YKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIAC-FDITDFVLLA---VEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFK-RRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVE 1493
            +++K++ QKY    G   +L      V+ +N      EV +++  +  +GR  +    +L+ +  +I   DY   W+  ++ +H  L       A+L R+      C +           +  G  +++  +L     NVI  L FN  ++  D       +  QG ++ + + +    FP  +     D + +++   V +QL   LQ + +EH  K DY      D+ D +L A    E  +   +     + L+D H+  ++ D+  A  E       W    L  YP +Q+ I+ E+++ +   +    L  +  +P+  A + E+ R          H  + D ++G + + K + +V+NL+++HHD+K+W NPD+ +P  FLS DG S       ++P+G GLR C+G   ++  LF+ +  ++  + +    ++S   ++ K  V ++ V+
Sbjct:   56 VLFKELQQKY----GQTYSLKMGSHQVIIVNHHAHAREVLLKR-GRTFAGRPRTVTTDVLTRDGKDIAFGDYSATWRFHRKIVHGALCMFGEGSASLQRI-----ICTEAQSLCSTLSEAAATGLALDLSPELTRAVTNVICSLCFNSSYSRGDPEFEAMLRYSQGIVDTVAKDSLVDIFPWLQIFPNKDLRLLKQCVAVRDQL---LQKKFEEH--KSDYSDHVQRDLLDALLRAKRSAENNNTAAEFSAEAVGLSDDHLLMTVGDIFGAGVETTTTVLKWAITYLIHYPEVQKQIQEELDR-KVGVDRPPQLSDRGSLPFLEATIREVLRIRPVAPLLIPHVALSDTSLGDFTVRKGTRVVINLWSLHHDEKEWTNPDLFNPGRFLSADGSSLTLPSSSYLPFGAGLRVCLGEALAKMELFLFLSWILQRFTLSVPPSQSLPSLEGKFGVVLQPVK 497          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|O57525|CP17A_RANDY (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii OX=71582 GN=CYP17A1 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 3.325e-31
Identity = 106/443 (23.93%), Postives = 196/443 (44.24%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDF--------KSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDG-RSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNI 1505
            KYG + +       VV +N+ E   EV ++K  K   GR  +    IL+ +  +I  +DY P WK  ++ +H  L  C   +    I      +     +     +   +++  +L     NV+  L FN       YK+     E + +Y++       K S    F        K ++ L++      ++LQ +I+EH K         D+ D +L A      +  +    + LT+ H+  ++ D+  A  E       W    L  YP +Q+ I+ E++  +        L  +  + YT A + E+ R          H  + + +IG Y IPK++ +V+NL+++HHD+K+W NP +  P  FL E+G R +     F+P+G G+R C+G   ++  +F+ +  ++  + +   +      ++ K  V I+ V+PF +
Sbjct:   73 KYGSLYSFMMGSHYVVVVNNHEDAREVLLKK-GKTFGGRPRTVTTDILTRDGKDIAFADYSPTWKFHRKMVHSAL--CMFGEGTVAIEQIISREAASLCQTLTSFQRIPLDMAPELIRAVTNVVCSLCFN-----TRYKRGDAEFETMLKYSKGIVDTVAKDSLVDIFPWLQIFPNKDLDILRQSVAARDQLLQKKINEH-KDAFCGETVKDLVDALLKAKLNMENNNSNVSQDVGLTEDHILMTVGDIFGAGVETTSTVLKWAVAYLLHYPEVQKKIQEELD-VKVGFGRYPLLSDRKILHYTEAAISEVLRIRPVSPLLIPHVALKESSIGEYTIPKEARVVINLWSLHHDEKEWVNPHLFSPDRFLDENGNRVYSPSPSFLPFGAGIRVCLGEALAKMEVFLFLSWILQRFTLEVPEGDPLPDLEGKFGVVIQ-VKPFKV 504          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P30437|CP17A_ONCMY (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss OX=8022 GN=cyp17a1 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.385e-31
Identity = 102/453 (22.52%), Postives = 209/453 (46.14%), Query Frame = 3
Query:  183 IVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGL----RHCANLDRL--NEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKY----QGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYK-IACFDITDFVLLA--VEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFK-RRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVE 1493
            + QK   KYG   +L      V+ +N  +   EV ++K  K  +GR  +    +L+ +  +I  +DYG  W+  ++ +H  L       A+++++   E +  C D  +E       S +  +++  +L     NV+  L F+  +   D +++      QG ++ + + +    FP  +    +D + +++   + ++L   LQ + +EH  K DY      D+ D +L A    E +   +     + L++ H+  ++ D+  A  E       W    L  +P +Q+ I+ E++     +     L  +  +PY  A + E+ R          H    D +IG + + K + I++NL+++HHD+K+WKNP++ DP  FL+E+G         ++P+G G+R C+G   ++  +F+ +  ++    M     +    ++ K  V ++ V+
Sbjct:   58 LFQKLQQKYGHTYSLMMGPHTVILVNHHQHAKEVLLKK-GKIFAGRPRTVTTDLLTRDGKDIAFADYGATWRFHRKTVHGALCMFGEGSASIEKIICREALSLC-DTLRE-------SGSASLDLSPELTRAVTNVVCSLCFSSSYCRGDPEFEAMLQFSQGIVDTVAKDSLVDIFPWLQVFPNADLRLLKQCVSIRDKL---LQKKYEEH--KSDYSDHEQRDLLDALLRAKRSAENNNTAEITMETVGLSEDHLLMTVGDIFGAGVETTSTVLKWAIAYLIHHPQVQQRIQEELDSVVGGDRTP-QLSDRGSLPYLEATIREVLRIRPVAPLLIPHVAQTDTSIGKFTVRKGARIIINLWSLHHDEKEWKNPEMFDPGRFLNEEGTGLCIPSPSYLPFGAGVRVCLGEALAKMEIFLFLSWILQRLTMTVSPGQPLPSLEGKFGVVLQPVK 495          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: C3ZZH5 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_145601 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.245e-41
Identity = 114/417 (27.34%), Postives = 201/417 (48.20%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDY----KKYQGAIEVIPQYAEECDFPNDK--PSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIK----LTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYK 1421
            YG + +L    T VV +N ++   E FV+K  +  +GR       I S    +I  +DY P WK  ++  H  +R  A+   L     K  +  ++T+      +   +++++ ++ +  NVI    F   +N  D D+    K  +   E   Q      +P  +  PS      SV   +K+ +QL+E++Q  +++HR+  D      DITD ++ A ++      +++ GI+    LTD H++  + D+ FA       +  W    LA++P IQE +  E++     + +   L  +   PYT A+  E+ R AS D  +  H+T  D  +  Y+IPK + I+ NL+A+HHD   W +PD+  P+ FL E G+   +    +P+G+G R C G    +   F+L+  +V N++
Sbjct:   11 YGDVFSLKMGMTDVVVLNSLDAVKEAFVKK-GEDFAGRPKMLSTDISSEGGKDIAFADYSPTWKLHRKLFHSAIRGYASAQNLQS---KVHESLEDTIAVFSKMEGQAVDLEDYIYQLVYNVICSAAFGTRYNMDDEDFNTLMKISKDTTETFGQGLLADVYPLLRFLPSS-----SVTANRKMTHQLMEIMQRHLEQHRESFDPN-NLRDITDHMIKAQKD------AEEEGIQDIDSLTDTHLRQLIGDIFFAGTISTILTLRWAILYLAVHPEIQEKVAAELDSVVGRDRLP-ELSDREATPYTEAIFHEVMRMASMDPVSLPHATTVDTTLRGYQIPKGTWILPNLWALHHDPDTWGDPDVFRPERFLDESGKPIPKPAALMPFGVGRRACPGEALGKADTFLLLGGLVQNFR 410          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: C3YIB9 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_211258 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.937e-40
Identity = 116/451 (25.72%), Postives = 212/451 (47.01%), Query Frame = 3
Query:   96 ISSYKLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQGAIEVIPQYAEECDFPNDKPSKK---SDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIK----LTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYK 1421
            +  +++PPGP       +   N ++    I      KYG + +L    T VV +N ++   E FV+K     +GR      +IL+    +I  +DY P WK L R L  G+ H         +  K  +  ++T+      +   ++++  ++ +  NVI    F   +N  D D+       + + +   +    +  PS +   S  +S+   +K+  Q + +LQ  ++EHR+  D      DITD ++ A ++      +++ GI+    LTD H++ ++ DV     +    +  W    LA +P IQE +  E++     + +   +  +  MPYT A + EI R  S    +  H+T  D  +  Y+IPK + I+ NL+A+HHD   W +PD+  P+ FL EDG+   +    +P+  G R C G+  ++ V ++L+  +V N++
Sbjct:   20 MKRWRMPPGPFFWPIIGNIYCNGRMYITFI--DLAQKYGDVFSLKMGMTDVVVLNSLDAVKEAFVKK-GVDFAGRPKILSNEILTEGGKDIAFTDYSPTWK-LHRKLFHGVTHWGQ-----NLQTKVHESLEDTIAEFSKMEGQAVDLEGYIYKLVYNVICSTAFGVRYNMDDEDFITLMKISKDMTETLGQGLLADVYPSLRFLPSPGESLTAFRKMTEQSLTILQRHLEEHRETFDPS-NLRDITDHMIKAQKD------AEEEGIQDINSLTDTHLRQTMNDVFAGGTDTTIWTLRWANLYLAAHPEIQEKVAAELDSVVGRDRLP-EMSDREAMPYTEATIHEIMRMGSIAPLSLPHATTVDTTLSGYQIPKGTWIMPNLWALHHDPDTWGDPDVFRPERFLDEDGKPIPKPAALMPFSAGRRACPGDAVAKAVTYLLLGGLVQNFR 453          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A1S3I374 (cytochrome P450 1A1 OS=Lingula unguis OX=7574 GN=LOC106160616 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 8.323e-39
Identity = 116/444 (26.13%), Postives = 219/444 (49.32%), Query Frame = 3
Query:  105 YKLPPGPNRNSDEADFII--NEKLIYKKIVQKYIPKYGPICTL-YKDGTPVVFINDIETGYEVFVRKLSKQVSGRSA-SYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKYQGAIEVIPQYAEECDFPND--KPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKR--RKDFVPYGLGLRTCVGNTFSE-NVLFVLIML 1403
            YKLPPGP +      +    N+  +Y  +  K    +G + ++       VV +   +  +E  V K  +  +GR   ++  ++ SG + +++ SDYGP+W+  ++   K  R     D+L       FD+    +E      +  + +   +F    N++  + F +++  N+ ++   +G ++   +       P+D     K     S    +++   LI+  ++++++H++  +   A  DITD +LL  EE   + +   +   L+DL + H+++D+ FA  +   ++ +W+    A  PNIQE I  E++   DD         +SK+PY  AV  E+ R   A   +  H  + D  +G Y+IPK++LI  N++AIHHD K W++P++  P+ FL +DG S K   +K ++P+  G R CVG   +  N++ +LI+ 
Sbjct:   34 YKLPPGPPQLPILGSYFAFRNDGRLYS-VFSKLGKSFGDLFSVDLGFWHTVVVLKSADIVHEALVEK-KETFAGRGVLTWKYELFSGRKRDLIFSDYGPVWRLQKQMALKAFRTYVASDKLEMFTRSAFDEIAALIEKETEPFDMHVYMRLLIF----NIVCRMAFGKVYKINEPEFVWLKGTLDESMEKVYGSIIPSDVIPVLKHLPIPSSLSTKRLLQGLIDFQKVKLEDHKRTINLGEAR-DITDQMLLLREELTAE-RDDDVKESLSDLRILHTILDIFFAGTQTTSDTLIWMILYAADNPNIQEKIHEELDSLGDDFCD--LRQCRSKLPYCEAVQREVLRMRPAGPVSIPHRALCDTKLGGYDIPKNTLIFANIWAIHHDPKNWESPEVFMPERFLEKDG-SLKELDKKTWLPFSSGKRKCVGEAIARTNIMTILILF 466          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: C3YIB7 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_73418 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 5.727e-38
Identity = 112/426 (26.29%), Postives = 205/426 (48.12%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECD-------FPNDK--PSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIK----LTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKS 1445
            YG + +L    T VV +N ++   E F++K     +GR       I S    +I+ +DY P WK  ++  H  +R  A+   L     K  +  K+T+      +  G+ +D+ L+ +  NVI    F   +N +D + ++  ++V    AE          +P  +  PS      +V   +K+ +Q++ ++Q  +++H++  D      DITD ++ A ++      +++ GI+    LTD H++ ++ D+ F        S  W    LA++P IQE +  E++     + +   L  +   PY  A + E+ R AS D  +  H+T  D  +  Y+IPK ++++ NL+A+HHD   W +PD+  P+ FL E+G+  K     +P+  G R C G T  +   F+L+  +V N++    K + 
Sbjct:   53 YGDVFSLKLGMTDVVVLNSLDAVKEAFMKK-GADFAGRPKMLSMDISSEGGKDIVFTDYNPTWKLHRKLFHGAIRGYASGQNLQS---KVHESLKDTIAEFTKMEGQGVNLDDYLYQLVYNVICSAAFGVRYN-MDDENFKTLMKVSKDAAERFGQGFLADVYPLLRFLPSP-----TVTACRKMMDQILGIMQCHLEQHKETFDPSNR-RDITDHMIKAQKD------AEEEGIQDINSLTDTHLRQTISDIFFGGTFSSIFSLRWALLYLAVHPEIQEKVAAELDSVVGRDRLP-ELSDREATPYMEATIHEVMRMASMDPLSLPHATTVDTTLRGYQIPKGTMVMPNLWALHHDPDTWGDPDVFRPERFLDENGKPVKPAA-LMPFSAGRRACPGETLGKANNFLLLGGLVQNFRFSISKGEG 459          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A210R6Z5 (Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16032 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.886e-37
Identity = 113/461 (24.51%), Postives = 223/461 (48.37%), Query Frame = 3
Query:   75 IITMNRTISSYKLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIE-VDNDLFWMADNVITMLLFNEI--FNDVDYKKYQGAIEVIPQYAEECDF---PNDKP--SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRK---KGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            +  + R I+  K PPGP       ++ +       +   +   KYGP+ T+    +  V +N IET  E  V++ +   +GR        LS    +IL S Y P  K  ++ +   LR       L  I+ K   +F +  E  +G+     E +D  LF    N+I  + F ++  F+D  +K Y   +++  Q+  E       +  P  +K    +  +K+  +F +L+  +   ++ H++   +G+ +    D  D +L+A +E   +   + L  +LTD+H++ +L D   A+ +    +  W    +A + ++Q  ++ E+++    + +   +  +  +PYT A L E+ R AS       H TM D ++G Y +PK + +++N +A+H+D + WK P  +DP+ FL+ DG   ++ + F+P+  GLR C+G + ++  L +++ L++  + +
Sbjct:   37 VFILCRLITKPKYPPGPMALPVIGNYKLLTDPKIHEACARLSEKYGPVVTVQFGPSKTVVLNSIETVVEAMVKRRA-DFAGRPPVPSGMTLSEGGKDILMSQYTPSLKVHRKIVSAALRKYIKGPFLQTILEKSMGQFIKLFEETKGNPFIPHEYIDLALF----NIICGVCFQKVYKFDDPKFKHY---LDIDNQFVAEFGMGLIEDLYPILAKVWQSQRYKKVVSLFRELLHYIHEELEAHKQDFDEGNIR----DFADCLLMARKEAENEEDVEILS-QLTDVHLRQTLSDTFTAAFDTTRFTIQWALLYMADHQDVQRKVQAELDRVVGRDRLP-RVDDRPSLPYTEATLFEVMRIASVAPLGMPHMTMVDSSVGGYTVPKGTTVIINHWALHNDPRHWKEPSKLDPERFLNSDGTLARKPESFLPFSAGLRVCLGESTAKPELVIILALILHQFNI 483          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: cyp17a2 (cytochrome P450, family 17, subfamily A, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-100822-1])

HSP 1 Score: 130.568 bits (327), Expect = 2.484e-32
Identity = 94/441 (21.32%), Postives = 190/441 (43.08%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCA-NLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQ------GAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHR---KKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIK-LTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVE 1493
            +YGP+ +L       + ++++    EV + +  +  +GR       +++    +I  +DY PLWK  +R +H           +L  I+    +     ++  RG     +++   L     NV+  L+FN  +   D +  Q      G ++ I +      FP  +     D   + +   + ++L   L  +++EH+     G+ +    D+ D +L+         +S   G   +TD HV  +  +   A  E    + +W    L  +P +Q+ +  E+++ +   +    L  +S +P+ ++ LCE+ R          H  M D ++G + +PK + +++N++AIHHD K W+ PD   P  FL   G+       F+P+G G R CVG + +   LF+ +  ++  +        S   +  +  V ++ + 
Sbjct:   69 RYGPLFSLRAGRNYTLVVSEVGLAREVLLHR-GRDFAGRPQMVTTALMTRGGKDIAFADYSPLWKKHRRLVHSSFTLFGEGSSKLQNIVLDAAESLCSDLQACRGQH---VDLCPMLMRAVTNVVCRLVFNSSYRPHDPELQQVMDYNDGIVQTIARGGLVDIFPWLQIFPNKDLAKLRECVSIRDKL---LTKKLEEHKLTYTPGEPR----DLLDALLIG--------QSGSAGEDDITDDHVLMTAAEAFGAGVETTSTTLLWTIAFLLHHPQVQDRLHAELDE-QVGRDRPPALSDRSNLPFLDSALCEVMRIRPVSPILIPHVAMQDTSLGGHAVPKGTRVLVNMWAIHHDPKHWEEPDQFRPDRFLDATGKKIA-PPSFLPFGAGPRVCVGESLARMELFLFVSCLLQRFHFSVPAGASLPDLQGRYGVVLQPLR 488          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000044947.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:11445979:11463125:-1 gene:ENSAMXG00000016265.2 transcript:ENSAMXT00000044947.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 4.037e-32
Identity = 105/443 (23.70%), Postives = 186/443 (41.99%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKYQGAIEVIPQYAEEC------DFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKN-AVFIRDVEPFNI 1505
            +YG I  LY   T +V +N  E   E  V+K S   +GR +SY    +SG   NI   DY  +WK  +R +H  L+ C      + I  +     +  ++YR  +    +++  D    A NVIT L F + +  +  + +K  G +  I              FP  +      F     L K   +  E++   +DE +++   K         +  ++E      K K L   LTD  +  + ID++    E       W    L   P +Q  +  E+         + +   + ++PY  AV+ E+ R          H+   D +I  Y IPK+++I+ NL+  HHD   W  P    P+ FL   G S    +  +P+G G R C+G + ++  LF+    ++ +++ +    + +E+ D +  A  +   +P+ +
Sbjct:   93 RYGNIYRLYCGSTTMVILNSSEFIREALVKKWS-DFAGRPSSYTGDKVSGGGQNISLGDYSEVWKAQRRVVHNALQRCTAESLHSVIETQALHLKQVLLDYREKA----VDLSEDFTVAASNVITTLAFAKSYDKSSAELQKLHGCLNKIVSLWGSLWISVLDSFPLLRRLPNPHF---SLLMKEVARRDEIIVGLLDEFKQRSGAKDGGTLTASLLQHSLESADKTAKPKTL---LTDTQLHMTTIDLLIGGTETTAAWLCWTVAFLLHRPEVQTGVYEELCSVLKGQYPQYSD--RHRLPYLCAVINEVLRLRPVAPLAVPHTAKRDSSIAGYFIPKNTVIIPNLFGAHHDPAVWSEPFTFRPERFLEGGGGSL---RALMPFGGGARLCLGESVAKMELFLFTAYLLRDFQFL--PEQPEELPDLRGVATVVLKAKPYRV 517          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: cyp17a1 (steroid 17-alpha-hydroxylase/17,20 lyase [Source:NCBI gene;Acc:103036160])

HSP 1 Score: 126.331 bits (316), Expect = 1.145e-30
Identity = 96/420 (22.86%), Postives = 193/420 (45.95%), Query Frame = 3
Query:  189 QKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKY----QGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEI-NKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRK-DFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            Q+   KYG I +L      V+ +N      EV ++K  K  +GR+ +    IL+ +  +I  +DY   W+  ++ +H  L  C   +    I      +     +     +N  +++  +L     NV+  L F+  +   D +++      QG ++ + + +    FP  +     D + + +   + ++L   LQ + +EH+      +   D+ D +L A      +  S +  + LT+ H+  ++ D+  A  E       W    L  +P +Q+ I+ E+ +K   D + +  L  +  +PY  A + E+ R          H  + D +IG Y + K + +++NL+++HHD+K+WKNP++ DP  FL E+G         ++P+G G+R C+G   ++  LF+ +  ++  + +
Sbjct:   62 QQLQKKYGDIYSLMMGSHKVLIVNSHHHAKEVLLKK-GKIFAGRARTVTTDILTRDGKDIAFADYSATWRFHRKMVHGAL--CMFGEGSASIEKIICREASSMCKVLTDLQNSAVDMAPELTRAVTNVVCSLCFSSAYKRGDAEFEAMLQYSQGILDTVAKDSLVDIFPWLQFFPNEDLRILRQCVSIRDKL---LQKKYEEHKANYSDNVQ-RDLLDALLRAKSSSENNNTSTQ-DVGLTEDHLLMTVGDIFGAGVETTTTVLKWSIAYLIHHPQVQKKIQEELDSKIGRDRHPQ--LSDRGNLPYLEATIREVLRIRPVSPLLIPHVALSDSSIGEYTVQKGTRVIVNLWSLHHDEKEWKNPELFDPGRFLDEEGNGLCNPSLSYLPFGAGIRVCLGEALAKMELFLFLSWILQRFTL 471          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000016766.2 (pep primary_assembly:Astyanax_mexicanus-2.0:11:11445979:11462938:-1 gene:ENSAMXG00000016265.2 transcript:ENSAMXT00000016766.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 3.291e-30
Identity = 103/449 (22.94%), Postives = 186/449 (41.43%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKYQGA------------IEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKN-AVFIRDVEPFNI 1505
            +YG I  LY   T +V +N  E   E  V+K S   +GR +SY    +SG   NI   DY  +WK  +R +H  L+ C      + I  +     +  ++YR  +    +++  D    A NVIT L F + +  +  + +K  G             I V+  +      PN  P      K V +  ++   L++  +++I+         +    +   VLL+                LTD  +  + ID++    E       W    L   P +Q  +  E+         + +   + ++PY  AV+ E+ R          H+   D +I  Y IPK+++I+ NL+  HHD   W  P    P+ FL   G S    +  +P+G G R C+G + ++  LF+    ++ +++ +    + +E+ D +  A  +   +P+ +
Sbjct:   82 RYGNIYRLYCGSTTMVILNSSEFIREALVKKWS-DFAGRPSSYTGDKVSGGGQNISLGDYSEVWKAQRRVVHNALQRCTAESLHSVIETQALHLKQVLLDYREKA----VDLSEDFTVAASNVITTLAFAKSYDKSSAELQKLHGCLNKIVSLWGSLWISVLDSFPLLRRLPN--PHFSLLMKEVARRDEIIVGLLDEFKVKIE---------MLIMSVALSVLLSQ--------------LLTDTQLHMTTIDLLIGGTETTAAWLCWTVAFLLHRPEVQTGVYEELCSVLKGQYPQYSD--RHRLPYLCAVINEVLRLRPVAPLAVPHTAKRDSSIAGYFIPKNTVIIPNLFGAHHDPAVWSEPFTFRPERFLEGGGGSL---RALMPFGGGARLCLGESVAKMELFLFTAYLLRDFQFL--PEQPEELPDLRGVATVVLKAKPYRV 493          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000055532.1 (cytochrome P450 2J2-like [Source:NCBI gene;Acc:103031006])

HSP 1 Score: 124.02 bits (310), Expect = 5.807e-30
Identity = 120/472 (25.42%), Postives = 197/472 (41.74%), Query Frame = 3
Query:   99 SSYKLPPGPNRNSDEADFIINEKLIYKKIVQ--KYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSK-----NGGIEVDNDLFW-------MADNVITMLLFNEIFNDVDYKKYQGAIEV-----------IPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLH---VKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVW 1430
            S  + PPGP        F+ N   I K  +   K +PKYG +C++Y    P + +N ++   E FV+  +   S        K   G    I+ + YG  WK  +R     LR               F   K+TVE R   +        ++ +   F+          N+I  ++F + F + D K++   +E+           I Q      F    P         +K+ K  N L E +    +EHRK  D +    ++ DF+     + +L    K+   + +  H   +  S  D+  A  E   N+  W    +  +P++QE    EI +    +    ++  ++++PYT+A + EIQR A+       H T     +  Y IP+ + I+ NL AI  DK  WK PD  +P+NFL E G+ F +   F+P+ LG R C+G T +   LF+    ++   K  W
Sbjct:   35 SRSRSPPGPK----PMLFVGNLPQIMKDRMAFIKMMPKYGEMCSMYLGKKPTIVLNTVQIAKEAFVQNGTVFSSRPDNRLIRKFTQG--CGIIMAPYGNSWKQQRRFALHTLRD--------------FGLGKKTVEERVAEEARYLIKEMLKQEGKAFYPIHPIMNAVSNIICSIVFGDRF-EYDDKQFAKLLEILNENVRFTGSFISQTYLVIPFVEHLPGPH------QKVWKNLNSLREFILGVAEEHRKTLDPE----NLRDFI-----DAYLVEMIKQESNEDSTFHEENMAKSTADLFSAGTETTANTLRWGLIYMMEHPDVQERCHEEIVRVLGFDRFP-SMDDRAQLPYTHATVHEIQRNANIIPLGVMHHTTQPTTLRGYHIPQGTDIMSNLTAILTDKDHWKYPDTFNPENFLDEKGQ-FCKNDSFLPFSLGPRVCLGETLARTELFIFFTSLIQRLKFSW 468          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 127.102 bits (318), Expect = 1.256e-31
Identity = 104/423 (24.59%), Postives = 182/423 (43.03%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYK------------KYQG--AIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKD---FVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            YG +  L   G  +V +N++E+  E+ ++K S   +GR  +Y    ++G   +I   DY  +W+  +R     L HC    R  EI+     +  E +    G      ++  D+     NVI  + F   ++  D +            +  G  AI  +  +     FPN  P+ +    +V K         EV+  +I  H+ K     +  D+TDF+L        + +S+  G  LT+  V  S++D   A  E       W    L L+P +Q+ I  E+ + +    +  +L  + K+ Y +A + EI R          H  + D ++G + I K S ++ NL+A H D   W NP +  P  FL   G S +RR      +P+G G R C+G + ++  +F+ +  V+   ++
Sbjct:   75 YGAVYCLRVGGEDIVVLNNVESIKEMLIKK-SADFAGRPQTYAGGKITGGGKDIALGDYSAVWRRQRRAALSAL-HCVGTARTEEIVQGEAQRLVEDLTQYIGRPT---DIHTDISMRVCNVICSVAFGTKYDKHDTEFLDIHCCLDSLVRLWGSPAIRALDCFPVLRLFPN--PAWRDLMAAVRKRD-------EVVWRQILLHKAKPSSSPS-SDMTDFLLKFTRHSRNEEESEARGGILTEERVHLSIMDTFIAGVETTATLIEWALAYLVLHPEVQDQIYEEMEQ-KLQPGLGPSLADRDKLLYLDATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFL---GESLERRNPASLLLPFGAGKRVCLGESLAKAEIFLFLGHVLRRLRL 478          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: cyp1d1 (cytochrome P450, family 1, subfamily D, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-041114-179])

HSP 1 Score: 110.153 bits (274), Expect = 6.674e-26
Identity = 98/448 (21.88%), Postives = 193/448 (43.08%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRH-CANLDRLNEIMYKCFDKFKETVEYRR--------GSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKYQGAIEVIPQYAEECD----FPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHR---KKGDYKIACFDITD-FVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRR--KDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIR 1484
            +YG +  ++    PVV ++ +ET     V+      +GR   Y   ++           Y   WK  +R     LR+ CA   R     Y C  +     E  R        G++ GG +    +     NV+  L+F + +   D  + +  G  E   Q +   +    FP  +    +  ++++ L     +L+  ++  I EH    +KG  +    DITD  + +  E+ H     +++G  L+D  V  + +D+  A  + +     W    L ++P++Q  ++ EI++    +        ++ +    A L E+ R+++   FT  HST  D+ +    IP+D+ + +NL+ ++HD   W +P+  DP  FLS DG+   +   +    +GLG R C+G+  +   LFV+++ ++               +  ++A+ ++
Sbjct:   87 RYGDVFRVHLGSVPVVVLSGLETIKRALVKN-GDAFAGRPPFYSLSLVGNGDTLTFTRAYDGCWKAHKRLARSALRNFCAAPARREG--YACLLEECVCEEAERLLLACKGGGAQPGGFDPVPSITCAVANVMCALVFGKRYPHGDPTFLQIVGFNEEASQLSGAGNLVDFFPFLRHVPNAQLRALKVLSA---RLLAFMEGHIKEHYSSYQKGHVR----DITDALIAMCAEQEH---ALREVG--LSDERVVATALDIFGAGFDTIITGLTWCLLYLCIHPDVQHKLQREIDETIGRDRTP-RFEDRANLRRVEAFLTEMFRHSAFVPFTIPHSTTQDVVLNGMFIPRDTCVFVNLHQVNHDPTVWSDPERFDPDRFLSHDGKEVNKEMVEKVQIFGLGKRRCLGDMVARQELFVVLVTLLQGLSFRVPPGTPTPSVAPQHALVMK 518          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 9.197e-26
Identity = 105/445 (23.60%), Postives = 192/445 (43.15%), Query Frame = 3
Query:  186 VQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRH-----CANLDRLN-EIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQGAIEVIPQYAEE-----CD-FPN----DKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDK 1466
            +Q+   KYG +CT+    TPVV ++  E   EV V +   + + R  +     L+ N    L + YG  WK  +R     LR+         D+++ E  Y       ET +    + +  + ++N L     N+I  LL    ++  +  ++K    +E + Q   E     C+ FP       P +K  F    KLQ + N ++   +   D+H  +        D+ D  L  +++   +P S       T   +   LI++     E   N+  W    + + P+IQ     EI++             +S +PY +AV+ EIQR+ +       H+T  D+    Y  PK + +++NL +  HD   WK P+  +P +FL +DG+  +    F+P+  G R C+G + ++  +F+    ++ +++  W  + S   +  K
Sbjct:   63 MQELAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNR-GHEFADRPITPIFTKLTQNIGIAL-APYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKY-----LIETFKQETSAFDPHLNLNNAL----GNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVILCNVFPFLLKLPGPWQKV-FHIHSKLQCLLNDIVSEHRATKDQHNPR--------DLIDSYLAQIDKEKDNPNSS-----FTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRS-LPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQCIQ-SDAFLPFSAGPRVCLGESLAKMEIFLFFTSLLQHFEFYWPNSVSPPTLAAK 480          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002462.1 (pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 gene:ENSPMAG00000002249.1 transcript:ENSPMAT00000002462.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 2.230e-25
Identity = 69/236 (29.24%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  756 LQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQ-ENIRTEINKF----RDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQ 1448
             Q RI EHR+  +      D+ D  L  +E+   DP+S       TD ++ + + D+  A  E    +  W    +  YP IQ E  + EI++     R  N  +     ++ +PYT+AV+ E QR A+       HST  D+    Y IPK + ++LNL ++ HD+ QWK P+  +P +FL   G+ F +   F+ +  G R C+G   +   LF+    ++  +K  W    S+
Sbjct:   83 FQERIREHRQTREAGQPR-DLIDAYLDEMEKESQDPEST-----FTDGNLLNVVGDLFIAGTETSSTTLRWALLYMMAYPQIQAERCQREIDEVIGGDRSPNTTD-----RANLPYTDAVIHEAQRMANVAPLGVLHSTTTDVKFRGYNIPKGTKVLLNLTSVLHDETQWKTPNEFNPDHFLDNTGQ-FVKPDAFLAFSAGPRVCLGENLARMELFLFFTSLLQRFKFHWPDATSR 306          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: cyp2u1 (cytochrome P450, family 2, subfamily U, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-070730-1])

HSP 1 Score: 104.375 bits (259), Expect = 4.459e-25
Identity = 49/179 (27.37%), Postives = 90/179 (50.28%), Query Frame = 3
Query:  921 DVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDIN--IGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQE 1451
            D+  A  +   N+ +W   L+  YP +Q  ++ E++         V+L  + ++P T A + E+QR +S       HS    +   +  + IP+ S+++LNL+A H D + W  P + DP+ FL   GR  +RR  F+P+G+G R+C+G + +   LF+    ++  +        S +
Sbjct:  106 DLFIAGTDTTANTLLWCLLLMCTYPAVQARVQAELDAVVGRGR-RVSLSDRPRLPLTVATIMEVQRLSSVVPLAIPHSATRSVRTELRGFTIPRGSVVLLNLWACHVDPRVWARPLLFDPERFLDPHGR-LRRRDAFMPFGIGRRSCLGESLARVELFLFFSALMQEFTFTSSAPHSPD 282          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Yeast
Match: ERG5 (C-22 sterol desaturase; a cytochrome P450 enzyme that catalyzes the formation of the C-22(23) double bond in the sterol side chain in ergosterol biosynthesis; may be a target of azole antifungal drugs [Source:SGD;Acc:S000004617])

HSP 1 Score: 75.0998 bits (183), Expect = 8.389e-15
Identity = 44/164 (26.83%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  885 KLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRD-DNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGP-YEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTF 1370
            + T+  +  ++   +FASQ+   +   W+F ++A  P++   IR E    R+ D + E+ L    KM YTN V+ E  RY        +     +  + P Y  PK ++++  LY   HD + ++NPD   P+ ++ E  ++ + +K+++ +G G   C+G T+
Sbjct:  320 EFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPY-VVKKNFPVSPNYTAPKGAMLIPTLYPALHDPEVYENPDEFIPERWV-EGSKASEAKKNWLVFGCGPHVCLGQTY 481          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Yeast
Match: ERG11 (Lanosterol 14-alpha-demethylase; catalyzes C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in ergosterol biosynthesis pathway; transcriptionally down-regulated when ergosterol is in excess; member of cytochrome P450 family; associated and coordinately regulated with the P450 reductase Ncp1p; human CYP51A1 functionally complements the lethality of the erg11 null mutation [Source:SGD;Acc:S000001049])

HSP 1 Score: 51.2174 bits (121), Expect = 2.952e-7
Identity = 42/206 (20.39%), Postives = 84/206 (40.78%), Query Frame = 3
Query:  879 GIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINI--GPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKD---------------FVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKS 1445
            G+K+TD  + + LI V+   Q     +  W+   LA  P++Q+ +  E  +  D    E+T     +MP  N  + E  R       + F   M D+++    Y IP    ++++    H   + + N    +   +  +   S+   ++               ++P+G G   C+G  F+   L VL+ + +   K  + + K+
Sbjct:  296 GVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLR-MHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKT 500          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO41284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S507])

HSP 1 Score: 134.806 bits (338), Expect = 3.469e-34
Identity = 116/457 (25.38%), Postives = 212/457 (46.39%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGP--LWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEY------RRGSKNGGIEVDN--DLFWMADNVITMLLFNEIF--------NDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACF-DITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDD--NNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFH-STMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGR-SFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQ 1508
            YG I TL       VF++      EV + K    ++GR  ++    L+    +I+  DY    +W+  ++ +H GLR           MY  F K +E + +      R+  K+ G  + +  +   +  N+I+  L  + F          +++ +    + V     +   F    P  +S F   +KL ++ ++L++   +   EH  K  +   C  D+TD  L A  E   + K K +G ++TD H+   + DV FA  E    +  W+   L  YP +Q  ++T+I    DD   +    L  K  +PY  A + E+ R A+       H +T +++ +  Y IPKD++IV+NL+AIHHD ++W NPD  DP  F++EDG+     ++ ++P+  G R CVG + ++  LF+++  ++  + +     +    + + +    R  +PF  +
Sbjct:   60 YGDIFTLKIFNDRFVFVSSGAGAREVLMGKRMNDLAGRPQTFTFNFLTRGAKDIIFGDYSRHLVWR--RKIVHSGLR-----------MY--FPKLEENIAWEVSKLERKLMKDVGTALHSRDEFSLLITNIISSFLLGKSFEPDDPDFLTTLEFTRIGSQLPVSGSILDNFPFLVHLPISESRF--YKKLVEIRDRLLDKFFL---EH--KSTFSEDCIRDLTDAFLKAKLEVEREDK-KAIG-EVTDDHITMLMTDVYFAGLETTSTTLSWLAAYLINYPQVQTRLQTDI----DDVIGSRWPVLADKPNLPYMEATIAEVLRIATVAPMGLPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFINEDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTLETLPGQGPPSVGEASGNITRAPKPFKFR 488          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 129.798 bits (325), Expect = 9.848e-33
Identity = 96/416 (23.08%), Postives = 187/416 (44.95%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRH-CANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDF---------KSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSF-KRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYK 1421
            YG +  L      +V +N IE   E  VR+ +   +GR   Y   ++S N  +I   D+GPLWK  ++  H  LR   + L  L E +    D+  + +    G  +      +D+     N+I   +F   + D+D  ++   ++   Q+ +       + +   D+         K + ++++       VLQ +  EH    ++ +   D+TD +L A +      + +   + +T+ H+  ++ D+  A  E    S +W    L   P +QE +  +I++    +     L  +  +P   A + E+ R +S       HST  D ++  YE+PKD++++ N++ +HHD ++W NPD  DP  FL + G+        ++P+  G R C+  +  +  LF+ I  ++  ++
Sbjct:   19 YGEVFRLKVGSHRIVVVNSIEAAREALVRR-ANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNP---KDDVNLAVLNIICSFVFGSRY-DMDDPEFHTVVDYTEQFVQ-----GFRAASLVDYFPWLRHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYEHGV-IRDLTDALLSANKAS----QEESAYLPMTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAP-ELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFLDDKGKFICPATLSYLPFSAGRRVCLAESLGKMQLFLFISRLLHKFR 418          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO46605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN7])

HSP 1 Score: 129.028 bits (323), Expect = 2.622e-32
Identity = 99/403 (24.57%), Postives = 190/403 (47.15%), Query Frame = 3
Query:  237 GTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIF--NDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKS-DFKSVEKLQKVFNQLIEVLQIRIDEHR---KKGDYKIACFDITDFVLLAVEEY-HLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKM 1424
            G   V I++I+   +V ++K  + V+ R+++Y    +S N  +++   Y P WK  +R +H  LR   +  R+ E +     +     +    S+   ++    L     NVI  L+F + +  +D ++       E + + A   +     P  +    + V+K+++       ++Q +I EHR   K+G+ +    D+TD +L ++E+    D  +  L   LT+ H+  ++ DV  A  E    +  W+F  +A YP +Q  I  E++         +    KS +PY  A + E+ R +              +NIG Y IP+++ + +NL+AIHHD+ +W +P    P  FL  +G +       +P+G G+R CVG + ++  LF+ +  ++  +K+
Sbjct:   70 GKRFVIIDNIKLARQVLLKKNGRDVADRTSAYVIDAISRNGCSVIFGKYSPTWKLQRRVVHSALRMYGSGVRILEAL--ILQEVDNLCDIFANSQGAPVDTKLPLTLSVMNVICALVFGKRYGLDDAEFTDIVATTESMAKLASPENPLIYMPWLRFFPLQVVKKMKETVTARDRLIQRKITEHRETYKEGEIR----DLTDALLKSLEDAKQEDNNAMSL---LTEDHLLIAINDVFMAGFETTTTALRWIFLYVAAYPEVQARIHQELDDVISFGRDPLIADRKS-LPYLEATILEVLRISPVFPLIR-RKARKQLNIGGYCIPEETFVYVNLWAIHHDEAEWVDPYKFRPSRFL--EGTNSASAYSMLPFGAGVRVCVGESLAKMELFLFVSRLLHRFKL 459          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO49214 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHE7])

HSP 1 Score: 125.561 bits (314), Expect = 6.162e-31
Identity = 103/409 (25.18%), Postives = 183/409 (44.74%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSK--QVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAE---ECDFPNDKPSKKS-DFKSVEKLQKVFNQLIEVLQIRIDEHR---KKGDYKIACFDITDFVLLAVEEYHLDPKSKK---LGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVL 1394
            KYGP+  L      VV IND+       +++ S+    +GR+ S   +  SG+  +I    Y   W+   + L   +RHC    +   +     D+ ++ +       +   +   DL  +  NV + ++F  IF   D  ++Q  ++    ++E     +F +  P  +   F  ++K+++  ++  E+   +   H+   K+G  +    DI D ++ A ++ + +  S+    L   L  L   ++L + I A  E      +W   LLA YP++Q  ++  I+     ++V +T   +SK PY  AV+ E  R A+       H TM D  +  YEIPKD++   NL+ +HHD   W+NP    P   +   G         +P+ LG R+C     S  +LFVL
Sbjct:   78 KYGPVYKLRLGRQLVVVINDL-----ALIKEASRGSDFAGRAKSISGEFFSGHGKSIGFQTYSEQWRGQHKALTIAIRHCEG--KQGPLEATVADEVEKLLGRLAKQADSTFDPRLDLGLLVTNVFSRVIFGRIFKKED-GEFQSLLQQTLNFSEGLAAANFLDAFPFLQVFPFPVIKKMRETASRRDEIFLSQHQLHQVTFKEGRIR----DIADALIQAEKDENQNIGSRPDADLPRSLDGLKRMYTLNESIIAGIESPLTCIMWTVALLAKYPDVQAKLQKSIDDIIGRSHVLLTYQDRSKFPYVEAVIYEALRLATVLPVAIPHFTMADAKLAGYEIPKDTIAFFNLWNVHHDPGLWENPYEFKPDRLIDSKGEVIT--AGLLPFSLGTRSCPWEVSSRKMLFVL 472          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO41250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S508])

HSP 1 Score: 125.176 bits (313), Expect = 6.706e-31
Identity = 111/469 (23.67%), Postives = 200/469 (42.64%), Query Frame = 3
Query:  186 VQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGP--LWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNG--------GIEVDNDLFWMADNVITMLLFN--------EIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDF--KSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACF-DITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHW-----KSKMPYTNAVLCEIQRYASADTFTDFH-STMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGR-SFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQ 1508
              K    YG I  L       VF++      EV + K    ++GR  ++   +LS    +I+  DY    +W+  ++ +H GLR           MY  F K +E + +      G         I        +  N+I+  L          +    +++ +    + V     ++  F    P  +S F    VE   ++ ++          EH  K  +   C  D+TD  L A  E   + K K +G ++TD H+   + DV     E    +  W+   L  YP +Q  ++T+I+ F       +   W     K  +PY  A + E+ R A+       H +T +++ +  Y IPKD++IV+NL+AIHHD ++W NPD  DP  F++EDG+     ++ ++P+  G R CVG + ++  LF+++  ++  + +     +    + + +    R  +PF  +
Sbjct:   53 AAKLAKTYGDIFMLKIFNDRFVFVSSGAGAREVLMGKRMNDLAGRPQTFTFNLLSRGAKDIVLGDYSRHLVWR--RKIVHLGLR-----------MY--FPKLEENIAWEVSKLEGKLMEDIGAAIHSKEVFLLLITNIISSFLLGKSYEPDDPDFLTTLEFIRIGSQVPVSGSILDKFPFLYHLPISESRFYKNVVEPRDRLLDKFFL-------EH--KSTFSEDCIRDLTDAFLKAKLEVEREDK-KAIG-EVTDDHITMLMTDVYVGGLETTSTTLSWLAAYLINYPLVQTRLQTDIDDF-------IGSRWPVLADKPNLPYMEATIAEVLRIATVLPMGVPHKATTNNVPLMGYNIPKDTIIVMNLWAIHHDPREWPNPDKFDPDRFINEDGKFEVPGQRSYLPFSAGRRVCVGESLAKIELFLVMTRLLQQFTLETLPGQGPPSVGEASGNITRAPKPFKFR 488          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: cyp17 (cytochrome P-450 17alpha-hydroxylase/C17,20-lyase [Source:NCBI gene;Acc:100125816])

HSP 1 Score: 132.109 bits (331), Expect = 1.003e-32
Identity = 105/458 (22.93%), Postives = 208/458 (45.41%), Query Frame = 3
Query:  168 LIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGL----RHCANLDRLNEIMYKCFDKFKETVEYRRGSKNG-GIEVDNDLFWMADNVITMLLFNEIFNDVD------YKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIAC-FDITDFVLLA---VEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFK-RRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVE 1493
            +++K++ QKY    G   +L      V+ +N      EV +++  +  +GR  +    +L+ +  +I   DY   W+  ++ +H  L       A+L R+      C +           +  G  +++  +L     NVI  L FN  ++  D       +  QG ++ + + +    FP  +     D + +++   V +QL   LQ + +EH  K DY      D+ D +L A    E  +   +     + L+D H+  ++ D+  A  E       W    L  YP +Q+ I+ E+++ +   +    L  +  +P+  A + E+ R          H  + D ++G + + K + +V+NL+++HHD+K+W NPD+ +P  FLS DG S       ++P+G GLR C+G   ++  LF+ +  ++  + +    ++S   ++ K  V ++ V+
Sbjct:   56 VLFKELQQKY----GQTYSLKMGSHQVIIVNHHAHAREVLLKR-GRTFAGRPRTVTTDVLTRDGKDIAFGDYSATWRFHRKIVHGALCMFGEGSASLQRI-----ICTEAQSLCSTLSEAAATGLALDLSPELTRAVTNVICSLCFNSSYSRGDPEFEAMLRYSQGIVDTVAKDSLVDIFPWLQIFPNKDLRLLKQCVAVRDQL---LQKKFEEH--KSDYSDHVQRDLLDALLRAKRSAENNNTAAEFSAEAVGLSDDHLLMTVGDIFGAGVETTTTVLKWAITYLIHYPEVQKQIQEELDR-KVGVDRPPQLSDRGSLPFLEATIREVLRIRPVAPLLIPHVALSDTSLGDFTVRKGTRVVINLWSLHHDEKEWTNPDLFNPGRFLSADGSSLTLPSSSYLPFGAGLRVCLGEALAKMELFLFLSWILQRFTLSVPPSQSLPSLEGKFGVVLQPVK 497          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: cyp17 (cytochrome P-450 17alpha-hydroxylase/C17,20-lyase [Source:NCBI gene;Acc:100125816])

HSP 1 Score: 132.109 bits (331), Expect = 1.950e-32
Identity = 105/458 (22.93%), Postives = 208/458 (45.41%), Query Frame = 3
Query:  168 LIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGL----RHCANLDRLNEIMYKCFDKFKETVEYRRGSKNG-GIEVDNDLFWMADNVITMLLFNEIFNDVD------YKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIAC-FDITDFVLLA---VEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFK-RRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVE 1493
            +++K++ QKY   Y    +L      V+ +N      EV +++  +  +GR  +    +L+ +  +I   DY   W+  ++ +H  L       A+L R+      C +           +  G  +++  +L     NVI  L FN  ++  D       +  QG ++ + + +    FP  +     D + +++   V +QL   LQ + +EH  K DY      D+ D +L A    E  +   +     + L+D H+  ++ D+  A  E       W    L  YP +Q+ I+ E+++ +   +    L  +  +P+  A + E+ R          H  + D ++G + + K + +V+NL+++HHD+K+W NPD+ +P  FLS DG S       ++P+G GLR C+G   ++  LF+ +  ++  + +    ++S   ++ K  V ++ V+
Sbjct:  134 VLFKELQQKYGQTY----SLKMGSHQVIIVNHHAHAREVLLKR-GRTFAGRPRTVTTDVLTRDGKDIAFGDYSATWRFHRKIVHGALCMFGEGSASLQRI-----ICTEAQSLCSTLSEAAATGLALDLSPELTRAVTNVICSLCFNSSYSRGDPEFEAMLRYSQGIVDTVAKDSLVDIFPWLQIFPNKDLRLLKQCVAVRDQL---LQKKFEEH--KSDYSDHVQRDLLDALLRAKRSAENNNTAAEFSAEAVGLSDDHLLMTVGDIFGAGVETTTTVLKWAITYLIHYPEVQKQIQEELDR-KVGVDRPPQLSDRGSLPFLEATIREVLRIRPVAPLLIPHVALSDTSLGDFTVRKGTRVVINLWSLHHDEKEWTNPDLFNPGRFLSADGSSLTLPSSSYLPFGAGLRVCLGEALAKMELFLFLSWILQRFTLSVPPSQSLPSLEGKFGVVLQPVK 575          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: cyp21a2 (steroid 21-hydroxylase [Source:NCBI gene;Acc:101157155])

HSP 1 Score: 124.79 bits (312), Expect = 1.440e-30
Identity = 104/418 (24.88%), Postives = 186/418 (44.50%), Query Frame = 3
Query:  204 KYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEE--CDFPNDKPSKKSDFKSVEKL-QKVFNQLI-------EVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMV 1427
            +YG I  L    T +V +N  E   E  VRK S   +GR  SY   I+SG   NI   DY   W+  +R +H  L+ C     L+ ++ +     ++ +   +GS    +++  D    A NVIT L F +     +Y K    ++ +     E    + +   S    F  + KL   VF +L+       E+++  +D  + +G        IT  +L A++++    ++ K G  LTD+HV  + +D++    E       W    L   P IQ+ +  E+    +    + +   + ++P   A++ E+ R          H  + + +I  + IPK+S+I+ NL+  HHD   W  P    P+ FL   G S    +  VP+G G R C+G + ++  LF+    ++ +++ +
Sbjct:   19 RYGSIYRLKCGNTTMVVLNSGELIRETLVRKWS-DFAGRPISYTGDIVSGGGRNISLGDYTEEWRAHRRLVHGALQRCCQ-QSLHSVIERQALHLRKVLMGYQGSP---VDLSEDFTVAASNVITTLAFGK-----EYDKSSSELQQLHSCLNEIVSLWGSSWISALDSFPLLRKLPNPVFARLLKEVARRDEIIKQHLDNFKLQGHQSED--SITGSLLQALDKH----QNTKEGQLLTDVHVHMATVDLLIGGTETTAAWLNWTVAFLLHRPEIQDKVYEELCTVPEGRYPKYSD--RQRLPVLCALVNEVLRLRPVAPLAVPHRAIRNSSIAGFFIPKNSVIIPNLFGAHHDPAVWSEPYSFKPERFLEGGGGS---TRALVPFGGGARLCLGESVAKMELFLFTAYLLRDFQFI 415          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000024770.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101169416])

HSP 1 Score: 125.176 bits (313), Expect = 1.980e-30
Identity = 108/442 (24.43%), Postives = 206/442 (46.61%), Query Frame = 3
Query:  207 YGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEY--RRGSKNGGIEVDNDLFW--MADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSD-FKSVEKLQKVFNQ-------LIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEP 1496
            YG + + +    P V +N ++   E  + K +   SGR        L+  R  ++  DYG +W+  +R     LR+      L +I  +  ++  E +++   +  +N G  +     +   A N+I  +LFN  ++  D K      E++  + E     N   +   D F  +      FN+        + + +  ++EH+     ++A  +  DFV   ++E     K+KK     ++  +     D+  A  +   N+ +  F  L +YP+IQE  + EI++  +  +  V+   + KMPY  AV+ E+QR+A+    + FH T  D  +  Y IPK +LI+ N+ ++  ++ QWK P   +P+NFL++ G  F + + F+P+  G R C+G   +   LF++++ ++  +K  W ++  Q    D + VF   + P
Sbjct:   59 YGNVYSFFIGSRPAVVVNGLQAMKEAIMIK-ATDFSGRPQDMFVSDLT-QRKGVILVDYGSVWRDHRRFALMTLRNFG----LGKISME--ERIHEEIQFTISKLEENIGKTLSPKFMFHNAASNIICKVLFNTRYDYEDGK----ISEIVQGFVEMLQIANGPWAMMYDAFPWIRSFPLPFNKAFRNMENFLNLAKRLVNEHKMS---RVAG-EPRDFVDSYLDELE---KNKK---DFSEQQLLRMTFDLYIAGTDTTSNTMLAGFLYLMVYPHIQEKCQREIDQMLERKD-RVSFEDRHKMPYMQAVIHEVQRFANIVPLSVFHCTTKDSELSGYTIPKGTLIIQNMVSVLREEGQWKFPHEFNPENFLNDQG-EFIKPEAFMPFSAGPRMCLGEGLARMELFIIMVTLLRKFKFTWPEDAGQ---PDLSPVFGATLTP 473          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: cyp17a2 (steroid 17-alpha-hydroxylase/17,20 lyase-like [Source:NCBI gene;Acc:101170547])

HSP 1 Score: 125.561 bits (314), Expect = 1.985e-30
Identity = 99/425 (23.29%), Postives = 185/425 (43.53%), Query Frame = 3
Query:  156 INEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLR-HCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQ------GAIEVIPQ------YAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKL-GIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNV----EVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSE 1376
            +   L++ K+  +Y    G +  L+      V +N  +   EV +++  +  +GR +    ++L+    +I  SDY PLWK  +R +H           RL ++++   D     +    GS+  G +    +     NV+  L+F+  +   D +  +      G +E I +      Y     FPN          S+ KL++       +L  +++EH+      +A  D +D +   ++     PKS  L G  +TD HV  +  +   A  E    + +W+   L  +P +Q+ ++ E+     D NV       L  +  +PY + V+ E  R          H+ M D +IG + + + + +++N+++IHHD + W  PD+  P+ FL + G        F+P+G G R CVG + + 
Sbjct:   69 LPPHLLFTKLAHRY----GSLFGLFLGPHYTVVVNSHQHAKEVLLQR-GRDFAGRPSMVTTELLTRGGKDIAFSDYSPLWKLHRRLVHNSFTLFGEGTSRLQDVVFSAVDSLCSEL-MSNGSR--GFDPSAAVTRAVTNVVCTLVFSSTYRHGDAELQEVISYNNGIVETIARGGLVDIYPWMKVFPNS---------SLRKLKECIAVRDRLLTRKLEEHKAS----LAEGDPSDLLDALLKGKKGGPKSHGLEGEGITDDHVLMTAAEAFGAGVETTSTTLLWILAYLLHHPEVQQRVQKEL-----DENVGADRAANLSDRGHLPYLDCVINEGMRIRPVSPVLIPHTAMTDSSIGGHAVRRGTRVLVNMWSIHHDPQNWDKPDLFQPERFLDDQGNR-ATPSCFMPFGAGPRVCVGESLAR 466          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000080703.1 (SMESG000080703.1)

HSP 1 Score: 986.867 bits (2550), Expect = 0.000e+0
Identity = 479/480 (99.79%), Postives = 480/480 (100.00%), Query Frame = 3
Query:   84 MNRTISSYKLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIRLK 1523
            MNRTISSYKLPPGPNRNSDEADFIINEKLIY+KIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIRLK
Sbjct:    1 MNRTISSYKLPPGPNRNSDEADFIINEKLIYQKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQEIIDDKNAVFIRDVEPFNIQFIRLK 480          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000012534.1 (SMESG000012534.1)

HSP 1 Score: 246.899 bits (629), Expect = 1.102e-75
Identity = 144/445 (32.36%), Postives = 240/445 (53.93%), Query Frame = 3
Query:  168 LIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQGAIEVIPQYAEECDFPNDKP-SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKF-RDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVW-GKNKSQEIIDD-KNAVFIR 1484
            +IYK++V+ Y PKYG + TL+   TP+VFIND +   E    K  K ++GR +   E I+S  R+NI  ++YGPLWK + R L  G+  C     L + + K  + + + +     +   G+   ++ +W++DN +  ++    F   D DY   Q +   +    ++ +F N  P  +    K + +L +   +L  +L   + + RK G Y+    +I +++L   E   L  + K   + L D+H++    D++FAS EG+G + +W   LL L+P IQE IR +I K      +      WK+++PY  AV  E  R++S     DFH  +  + +G Y IPK  LI +N YAI+HD ++W+NP+ I P+ FL   G +F  R D +P+G+G+R C G + ++   F+L+  +  NYK+ W  +N+  E++DD +NAV  R
Sbjct:    1 MIYKRMVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKK---VNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSG-AFTDRSDLMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFR 441          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000012534.1 (SMESG000012534.1)

HSP 1 Score: 239.195 bits (609), Expect = 8.876e-73
Identity = 141/440 (32.05%), Postives = 235/440 (53.41%), Query Frame = 3
Query:  183 IVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFN--DVDYKKYQGAIEVIPQYAEECDFPNDKP-SKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKF-RDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVW-GKNKSQEIIDD-KNAVFIR 1484
            +V+ Y PKYG + TL+   TP+VFIND +   E    K  K ++GR +   E I+S  R+NI  ++YGPLWK + R L  G+  C     L + + K  + + + +     +   G+   ++ +W++DN +  ++    F   D DY   Q +   +    ++ +F N  P  +    K + +L +   +L  +L   + + RK G Y+    +I +++L   E   L  + K   + L D+H++    D++FAS EG+G + +W   LL L+P IQE IR +I K      +      WK+++PY  AV  E  R++S     DFH  +  + +G Y IPK  LI +N YAI+HD ++W+NP+ I P+ FL   G +F  R D +P+G+G+R C G + ++   F+L+  +  NYK+ W  +N+  E++DD +NAV  R
Sbjct:    1 MVEYYKPKYGNLVTLFWGNTPIVFINDYKLAIEALGNKNGKHLAGRKSVQTEDIVSEERHNIFGNNYGPLWKEMIRALKLGVSKCGLTPSLEKNIQKSINFYCDELIRNPDNSGKGVFPFDESYWLSDNTVLSIVIGRTFTLEDEDYIILQDSRRQVFDIMDKSEFVNWIPFGRYLPLKCIRRLFEQSTKLNNLLAKFVSDARKMGRYRNNPDNIIEYLLQETENSKLVTEKK---VNLNDVHIRQIFKDILFASYEGIGMTNIWYMALLGLHPQIQERIRLDITKLCSKKKDSTPKFEWKNELPYIQAVEYEFFRFSSIVGILDFHCALKSVTLGGYHIPKGCLIAVNQYAINHDAERWENPETIKPERFLDSSG-AFTDRSDLMPFGMGVRMCPGTSITKGYGFLLLCNLCLNYKIKWSSENEFTELVDDPENAVLFR 436          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000050434.1 (SMESG000050434.1)

HSP 1 Score: 226.098 bits (575), Expect = 4.522e-67
Identity = 145/495 (29.29%), Postives = 247/495 (49.90%), Query Frame = 3
Query:  105 YKLPPGPNRNSDEADFII-------NEKLIYKKIVQKYIPKYGPICTLYKDGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDYGPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETV-EYRRGSKNGGIEVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECD---FPNDKPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKI-------ACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWK--SKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRSFKRRKDFVPYGLGLRTCVGNTFS-ENVLFVLIMLVVDNYKMVW-GKNKSQEIIDDKNAVFIRDVEPFNIQFIRLK 1523
            + LPPGP     +A  II       +  L YK++++ +  KYG I    + G   V+++D + GY+ FV+  S +++GR  +  +++  GN N          W  L++ +   LR  A   ++ EI    ++ F   + E +    +GG  V+   +W+  N++  + + +   + D   YQ  I VI +   +     F +  P          K+ +    L + +Q  I E +  G+YK+        C +I D      E+Y   P        LTD  + +  +D+ FA  +  G  F W  GLLA +P++Q+NIR E+ K  D  NVE + ++K   K+ Y NAV+ E+ R  S  +FT FH  M D+ +G Y+IPKD++I LN+Y  H+D K WKNP+  +P  F++ DG+    ++ F+P+G+G RTCV   ++ +   F+    +  ++K+ W  KNK+ ++ +D    F R   PF ++F  +K
Sbjct:   31 HNLPPGP-----KAWPIIGSIPDPYSSPLSYKRLIEDWKEKYGEIILFKRMGMNFVYVSDYKLGYQAFVKDYSNELAGRPLNSVDRLSVGNENIFFTRSLDAGWTELRKQIMIMLRKVAEPQKMTEISNNAYELFATHIREKKELVSDGGFYVEQLCYWVGHNILVQVFWEDAV-EFDNPNYQDTISVIGKLMAKVGNLAFFDITPLNCLPHPGKNKILEYSKYLSDKVQKHIKERKSDGNYKVNPKYFIDYCIEIQDNQKEQKEKYGQLPM-------LTDWFISNLSLDIYFAGMDAFGIGFSWTIGLLATHPHVQDNIRKELQK-NDIENVE-SFNYKMMDKLHYLNAVVNEVMRIHSLSSFTSFHRAMSDVKVGEYDIPKDTIIALNIYGAHYDPKYWKNPNEFNPDRFINADGKFQSPKEGFMPFGVGRRTCVAERYTVKESHFIFTGRICQDFKITWSSKNKTDKVEEDLENTFFRHTAPFYVEFHSIK 510          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000078094.1 (SMESG000078094.1)

HSP 1 Score: 117.472 bits (293), Expect = 6.969e-28
Identity = 76/275 (27.64%), Postives = 137/275 (49.82%), Query Frame = 3
Query:  699 SDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVLLAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLLALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASADTFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNFLSEDGRS---FKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWGKNKSQE-----IIDDKNAVFIRDVEPF 1499
            SD+K   K+Q  F +        I EHR   D+     DI D  L  ++++ L   +  +     D  +  + +++  A  E    +  W    ++ YP+IQE +  EI++      +  T++ K  M YT +V+ E+ R +S    +  H T  D NI  + IPKDSLI  NLYA H D + W++P    P++FLS D      ++ R++ +P+ +G R C+G + + +  F+  + +V  +++ +G+  S+E     II ++  +   D++ F
Sbjct:  238 SDWKRFVKIQDYFAE-------EIKEHRNALDFTSEGEDIMDRFL--IKQHELKQSTGNVE-SFVDWQLIRNSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVYKEISEIIGKERLP-TMNDKKAMNYTQSVMDEVLRLSSVSPLSLIHRTFHDANINGFYIPKDSLIFPNLYACHMDPEIWESPTTFYPEHFLSLDSNGISKYQPREELIPFSVGKRQCLGESLARSEYFIFFVTMVQRFQISFGEEISEEKYLQTIIGNEGLIRTSDIKNF 501          
The following BLAST results are available for this feature:
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2J29.529e-3024.24cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2R11.777e-2832.95cytochrome P450 family 2 subfamily R member 1 [Sou... [more]
CYP2U13.742e-2722.37cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
CYP2R14.934e-2732.95cytochrome P450 family 2 subfamily R member 1 [Sou... [more]
CYP21A21.436e-2621.10cytochrome P450 family 21 subfamily A member 2 [So... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33C93.807e-2323.60CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-23A16.669e-2223.31CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-34A109.150e-2224.71CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C23.573e-2122.43CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-31A36.605e-2125.27CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp305a16.117e-2123.04gene:FBgn0036910 transcript:FBtr0074925[more]
Cyp304a11.294e-2028.41gene:FBgn0038095 transcript:FBtr0082691[more]
Cyp18a17.089e-1920.45gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a17.089e-1920.45gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp303a18.077e-1626.63gene:FBgn0001992 transcript:FBtr0343812[more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2x81.252e-3727.79cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x81.872e-3727.57cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x72.361e-3627.75cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x63.303e-3627.09cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x73.663e-3627.75cytochrome P450, family 2, subfamily X, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043988.14.533e-3123.19pep primary_assembly:Xenopus_tropicalis_v9.1:4:503... [more]
foxh1.22.176e-2925.16forkhead box H1, gene 2 [Source:Xenbase;Acc:XB-GEN... [more]
cyp2u14.066e-2924.12cytochrome P450 family 2 subfamily U member 1 [Sou... [more]
cyp17a15.304e-2922.88cytochrome P450 family 17 subfamily A member 1 [So... [more]
cyp17a17.128e-2922.88cytochrome P450 family 17 subfamily A member 1 [So... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2j61.069e-2925.59cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2r14.654e-2933.33cytochrome P450, family 2, subfamily r, polypeptid... [more]
Cyp2j92.051e-2824.89cytochrome P450, family 2, subfamily j, polypeptid... [more]
Cyp2r17.128e-2833.33cytochrome P450, family 2, subfamily r, polypeptid... [more]
Cyp2c297.938e-2826.05cytochrome P450, family 2, subfamily c, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12394|CP17A_CHICK1.930e-3524.00Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus... [more]
sp|Q92113|CP17A_SQUAC2.096e-3226.45Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalu... [more]
sp|P70085|CP17A_ORYLA8.989e-3222.93Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzia... [more]
sp|O57525|CP17A_RANDY3.325e-3123.93Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana d... [more]
sp|P30437|CP17A_ONCMY5.385e-3122.52Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorh... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3ZZH53.245e-4127.34Uncharacterized protein (Fragment) OS=Branchiostom... [more]
C3YIB92.937e-4025.72Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A1S3I3748.323e-3926.13cytochrome P450 1A1 OS=Lingula unguis OX=7574 GN=L... [more]
C3YIB75.727e-3826.29Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A210R6Z56.886e-3724.51Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mizuho... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp17a22.484e-3221.32cytochrome P450, family 17, subfamily A, polypepti... [more]
ENSAMXT00000044947.14.037e-3223.70pep primary_assembly:Astyanax_mexicanus-2.0:11:114... [more]
cyp17a11.145e-3022.86steroid 17-alpha-hydroxylase/17,20 lyase [Source:N... [more]
ENSAMXT00000016766.23.291e-3022.94pep primary_assembly:Astyanax_mexicanus-2.0:11:114... [more]
ENSAMXT00000055532.15.807e-3025.42cytochrome P450 2J2-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp17a11.256e-3124.59cytochrome P450, family 17, subfamily A, polypepti... [more]
cyp1d16.674e-2621.88cytochrome P450, family 1, subfamily D, polypeptid... [more]
ENSPMAT00000011254.19.197e-2623.60pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
ENSPMAT00000002462.12.230e-2529.24pep scaffold:Pmarinus_7.0:GL485824:2571:10389:-1 g... [more]
cyp2u14.459e-2527.37cytochrome P450, family 2, subfamily U, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERG58.389e-1526.83C-22 sterol desaturase; a cytochrome P450 enzyme t... [more]
ERG112.952e-720.39Lanosterol 14-alpha-demethylase; catalyzes C-14 de... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412843.469e-3425.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481919.848e-3323.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466052.622e-3224.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492146.162e-3125.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412506.706e-3123.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp171.003e-3222.93cytochrome P-450 17alpha-hydroxylase/C17,20-lyase ... [more]
cyp171.950e-3222.93cytochrome P-450 17alpha-hydroxylase/C17,20-lyase ... [more]
cyp21a21.440e-3024.88steroid 21-hydroxylase [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000024770.21.980e-3024.43cytochrome P450 2J6 [Source:NCBI gene;Acc:10116941... [more]
cyp17a21.985e-3023.29steroid 17-alpha-hydroxylase/17,20 lyase-like [Sou... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080703.10.000e+099.79SMESG000080703.1[more]
SMESG000012534.11.102e-7532.36SMESG000012534.1[more]
SMESG000012534.18.876e-7332.05SMESG000012534.1[more]
SMESG000050434.14.522e-6729.29SMESG000050434.1[more]
SMESG000078094.16.969e-2827.64SMESG000078094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033976 ID=SMED30033976|Name=Steroid 17-alpha-hydroxylase/17,20 lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1629bp
CGTGAACTTTACTTGAAAATAAATTAAAAGAAATTCTAAATAAAGTTTTA
TCGAGATTATTTAAGAAATATTAAATTATTACAATGAATCGAACTATATC
TAGTTATAAATTGCCACCTGGTCCCAATCGAAATTCAGATGAAGCAGATT
TTATTATCAATGAAAAATTAATTTATAAAAAAATTGTTCAAAAATATATT
CCTAAATATGGTCCCATATGTACTCTTTACAAAGATGGAACTCCAGTAGT
TTTTATAAATGATATAGAAACAGGCTATGAAGTTTTCGTTCGTAAATTAT
CGAAACAAGTGAGTGGTCGGTCAGCCAGTTACGGAGAAAAGATTTTATCT
GGAAATCGAAACAATATTTTAAACAGTGATTATGGACCACTTTGGAAAAC
TCTTCAGAGAAACTTACATAAAGGTCTACGGCATTGTGCGAATCTGGACA
GATTGAATGAGATTATGTACAAATGTTTCGATAAATTCAAAGAAACTGTT
GAATACAGACGAGGTTCAAAAAATGGAGGAATTGAAGTTGACAATGATTT
GTTTTGGATGGCGGATAATGTGATAACAATGCTCCTTTTCAATGAGATTT
TTAATGATGTTGATTATAAAAAGTACCAAGGGGCAATTGAAGTCATTCCG
CAATATGCAGAAGAGTGTGATTTCCCAAACGATAAGCCAAGCAAAAAATC
TGATTTCAAATCTGTTGAAAAATTACAAAAGGTTTTCAATCAACTTATAG
AAGTTTTACAAATTCGAATTGATGAACATCGAAAAAAGGGTGATTATAAA
ATCGCTTGTTTTGATATTACTGATTTTGTTTTGCTCGCCGTTGAGGAATA
TCATTTGGATCCAAAAAGTAAAAAATTAGGTATCAAATTGACAGATCTGC
ACGTGAAACATTCTTTAATTGATGTCATATTTGCTAGTCAAGAAGGATTA
GGGAATTCATTCGTATGGGTATTTGGATTGTTAGCCTTATATCCAAATAT
TCAAGAAAATATTCGGACAGAAATCAACAAATTTAGAGATGACAACAATG
TTGAAGTAACCTTACATTGGAAATCCAAGATGCCTTACACAAATGCTGTT
TTATGCGAAATACAGAGATATGCTTCAGCTGACACCTTTACAGATTTTCA
TTCCACAATGGATGATATCAACATTGGACCTTATGAAATTCCCAAGGATT
CATTGATAGTTCTCAATCTCTATGCAATTCATCATGACAAAAAACAGTGG
AAAAATCCAGATATTATTGATCCCCAGAATTTTTTGAGTGAAGATGGGCG
GTCTTTTAAACGACGGAAGGATTTTGTGCCTTACGGATTGGGATTACGAA
CTTGTGTTGGCAACACATTTTCTGAAAACGTTTTGTTTGTTCTAATAATG
CTAGTAGTCGACAATTACAAGATGGTGTGGGGTAAAAATAAAAGTCAGGA
AATAATTGATGACAAAAACGCAGTTTTCATTCGAGATGTTGAGCCCTTTA
ATATTCAATTCATTAGATTGAAATAATATTTCTAGAAAACTTACGCGTTG
ATTTTTTTTAATTTTTTTTCTCTGATTAATTTATTAGATAAAAATCACTA
ATTTTATTAAAATAAAATATTTTGAGTTG
back to top

protein sequence of SMED30033976-orf-1

>SMED30033976-orf-1 ID=SMED30033976-orf-1|Name=SMED30033976-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=481bp
MNRTISSYKLPPGPNRNSDEADFIINEKLIYKKIVQKYIPKYGPICTLYK
DGTPVVFINDIETGYEVFVRKLSKQVSGRSASYGEKILSGNRNNILNSDY
GPLWKTLQRNLHKGLRHCANLDRLNEIMYKCFDKFKETVEYRRGSKNGGI
EVDNDLFWMADNVITMLLFNEIFNDVDYKKYQGAIEVIPQYAEECDFPND
KPSKKSDFKSVEKLQKVFNQLIEVLQIRIDEHRKKGDYKIACFDITDFVL
LAVEEYHLDPKSKKLGIKLTDLHVKHSLIDVIFASQEGLGNSFVWVFGLL
ALYPNIQENIRTEINKFRDDNNVEVTLHWKSKMPYTNAVLCEIQRYASAD
TFTDFHSTMDDINIGPYEIPKDSLIVLNLYAIHHDKKQWKNPDIIDPQNF
LSEDGRSFKRRKDFVPYGLGLRTCVGNTFSENVLFVLIMLVVDNYKMVWG
KNKSQEIIDDKNAVFIRDVEPFNIQFIRLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR003652Ataxin_AXH_dom
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0005506iron ion binding
GO:0004497monooxygenase activity
GO:0004508steroid 17-alpha-monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016829lyase activity
GO:0046872metal ion binding
GO:004744217-alpha-hydroxyprogesterone aldolase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006694steroid biosynthetic process
GO:0007548sex differentiation
GO:0008202steroid metabolic process
GO:0042446hormone biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 414..424
score: 44.1
coord: 39..58
score: 30.97
coord: 378..402
score: 35.21
coord: 159..177
score: 27.4
coord: 293..319
score: 23.97
coord: 424..447
score: 18.99
coord: 337..355
score: 29.1
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 3..478
e-value: 9.0E-69
score: 234.2
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 32..456
IPR001128Cytochrome P450PFAMPF00067p450coord: 30..474
e-value: 1.2E-67
score: 228.7
NoneNo IPR availablePANTHERPTHR24299FAMILY NOT NAMEDcoord: 41..476