caspase-8

Overview
Namecaspase-8 (AGY56134.1)
Smed IDSMED30033974
Length (bp)1869
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of caspase-8 (SMED30033974) t-SNE clustered cells

Violin plots show distribution of expression levels for caspase-8 (SMED30033974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of caspase-8 (SMED30033974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for caspase-8 (SMED30033974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30033974SMESG000005044.1 dd_Smed_v4_10883_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30033974SMESG000005044.1 SMESG000005033.1 Contig12192newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033974SMESG000005044.1 SMESG000005033.1 Contig12192uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of caspase-8 vs. Ensembl Human
Match: CASP8 (caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509])

HSP 1 Score: 121.324 bits (303), Expect = 8.990e-29
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  211 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 416          
BLAST of caspase-8 vs. Ensembl Human
Match: CASP8 (caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509])

HSP 1 Score: 121.324 bits (303), Expect = 8.990e-29
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  211 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 416          
BLAST of caspase-8 vs. Ensembl Human
Match: CASP8 (caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509])

HSP 1 Score: 121.709 bits (304), Expect = 1.123e-28
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  243 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 448          
BLAST of caspase-8 vs. Ensembl Human
Match: CASP8 (caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509])

HSP 1 Score: 121.324 bits (303), Expect = 1.134e-28
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  226 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 431          
BLAST of caspase-8 vs. Ensembl Human
Match: CASP8 (caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509])

HSP 1 Score: 121.324 bits (303), Expect = 1.134e-28
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  226 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 431          
BLAST of caspase-8 vs. Ensembl Celegans
Match: ced-3 (Cell death protein 3 Cell death protein 3 subunit p17 Cell death protein 3 subunit p15 Cell death protein 3 subunit p13 [Source:UniProtKB/Swiss-Prot;Acc:P42573])

HSP 1 Score: 103.219 bits (256), Expect = 3.852e-24
Identity = 62/225 (27.56%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  844 DEFYPYPESDRVKSVCLIINIKNYEHYP-RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQEN-----------LHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ 1482
            DE   Y      + +CLIIN +++E  P R G++ D  N+   F  + +T+   +NL    M+   + ++K E+    ++LV  IL+HG ++ I  +++  +S  E   + NA N     NKPK+ F+QAC+G+R   G P         +  +             L  ++P ++Q       P +AD +   +T A YV++R++ +GSW+I  +C+  +  A+
Sbjct:   14 DEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILV--ILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKK--PSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAK 234          
BLAST of caspase-8 vs. Ensembl Celegans
Match: ced-3 (Cell death protein 3 Cell death protein 3 subunit p17 Cell death protein 3 subunit p15 Cell death protein 3 subunit p13 [Source:UniProtKB/Swiss-Prot;Acc:P42573])

HSP 1 Score: 102.064 bits (253), Expect = 1.231e-22
Identity = 59/213 (27.70%), Postives = 109/213 (51.17%), Query Frame = 1
Query:  880 KSVCLIINIKNYEHYP-RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQEN-----------LHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ 1482
            + +CLIIN +++E  P R G++ D  N+   F  + +T+   +NL    M+   + ++K E+    ++LV  IL+HG ++ I  +++  +S  E   + NA N     NKPK+ F+QAC+G+R   G P         +  +             L  ++P ++Q       P +AD +   +T A YV++R++ +GSW+I  +C+  +  A+
Sbjct:  242 RGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILV--ILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKK--PSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAK 450          
BLAST of caspase-8 vs. Ensembl Celegans
Match: csp-1 (Caspase A Caspase A subunit p16 Caspase A subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:G5EBM1])

HSP 1 Score: 87.4261 bits (215), Expect = 6.984e-19
Identity = 62/237 (26.16%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  817 RVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRK-GSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHG-CKDCIYDINEELVSIREFSLIFNAKNCEAYKN----KPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKN---SDIIPEE-----ADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 1485
            R    K  H   Y Y  +   +   LI++ +N+++  R+ G+++D  N+ K F KL +T+    NL    M+   K ++++  + S   ++ F+L+HG     ++ I++  V++ E S         AY      KPK   + AC+G + + G+P  G+ + +             PI ++ N   S I+P       AD I   ST   + ++R  + G+WYI  +CK  NK ++T
Sbjct:    3 RTDAKKSNHKHKYCYEMNSNPRGTVLILSNENFKNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHTDS---IILFLLSHGDGAGSVFGIDDMPVNVMEVSTYL------AYHQNLLLKPKWVAVSACRGGKLNMGVPVDGLPALEDKCA---------PISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHSKT 221          
BLAST of caspase-8 vs. Ensembl Celegans
Match: csp-1 (Caspase A Caspase A subunit p16 Caspase A subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:G5EBM1])

HSP 1 Score: 86.6557 bits (213), Expect = 1.354e-17
Identity = 62/237 (26.16%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  817 RVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRK-GSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHG-CKDCIYDINEELVSIREFSLIFNAKNCEAYKN----KPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKN---SDIIPEE-----ADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 1485
            R    K  H   Y Y  +   +   LI++ +N+++  R+ G+++D  N+ K F KL +T+    NL    M+   K ++++  + S   ++ F+L+HG     ++ I++  V++ E S         AY      KPK   + AC+G + + G+P  G+ + +             PI ++ N   S I+P       AD I   ST   + ++R  + G+WYI  +CK  NK ++T
Sbjct:  271 RTDAKKSNHKHKYCYEMNSNPRGTVLILSNENFKNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHTDS---IILFLLSHGDGAGSVFGIDDMPVNVMEVSTYL------AYHQNLLLKPKWVAVSACRGGKLNMGVPVDGLPALEDKCA---------PISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHSKT 489          
BLAST of caspase-8 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 64.6994 bits (156), Expect = 2.800e-11
Identity = 57/236 (24.15%), Postives = 107/236 (45.34%), Query Frame = 1
Query:  838 KHDEFYPYPESDRVKSVCLIIN-IKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ-THWPIPVRNLNVKTNEKAL 1539
            K DE   Y  +   K   +IIN +       R GS++D   + K F +L +    Y+NL  +E++   + +++   S  G  L+  I++HG +  +Y ++   V + +   I +     +   KPK      C+GDR    +   G   +      +    +K     ++ S     +AD +   ST   +++FR   KG+WYI EL + + + A+ TH    + +L ++TN + +
Sbjct:   11 KIDETRKYRNNRSSKCRAIIINNVVFCGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQ---SNHGDSLIITIMSHGDQGLLYGVDGVPVQMLD---IIDLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTS---SSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTH----LADLLMETNRRVV 233          
BLAST of caspase-8 vs. Ensembl Fly
Match: Drice (gene:FBgn0019972 transcript:FBtr0085482)

HSP 1 Score: 90.5077 bits (223), Expect = 1.937e-19
Identity = 70/236 (29.66%), Postives = 111/236 (47.03%), Query Frame = 1
Query:  784 STPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIY--DINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            S+P+  Y  +   KM+  +H   Y     +R  ++     I N+EH+       R G+  D  N+ +   +L F +  Y++    +++   +  +    S S  +LV  IL+HG    IY  D   +L +I  F   F A +C +   KPKLFFIQACQGDR   G+    +Q SQ     ++    K           IP  ADF+   STV  + ++R+T +GSW++  LC  +
Sbjct:   64 SSPSSSYR-KNVAKMVTDRHAAEYNMRHKNRGMAL-----IFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVA-ILSHGEMGYIYAKDTQYKLDNIWSF---FTANHCPSLAGKPKLFFIQACQGDRLDGGVT---MQRSQTETDGDSSMSYK-----------IPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAEL 275          
BLAST of caspase-8 vs. Ensembl Fly
Match: Decay (gene:FBgn0028381 transcript:FBtr0083304)

HSP 1 Score: 87.0409 bits (214), Expect = 2.262e-18
Identity = 58/210 (27.62%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  883 SVCLIINIKNYE-HYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILA---HGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIP 1500
             + LI+N K+ +    R G+ERD  ++  T     F ++ +++L  +E+    K  ++ + S++     CF+LA   HG +  +Y   +    +      F   NC+  KNKPKLFFIQAC+G    + +  S        L  E    ++P       +  IP  AD +   ST   + +FR+   GSW+I  LC+ +++ A      P
Sbjct:   56 GIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQND----CFVLAVMSHGTEGKVY-AKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPI------TYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATP 254          
BLAST of caspase-8 vs. Ensembl Fly
Match: Dcp-1 (gene:FBgn0010501 transcript:FBtr0072062)

HSP 1 Score: 83.1889 bits (204), Expect = 4.744e-17
Identity = 68/260 (26.15%), Postives = 116/260 (44.62%), Query Frame = 1
Query:  724 DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIY--DINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIP-ESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ 1482
            D K C  E+  +    G   ++P        R+ + +Y  +    Y  S + + V LI N + ++  P    R G+  D   + K F  L F +  +++    +++      ++++ + +  + V  IL+HG    +Y  D   +L +I  +   F A  C +   KPKLFFIQACQGDR   GI  E G+  +                 +   S  IP  ADF++  ST+  Y ++R+   GSWY+  L + +N   +
Sbjct:   33 DAKGCTPESLVVG---GATAASPLPANKFVARMPVERYASE----YNMSHKHRGVALIFNHEFFD-IPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDHTDNDCLAVA-ILSHGEHGYLYAKDTQYKLDNIWHY---FTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETD---------------GESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGK 265          
BLAST of caspase-8 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0114560)

HSP 1 Score: 75.485 bits (184), Expect = 4.637e-14
Identity = 50/201 (24.88%), Postives = 90/201 (44.78%), Query Frame = 1
Query:  928 RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNE 1530
            R G++ D   + + F  + + ++ Y+N++   M  + +  S  + S     LV FIL+HG ++ +Y  N   + I +   +  + +   YK  PKL  IQACQ    H+  P    +    +++ +                   +  D +  MSTV  Y A R T+ GSW+I  LC  +++ + +     +  L + TNE
Sbjct:  289 RDGTDVDKERLIEVFSSMGYNVEAYDNVD--HMGIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYK--PKLLIIQACQEKLVHKKKPNELFRIDVTTVSPD-------------------QHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADI--LTIVTNE 464          
BLAST of caspase-8 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0114559)

HSP 1 Score: 75.485 bits (184), Expect = 5.147e-14
Identity = 50/201 (24.88%), Postives = 90/201 (44.78%), Query Frame = 1
Query:  928 RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNE 1530
            R G++ D   + + F  + + ++ Y+N++   M  + +  S  + S     LV FIL+HG ++ +Y  N   + I +   +  + +   YK  PKL  IQACQ    H+  P    +    +++ +                   +  D +  MSTV  Y A R T+ GSW+I  LC  +++ + +     +  L + TNE
Sbjct:  283 RDGTDVDKERLIEVFSSMGYNVEAYDNVD--HMGIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYK--PKLLIIQACQEKLVHKKKPNELFRIDVTTVSPD-------------------QHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADI--LTIVTNE 458          
BLAST of caspase-8 vs. Ensembl Zebrafish
Match: casp3a (caspase 3, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-011210-1])

HSP 1 Score: 112.849 bits (281), Expect = 2.727e-27
Identity = 64/199 (32.16%), Postives = 100/199 (50.25%), Query Frame = 1
Query:  889 CLIINIKNYEHY----PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            C+IIN KN++      PR G++ D  N+   F KL + ++ Y +    +++ V  T +  + S+  S LVC +L+HG +   +  +   V ++  + +F    C +   KPKLFFIQAC+G     G+              E  H   P I   +    IP EADF+Y  STV  Y ++R+T  GSW+I  LC+ + K
Sbjct:   50 CIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCAS-LVCVLLSHGDEGVFFGTDTS-VDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGV--------------ETDHPDHPDIPDGRVR--IPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTK 230          
BLAST of caspase-8 vs. Ensembl Zebrafish
Match: casp3a (caspase 3, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-011210-1])

HSP 1 Score: 112.849 bits (281), Expect = 2.727e-27
Identity = 64/199 (32.16%), Postives = 100/199 (50.25%), Query Frame = 1
Query:  889 CLIINIKNYEHY----PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            C+IIN KN++      PR G++ D  N+   F KL + ++ Y +    +++ V  T +  + S+  S LVC +L+HG +   +  +   V ++  + +F    C +   KPKLFFIQAC+G     G+              E  H   P I   +    IP EADF+Y  STV  Y ++R+T  GSW+I  LC+ + K
Sbjct:   50 CIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCAS-LVCVLLSHGDEGVFFGTDTS-VDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGV--------------ETDHPDHPDIPDGRVR--IPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTK 230          
BLAST of caspase-8 vs. Ensembl Zebrafish
Match: casp3b (caspase 3, apoptosis-related cysteine peptidase b [Source:ZFIN;Acc:ZDB-GENE-070607-1])

HSP 1 Score: 112.464 bits (280), Expect = 3.322e-27
Identity = 67/194 (34.54%), Postives = 97/194 (50.00%), Query Frame = 1
Query:  889 CLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            CLIIN KN+        R G++ D   +++TF +L F +  Y +L  ++M+++    S+ + SKS +M  C +L+HG    IY  +  +   R F+  F    C +   KPKLFFIQAC+G     GI   G+   +   TQ                  IP EADF+Y  ST   Y A+R+   GSW+IS LC
Sbjct:   57 CLIINNKNFHKRTGMGVRNGTDEDAKKVFETFSQLGFKVGHYNDLTVSQMMALLNKASQEDHSKS-AMFACVLLSHGDDGLIYGTDNSIELKRLFAH-FRGDRCTSLVGKPKLFFIQACRGTDLDSGIECDGVGDEE---TQR-----------------IPVEADFLYAYSTAPGYYAWRNVANGSWFISSLC 228          
BLAST of caspase-8 vs. Ensembl Zebrafish
Match: casp7 (caspase 7, apoptosis-related cysteine peptidase [Source:ZFIN;Acc:ZDB-GENE-050522-506])

HSP 1 Score: 107.457 bits (267), Expect = 7.439e-25
Identity = 65/207 (31.40%), Postives = 102/207 (49.28%), Query Frame = 1
Query:  853 YPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            + Y  S +    C+IIN KN++       R G++RD   ++K F  L F +  Y +     M  + K  S+ + S S S   C +L+HG +  IY  +  +  I+  + +F    C++   KPKLFFIQAC+G  F +G+  +SG  +  I       H              IP EADF++  STV  Y ++R+  +GSW++  LC
Sbjct:  103 FQYKMSHQRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYNDQTCRNMERLLKAVSEEDHSDS-SCFACILLSHGEEGMIYGTDGAM-PIKTMTSLFKGDVCKSLVGKPKLFFIQACRGSEFDDGVQTDSGPPNDTIETDANPRHK-------------IPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALC 294          
BLAST of caspase-8 vs. Ensembl Zebrafish
Match: dytn (dystrotelin [Source:NCBI gene;Acc:563097])

HSP 1 Score: 103.605 bits (257), Expect = 2.001e-24
Identity = 65/210 (30.95%), Postives = 113/210 (53.81%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNYEHYP---RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI--PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y  S+R    CLIIN   +E      R+G++RD  ++ K F K++F ++  ++L  ++M +V K +++ + S+  +  VC IL HG K  +   + + V IRE S  F    C +  +KPKLFFIQACQG+   +G+        +++    +E+ H           +  IP +ADF++ ++TV  + ++R    GS +I  LCK++ +
Sbjct:    1 YSMSNRPLGYCLIINNYKFESASLADRRGTDRDKDDLTKVFEKMYFKVEVRDDLQASDMRNVIKEFAEKDHSQMNA-FVCCILTHGEKGTVLGTDGKQVPIRELSQPF--AECRSLASKPKLFFIQACQGNMRQQGLWMAHERENTTEEEAYEEDAHA--------AGNYSIPMDADFLFAIATVEHFRSYRHITNGSIFIQVLCKQLER 199          
BLAST of caspase-8 vs. Ensembl Xenopus
Match: casp3.2 (caspase 3, gene 2 [Source:NCBI gene;Acc:100151728])

HSP 1 Score: 108.612 bits (270), Expect = 1.295e-25
Identity = 70/216 (32.41%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  832 KYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            KY+ D    YPE      +CLIIN KN++       R G++ D   +++TF  L + ++   +   N++ ++ K  S+ + SK  S  VC IL+HG    +Y ++   + I+  + +F    C+    KPKLFFIQAC+G        +SGI++   S   E +               IP EADF+Y  STV  Y ++R+T  GSW+I  LC+ +
Sbjct:   47 KYRTD----YPE----MGICLIINNKNFQSSTNMGVRNGTDVDARKLHETFTGLGYKVKVCNDQKSNDIFTLLKKMSEEDHSKRSS-FVCAILSHGEDGLVYGVDGP-IQIKNLTDLFRGDRCKTLVGKPKLFFIQACRGTDL-----DSGIETDSGSEPGEEIQR-------------IPVEADFLYAYSTVPGYYSWRNTMNGSWFIQSLCEMI 234          
BLAST of caspase-8 vs. Ensembl Xenopus
Match: casp10 (caspase 10 [Source:NCBI gene;Acc:548432])

HSP 1 Score: 112.079 bits (279), Expect = 1.616e-25
Identity = 74/209 (35.41%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  844 DEFYPYPESDRVKSVCLIINIKNY-EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +EFY      R    CLII+   + +   R+GS++D   +   F  L   +  +ENL   ++    K +   + S+     VC IL HG    +   +++ VSIRE    F A +C +   KPKLFFIQACQG   H   P S +++  I + +EN        K+Y  +  +P++ADF+ GMSTV  Y A+R T++GSWYI  LCK +
Sbjct:  255 EEFYDMNHKHR--GYCLIIDNSVFMKGNRREGSDKDAGALSDVFSWLGLEVDIFENLMSEQIRDCLKRFKSRDHSER-DCFVCCILTHGESGTVMGSDDKEVSIREIMSYFTAISCTSLVLKPKLFFIQACQGKFTH---PSSKVEADAI-VPEEN--------KKYVVN--VPKDADFLLGMSTVDGYAAYRHTREGSWYIQALCKNL 446          
BLAST of caspase-8 vs. Ensembl Xenopus
Match: casp10 (caspase 10 [Source:NCBI gene;Acc:548432])

HSP 1 Score: 112.079 bits (279), Expect = 1.621e-25
Identity = 74/209 (35.41%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  844 DEFYPYPESDRVKSVCLIINIKNY-EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +EFY      R    CLII+   + +   R+GS++D   +   F  L   +  +ENL   ++    K +   + S+     VC IL HG    +   +++ VSIRE    F A +C +   KPKLFFIQACQG   H   P S +++  I + +EN        K+Y  +  +P++ADF+ GMSTV  Y A+R T++GSWYI  LCK +
Sbjct:  264 EEFYDMNHKHR--GYCLIIDNSVFMKGNRREGSDKDAGALSDVFSWLGLEVDIFENLMSEQIRDCLKRFKSRDHSER-DCFVCCILTHGESGTVMGSDDKEVSIREIMSYFTAISCTSLVLKPKLFFIQACQGKFTH---PSSKVEADAI-VPEEN--------KKYVVN--VPKDADFLLGMSTVDGYAAYRHTREGSWYIQALCKNL 455          
BLAST of caspase-8 vs. Ensembl Xenopus
Match: ENSXETT00000003846.1 (caspase 3, gene 1 [Source:NCBI gene;Acc:100486222])

HSP 1 Score: 100.908 bits (250), Expect = 4.912e-23
Identity = 67/245 (27.35%), Postives = 119/245 (48.57%), Query Frame = 1
Query:  763 LEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPR----KGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEG-IPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ 1482
            + + D      F      ++ +   K D    Y  + + KS+CLI+ ++ +++ P+    + S  D   +   F K+ F ++  EN   +E+ S+ K  ++ + S+ G   VC +++HG KD  Y  ++E   I   +  F  +NC++   KPKLFFIQAC+GD+   G + ++GI ++  S                    +IP E DF++  +T   Y A+R    GSW+I  LC+ + +  Q
Sbjct:    1 MAEADAPDASGFTRKMPDKMNVTPAKPDNSMVYKMNYKQKSICLILCMEKFDNDPKGKRSRNSNDDKIFLNNIFVKMGFEVRLEENKTADEIESLLKDIARQDHSERGC-FVCVVISHGDKDFFYARDQEF-KIDALAEPFRGENCKSLIGKPKLFFIQACRGDKTDSGVVKDAGIATTTAS--------------------VIPTECDFLFAYATPPGYFAWRRG-AGSWFIQSLCEMLGEYWQ 222          
BLAST of caspase-8 vs. Ensembl Xenopus
Match: bmt2 (base methyltransferase of 25S rRNA 2 homolog [Source:Xenbase;Acc:XB-GENE-999766])

HSP 1 Score: 100.523 bits (249), Expect = 1.067e-21
Identity = 56/181 (30.94%), Postives = 95/181 (52.49%), Query Frame = 1
Query:  928 RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVN 1470
            R+G+ +D  +I K F +  +  +++++L    +    + YSK + +++ S  VCFIL+HG    +   + E V I+  +  FN ++C +  NKPK+FFIQACQG   H  +  +    S  S  +++                +P EADF+   +TV +Y + R  +KGS YI +LCK + 
Sbjct:  281 REGTMKDAEDITKIFNERGYITEEHKDLTAENIRKTLEMYSKKDHAENDS-FVCFILSHGGIGTVCGCDGEEVEIKRLTKYFNGQHCPSLINKPKIFFIQACQGKESHPKVDINTDTESSFSFYEQDAM-----------GTHLPLEADFLTAFATVEEYTSLRHIEKGSIYIQQLCKALT 449          
BLAST of caspase-8 vs. Ensembl Mouse
Match: Casp8 (caspase 8 [Source:MGI Symbol;Acc:MGI:1261423])

HSP 1 Score: 139.428 bits (350), Expect = 6.935e-35
Identity = 137/494 (27.73%), Postives = 221/494 (44.74%), Query Frame = 1
Query:  100 LFYLLIRKMCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY------------ECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNNFCRAYCK--------SFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE--DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY-----------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            LFYLLIR    S  +   + +L  +D   LKFL  D++ +    + ++    Q     L   G  E   L+ + E LF+I R D+L             E   P D+ + SP+       R+ LFK+    +E E R FK LLNN     CK           +++ ++++L + N+     I D  +         +Y  + TE+ + S +  EEL  S  +++  K+ E  D             E+  E  T + VY  +                   ++ +  CLIIN  ++               RKG++ D   + KTF +LHF I  Y++   NE+  + + Y   +  K+    +C IL+HG K  +Y  + +  SI + +  F    C +   KPK+FFIQACQG  F +G+P+      +    Q+N H L+     +KN   IP+EADF+ GM+TV + V++R    G+WYI  LC+ + +
Sbjct:   14 LFYLLIRMDFQSCLYAIAE-ELGSEDLAALKFLCLDYIPHK---KQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDP-DNAQISPY-------RVMLFKLSEEVSELELRSFKFLLNNEI-PKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICD-QVNKSLLGKIEDYERSSTERRM-SLEGREELPPSVLDEMSLKMAELCDSPR----------EQDSESRTSDKVYQMK-------------------NKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSAD-HKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPD------EAGFEQQN-HTLEVDSSSHKN--YIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRE 453          
BLAST of caspase-8 vs. Ensembl Mouse
Match: Casp8 (caspase 8 [Source:MGI Symbol;Acc:MGI:1261423])

HSP 1 Score: 139.428 bits (350), Expect = 6.935e-35
Identity = 137/494 (27.73%), Postives = 221/494 (44.74%), Query Frame = 1
Query:  100 LFYLLIRKMCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY------------ECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNNFCRAYCK--------SFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE--DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY-----------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            LFYLLIR    S  +   + +L  +D   LKFL  D++ +    + ++    Q     L   G  E   L+ + E LF+I R D+L             E   P D+ + SP+       R+ LFK+    +E E R FK LLNN     CK           +++ ++++L + N+     I D  +         +Y  + TE+ + S +  EEL  S  +++  K+ E  D             E+  E  T + VY  +                   ++ +  CLIIN  ++               RKG++ D   + KTF +LHF I  Y++   NE+  + + Y   +  K+    +C IL+HG K  +Y  + +  SI + +  F    C +   KPK+FFIQACQG  F +G+P+      +    Q+N H L+     +KN   IP+EADF+ GM+TV + V++R    G+WYI  LC+ + +
Sbjct:   14 LFYLLIRMDFQSCLYAIAE-ELGSEDLAALKFLCLDYIPHK---KQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDP-DNAQISPY-------RVMLFKLSEEVSELELRSFKFLLNNEI-PKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICD-QVNKSLLGKIEDYERSSTERRM-SLEGREELPPSVLDEMSLKMAELCDSPR----------EQDSESRTSDKVYQMK-------------------NKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSAD-HKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPD------EAGFEQQN-HTLEVDSSSHKN--YIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRE 453          
BLAST of caspase-8 vs. Ensembl Mouse
Match: Casp8 (caspase 8 [Source:MGI Symbol;Acc:MGI:1261423])

HSP 1 Score: 134.42 bits (337), Expect = 3.022e-33
Identity = 129/472 (27.33%), Postives = 210/472 (44.49%), Query Frame = 1
Query:  160 DLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY------------ECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNNFCRAYCK--------SFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE--DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY-----------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +L  +D   LKFL  D++ +    + ++    Q     L   G  E   L+ + E LF+I R D+L             E   P D+ + SP+       R+ LFK+    +E E R FK LLNN     CK           +++ ++++L + N+     I D  +         +Y  + TE+ + S +  EEL  S  +++  K+ E  D             E+  E  T + VY  +                   ++ +  CLIIN  ++               RKG++ D   + KTF +LHF I  Y++   NE+  + + Y   +  K+    +C IL+HG K  +Y  + +  SI + +  F    C +   KPK+FFIQACQG  F +G+P+      +    Q+N H L+     +KN   IP+EADF+ GM+TV + V++R    G+WYI  LC+ +
Sbjct:   13 ELGSEDLAALKFLCLDYIPHK---KQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDP-DNAQISPY-------RVMLFKLSEEVSELELRSFKFLLNNEI-PKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICD-QVNKSLLGKIEDYERSSTERRM-SLEGREELPPSVLDEMSLKMAELCDSPR----------EQDSESRTSDKVYQMK-------------------NKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSAD-HKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPD------EAGFEQQN-HTLEVDSSSHKN--YIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSL 431          
BLAST of caspase-8 vs. Ensembl Mouse
Match: Casp8 (caspase 8 [Source:MGI Symbol;Acc:MGI:1261423])

HSP 1 Score: 134.42 bits (337), Expect = 3.022e-33
Identity = 129/472 (27.33%), Postives = 210/472 (44.49%), Query Frame = 1
Query:  160 DLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY------------ECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNNFCRAYCK--------SFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE--DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY-----------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +L  +D   LKFL  D++ +    + ++    Q     L   G  E   L+ + E LF+I R D+L             E   P D+ + SP+       R+ LFK+    +E E R FK LLNN     CK           +++ ++++L + N+     I D  +         +Y  + TE+ + S +  EEL  S  +++  K+ E  D             E+  E  T + VY  +                   ++ +  CLIIN  ++               RKG++ D   + KTF +LHF I  Y++   NE+  + + Y   +  K+    +C IL+HG K  +Y  + +  SI + +  F    C +   KPK+FFIQACQG  F +G+P+      +    Q+N H L+     +KN   IP+EADF+ GM+TV + V++R    G+WYI  LC+ +
Sbjct:   13 ELGSEDLAALKFLCLDYIPHK---KQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDP-DNAQISPY-------RVMLFKLSEEVSELELRSFKFLLNNEI-PKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICD-QVNKSLLGKIEDYERSSTERRM-SLEGREELPPSVLDEMSLKMAELCDSPR----------EQDSESRTSDKVYQMK-------------------NKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSAD-HKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPD------EAGFEQQN-HTLEVDSSSHKN--YIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSL 431          
BLAST of caspase-8 vs. Ensembl Mouse
Match: Casp3 (caspase 3 [Source:MGI Symbol;Acc:MGI:107739])

HSP 1 Score: 108.997 bits (271), Expect = 6.107e-26
Identity = 73/213 (34.27%), Postives = 107/213 (50.23%), Query Frame = 1
Query:  835 YKHDEFYPYPESDRVKSVCLIINIKNYEHY----PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            YK D    YPE      +C+IIN KN+        R G++ D AN+ +TF  L + ++   +L + +++ +  + SK + SK  S  VC IL+HG +  IY  N   V +++ +  F    C +   KPKLF IQAC+G     GI  +SG        T E +   K           IP EADF+Y  ST   Y ++R++K GSW+I  LC
Sbjct:   37 YKMD----YPE----MGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSS-FVCVILSHGDEGVIYGTNGP-VELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSG--------TDEEMACQK-----------IPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLC 220          
BLAST of caspase-8 vs. UniProt/SwissProt
Match: sp|O89110|CASP8_MOUSE (Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.114e-32
Identity = 129/472 (27.33%), Postives = 210/472 (44.49%), Query Frame = 1
Query:  160 DLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY------------ECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNNFCRAYCK--------SFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE--DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHY-----------PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +L  +D   LKFL  D++ +    + ++    Q     L   G  E   L+ + E LF+I R D+L             E   P D+ + SP+       R+ LFK+    +E E R FK LLNN     CK           +++ ++++L + N+     I D  +         +Y  + TE+ + S +  EEL  S  +++  K+ E  D             E+  E  T + VY  +                   ++ +  CLIIN  ++               RKG++ D   + KTF +LHF I  Y++   NE+  + + Y   +  K+    +C IL+HG K  +Y  + +  SI + +  F    C +   KPK+FFIQACQG  F +G+P+      +    Q+N H L+     +KN   IP+EADF+ GM+TV + V++R    G+WYI  LC+ +
Sbjct:   13 ELGSEDLAALKFLCLDYIPHK---KQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDP-DNAQISPY-------RVMLFKLSEEVSELELRSFKFLLNNEI-PKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICD-QVNKSLLGKIEDYERSSTERRM-SLEGREELPPSVLDEMSLKMAELCDSPR----------EQDSESRTSDKVYQMK-------------------NKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSAD-HKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPD------EAGFEQQN-HTLEVDSSSHKN--YIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSL 431          
BLAST of caspase-8 vs. UniProt/SwissProt
Match: sp|Q9JHX4|CASP8_RAT (Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 8.586e-30
Identity = 125/471 (26.54%), Postives = 205/471 (43.52%), Query Frame = 1
Query:  163 LNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFL---LLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSP---------FGKL-ICSKRLFLFKIFNEFEERDFKT----LLNNF--CRAYCKSFNLKI----NEQSILKKLNMIL--KLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            L +++   LKFL  D +             I D + L   L   G  E + L+ + E LF+I R D+L          K+SP          GK  + + R+ LFK+  + ++ D K+    L+     C+    S  L I     +++IL + N++    +C +   +         +Y  + TE+ + S +  EEL +S  +++  K+ +                         ++ + G  +      D  Y      R    CLI N  N+    E  P       RKG+  D   + KTF +LHF I  + +   +++  V  +Y   +  K     +C IL+HG K  +Y  + +  SI E +  F    C +   KPK+FFIQACQG+ F + +P       +  L QE  H+L+     YKN   IP+EADF+ GM+TV + V++R   +G+WYI  LC+ +
Sbjct:   14 LGNEELAALKFLCLDHI------PQKKQESINDVLVLFQRLQEEGMLEEDNLSFLKELLFHISRRDLLSRV------LKSSPEEMVRELQVLGKAQVSAYRVMLFKLSEDMDKEDLKSFKFLLITEIPKCKLQDNSSLLDIFVEMEKRTILAENNLVTLKSICFR---VNRSLLGRIDDYERSSTERRM-STEGGEELPVSVLDEVTIKMQD-------------------------MWDSPGEQESESLNSDNVYQMKSKPR--GYCLIFNNNNFSKAREDIPKLSNMRDRKGTNYDEEALSKTFKELHFEIVSFSDCTASQIHEVLVSYQS-KDHKGKDCFICCILSHGDKGIVYGTDGKEASIYELTSYFTGSKCPSLAGKPKIFFIQACQGNNFQKAVP----VPDETGLEQE--HVLEEDSSSYKN--YIPDEADFLLGMATVKNCVSYRDPTRGTWYIQSLCQSL 432          
BLAST of caspase-8 vs. UniProt/SwissProt
Match: sp|Q14790|CASP8_HUMAN (Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.447e-28
Identity = 71/216 (32.87%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            Y    + +  CLIIN  N+    E  P       R G+  D   +  TF +LHF I+ +++    ++  + K Y  ++ S +    +C IL+HG K  IY  + +   I E +  F    C +   KPK+FFIQACQGD + +GIP       Q  L  +    L  P  +Y     IP+EADF+ GM+TV + V++R+  +G+WYI  LC+ + +
Sbjct:  226 YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHS-NMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMD----LSSPQTRY-----IPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE 431          
BLAST of caspase-8 vs. UniProt/SwissProt
Match: sp|Q92851|CASPA_HUMAN (Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 1.005e-26
Identity = 69/199 (34.67%), Postives = 98/199 (49.25%), Query Frame = 1
Query:  880 KSVCLIINIKNYEHYP-RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            + +C+I+N  ++     R+G+ +D   +   F  L FT+  + N+ K EM  V +      A   G   V  IL HG    +Y  +E L+ IRE    F A  C     KPKLFFIQACQG+      P   I++  ++  Q    L           D IP EADF+ G++TV  YV+FR  ++GSWYI  LC  + K
Sbjct:  283 RGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQ---PSVSIEADALNPEQAPTSL----------QDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKK 468          
BLAST of caspase-8 vs. UniProt/SwissProt
Match: sp|Q8MKI5|CASP3_CANLF (Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.226e-25
Identity = 73/213 (34.27%), Postives = 109/213 (51.17%), Query Frame = 1
Query:  835 YKHDEFYPYPESDRVKSVCLIINIKNYEH----YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            YK D    YPE      +C+IIN KN+       PR G++ D AN+ +TF  L + ++   +L   E++ +  + SK + SK  S  VC +L+HG +  I+  N   V +R+ +  F    C +   KPKLF IQAC+G     GI  +SGI+        +++   K           IP EADF+Y  ST   Y ++R++K GSW+I  LC
Sbjct:   37 YKMD----YPE----MGLCIIINNKNFHKSTGMAPRSGTDVDAANLRETFTNLKYEVRNKNDLTCEEILELMNSVSKEDHSKRSS-FVCVLLSHGDEGIIFGTNGP-VDLRKVTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGIE--------DDMACQK-----------IPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLC 220          
BLAST of caspase-8 vs. TrEMBL
Match: U5QER6 (Caspase-8 OS=Schmidtea mediterranea OX=79327 GN=casp8 PE=2 SV=1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 456/479 (95.20%), Postives = 463/479 (96.66%), Query Frame = 1
Query:  124 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIP-----VRNLNVKTNEKALSL 1545
            MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNL INEQSILKKLNMILKLCIKDPDIFNHFQ YFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP KGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT+  I      + ++++KT+  A  L
Sbjct:    1 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLIINEQSILKKLNMILKLCIKDPDIFNHFQLYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPMKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTNDIISILTNVIHDVSMKTHMNACQL 479          
BLAST of caspase-8 vs. TrEMBL
Match: A0A097ZJ82 (Caspase-8 OS=Dugesia japonica OX=6161 GN=casp8 PE=2 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 281/482 (58.30%), Postives = 369/482 (76.56%), Query Frame = 1
Query:  124 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNF-VYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGI---QSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEKALSLHNQC 1557
            MC  NFHNFY+YDL+ DD EC++FLLSDFL +WDIFQ D+G RIQDFVFLL+ NG +ENETLN+IIESL+++PRLDILYECS+  DSY ++P GKLIC+KRL  F +FNE EE+DFK++L+   + Y K    +  + SIL+ L+ +LK+  ++  +F+  +SYF N+GNNRT+K+V+ +++  E  I  SEQLW+K++ D K   ++   +A+EKGDE S P+F +   EGR+K++ YK DE Y  PE D +KS CLI +I++YE+ PRKGSE+D+  I KTF KLHFTIQ Y+N+ K+EM  +AKTY+ I+A  SGSMLVCFILAHG KDCI+DINEE V+IR+FSL F+AKNCEAY+NKPK+FFIQACQGDRFHEGIPE+ I   +SSQ S  Q     +K  I++YK SD+IPEEADFIYGM+TV+DYVAFRSTKKGSWYI+ELCKR+N+E +T+  I +   NV  +    +  N+C
Sbjct:    1 MCKINFHNFYQYDLSTDDAECIQFLLSDFLLHWDIFQMDNGGRIQDFVFLLIRNGLTENETLNVIIESLYFVPRLDILYECSISYDSYISNPVGKLICNKRLLFFNLFNELEEKDFKSILHILWKEYVKDEPWE-PKCSILQNLDKLLKMSRENDTLFDEIKSYFSNFGNNRTKKVVDVYEENRECTICDSEQLWQKVSNDNKQSNNDKIIIAMEKGDEFSNPSFAINDDEGRMKLINYKADESYLVPERDSIKSFCLIFDIRDYENKPRKGSEKDILKIRKTFEKLHFTIQPYKNVTKSEMFDIAKTYANIDAKSSGSMLVCFILAHGSKDCIFDINEEKVNIRQFSLCFSAKNCEAYRNKPKVFFIQACQGDRFHEGIPETSIDLEESSQCSYLQTGNQPIK--IEEYKKSDMIPEEADFIYGMATVSDYVAFRSTKKGSWYITELCKRINEEVKTNDVIGILT-NVNGDVSRRNYKNKC 478          
BLAST of caspase-8 vs. TrEMBL
Match: A0A218UXT8 (Caspase-8 OS=Lonchura striata domestica OX=299123 GN=CASP8_1 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.576e-35
Identity = 126/457 (27.57%), Postives = 209/457 (45.73%), Query Frame = 1
Query:  160 DLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILY----ECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERD---FKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPN---FVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNY--------EHY---PRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            +L+  +   LKFL  D L    +   ++ R   D    L  +   E   L  + E L++I R+D+L          ++    +P G  +   R  LF++F +  E +   FK LL N           ++ +  + ++  M+        DI    +   L   +N +  +++S    E++ IS    LW +I +  K    E   +  E+      P       +A G +            Y  + R + VCLI+N  N+        EH     R G++ D A +   F KLHF +++Y +L   E+      +   +  +     VC IL+HG K  IY ++ + V IRE +  F A+NC +   KPK+FFIQACQG+ FH+G+    I++  +   +E+  + +    Q    D IP EADF+ GM+T+ DYV++RS K+G+WYI  LC+ +
Sbjct:   14 ELDRAELAALKFLSRDHLLGRKL---EAVRSPYDLFEALQESCLLEAGNLAFLRELLYHIGRIDLLVAHLGSSREQVERELRAPGGARVPPFRYLLFQLFEDVTEDELMSFKLLLVN-----------ELPKSKLTRETTML--------DILIEMEKKGLLGKDNLS--MLKSL--CEKINIS----LWNRIEDGLKLFGQEEVLITEEQRGSTGCPGGHLVSSAAPGPLGSFNDSSQLLEAYKMTSRPRGVCLILNNHNFAKAREGVLEHKHLKDRNGTDVDAAALRNVFSKLHFRVEEYRDLTAEEIRETVNIFQSAD-HEDKDCFVCCILSHGKKGIIYGVDGQEVPIRELTTSFTAQNCISLAGKPKVFFIQACQGEAFHKGV---AIETDSV---EEDCSVERDARFQL---DCIPAEADFLLGMATLQDYVSYRSPKEGTWYIQALCQHL 430          
BLAST of caspase-8 vs. TrEMBL
Match: A0A091TQH1 (Caspase-8 (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_13640 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.283e-34
Identity = 80/217 (36.87%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY----EHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI---PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            Y  + R + VCLI+N  N+    E  P       R G++ D A + K F KLHFTI +Y +L   E+      Y + E  K     VC IL+HG K  IY ++ + V I++ +  F  +NC +   KPK+FF+QACQGD   +G+    +SG Q S +             I      D IP EADF+ GM+T+ DYV++RS ++G+WYI  LC+ +
Sbjct:  128 YKMTSRPRGVCLILNNHNFAKAREAVPEPKNMKDRNGTDVDAAALRKVFSKLHFTIAEYRDLTAEEIRKTVNIY-RCEDHKDKDCFVCCILSHGKKGIIYGVDGQEVPIQDLTTSFTGENCRSLAGKPKVFFVQACQGDVCQKGVTIETDSGEQDSSVE------------IDARFQLDCIPTEADFLLGMATLQDYVSYRSPRQGTWYIQALCQHL 331          
BLAST of caspase-8 vs. TrEMBL
Match: A0A0Q3P7N4 (Caspase-8-like protein OS=Amazona aestiva OX=12930 GN=AAES_132140 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.953e-34
Identity = 133/472 (28.18%), Postives = 207/472 (43.86%), Query Frame = 1
Query:  160 DLNDDDTECLKFLLSDF--LRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDIL------------YECSVPIDSYKTSPFGKLICSKRLFLFKI---FNEFEERDFKTLLNN---FCRAYCKSFNLKI----NEQSILKK--LNMILKLCIK-DPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIIN----IKNYEHYP-------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIP-ESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            +L + D   LKFL      +R  +  Q     + QDF   L   G  E E L  ++E L+ I R+D+L             E  +P    K SP+       R  LF++     E+E + FK LL      CR   ++  L +     ++ IL +  L+++ +LC + D  +    + Y L  G              EE+ ++ +++     TE          YLA     +  +P+            + +  E   Y  + R + VCLI+N     K  E  P       R G++ D   + + F KLHFTI ++ +L   E+      Y + +  K     VC IL+HG K  IY ++ + V IRE +  F  +NC +   KPK+FF+QACQGD   EG+  E+  +    S+  +    L          + IP EADF+ GM+T+ DYV++RS   G+WYI  LC
Sbjct:   14 ELGEGDLAALKFLSRGHIPMRKLEAIQ-----KAQDFFEALQEKGMIEEENLFFLMELLYRIRRIDLLESHLDTSREKMERELQIP-GRAKVSPY-------RYLLFQLSEEITEYELKSFKFLLGQELPKCRLIPQATMLDVFTEMEKRGILGEDNLSVLRRLCEEIDISLLKTIEEYELKLGE-------------EEMVVTEAQRSSTGGTEAHAR------YLASSVAPD--SPDS-----------QNESSEVQAYKMTSRPRGVCLILNNHSFAKARERVPELKNMKDRTGTDIDAGALKRVFSKLHFTIAEHRDLTAEEIRETVNIY-RCKDHKDKDCFVCCILSHGKKGMIYGVDGQEVPIRELTTSFTGQNCYSLAGKPKVFFVQACQGDACQEGVNIETDSKEPDDSVETDARFQL----------ECIPTEADFLLGMATLQDYVSYRSPCHGTWYIQALC 429          
BLAST of caspase-8 vs. Ensembl Cavefish
Match: casp3b (caspase-3 [Source:NCBI gene;Acc:103025383])

HSP 1 Score: 114.39 bits (285), Expect = 6.682e-28
Identity = 76/240 (31.67%), Postives = 116/240 (48.33%), Query Frame = 1
Query:  769 KGDE-VSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            KG E V T +    ++  V M +Y+ D    YP   +    C+IIN +N++       R G++ D   + K F +L F      N   ++M  +  + SK + SKS +M VC +L+HG +  I+   +  + ++E + +F    C +   KPKLFFIQAC+G     GI    +  S      E  H              IP EADF+Y  ST   Y ++R+T  GSW+IS LC+ + K
Sbjct:   25 KGSETVHTASVPAKSKAPVDMFRYRMD----YPNLGK----CIIINNRNFDRSTGMSDRAGTDVDAGKMLKVFSELGFKASVQNNRTVSQMRQILTSASKEDHSKS-AMFVCVMLSHGDEGTIFG-TDGCMELKELTRLFRGNQCPSLAGKPKLFFIQACRGSELDPGIETDSVDDS------EGTHK-------------IPVEADFLYVYSTAPGYYSWRNTANGSWFISSLCEMLAK 235          
BLAST of caspase-8 vs. Ensembl Cavefish
Match: casp3b (caspase-3 [Source:NCBI gene;Acc:103025383])

HSP 1 Score: 113.62 bits (283), Expect = 6.992e-26
Identity = 82/274 (29.93%), Postives = 124/274 (45.26%), Query Frame = 1
Query:  703 LWEKITEDEKHCLDENYYLALEKGDEVS-------------TPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            L E  +  E    +EN   A E GD V              T +    ++  V M +Y+ D    YP   +    C+IIN +N++       R G++ D   + K F +L F      N   ++M  +  + SK + SKS +M VC +L+HG +  I+  +   + ++E + +F    C +   KPKLFFIQAC+G     GI    +  S      E  H              IP EADF+Y  ST   Y ++R+T  GSW+IS LC+ + K
Sbjct:  402 LMEARSITETMADEENGSKAAEGGDSVDAKASNPKGSETVHTASVPAKSKAPVDMFRYRMD----YPNLGK----CIIINNRNFDRSTGMSDRAGTDVDAGKMLKVFSELGFKASVQNNRTVSQMRQILTSASKEDHSKS-AMFVCVMLSHGDEGTIFGTDG-CMELKELTRLFRGNQCPSLAGKPKLFFIQACRGSELDPGIETDSVDDS------EGTHK-------------IPVEADFLYVYSTAPGYYSWRNTANGSWFISSLCEMLAK 646          
BLAST of caspase-8 vs. Ensembl Cavefish
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:103041716])

HSP 1 Score: 109.768 bits (273), Expect = 8.303e-26
Identity = 68/212 (32.08%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  853 YPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            + Y  S R    C+IIN KN++       R G++RD   ++K F  L F +  Y +    +M  + K  S+ + S S S   C +L+HG +  IY  +  +  I+  + +F    C++   KPKLFFIQAC+G  F +GI  +SG  +  I       H              IP EADF++  STV  Y ++R+  +GSW++  LC  +N+
Sbjct:   96 FQYKMSHRRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKNLGFDVFVYNDQTCAKMERLLKEVSEEDHSDS-SCFACILLSHGEEGMIYGTDGAM-PIKSMTSLFRGDMCKSLVGKPKLFFIQACRGSEFDDGIQTDSGPPNDTIETDANPRHK-------------IPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNE 292          
BLAST of caspase-8 vs. Ensembl Cavefish
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:103041716])

HSP 1 Score: 109.768 bits (273), Expect = 8.303e-26
Identity = 68/212 (32.08%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  853 YPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            + Y  S R    C+IIN KN++       R G++RD   ++K F  L F +  Y +    +M  + K  S+ + S S S   C +L+HG +  IY  +  +  I+  + +F    C++   KPKLFFIQAC+G  F +GI  +SG  +  I       H              IP EADF++  STV  Y ++R+  +GSW++  LC  +N+
Sbjct:   96 FQYKMSHRRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKNLGFDVFVYNDQTCAKMERLLKEVSEEDHSDS-SCFACILLSHGEEGMIYGTDGAM-PIKSMTSLFRGDMCKSLVGKPKLFFIQACRGSEFDDGIQTDSGPPNDTIETDANPRHK-------------IPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNE 292          
BLAST of caspase-8 vs. Ensembl Cavefish
Match: ENSAMXT00000034295.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001829.1:2219:15770:-1 gene:ENSAMXG00000030411.1 transcript:ENSAMXT00000034295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 7.605e-25
Identity = 63/203 (31.03%), Postives = 99/203 (48.77%), Query Frame = 1
Query:  889 CLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI----PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            C+IIN KN+        R G++ D  N  K FGKL + ++ + +   +++  V    ++ + S+  S LVC +L+HG +   +  +  L  ++  + +F    C +   KPKLFFIQAC+G     GI    P  G                  P+K       IP EADF+Y  ST   Y ++R+T  GSW++  LC+ V+K
Sbjct:   61 CIIINNKNFHRSTGMNQRNGTDVDAGNAMKAFGKLGYKVKVFNDQTVDQIKQVLTAVAREDHSRCAS-LVCVLLSHGDEGVFFGTDGAL-ELKSLTSLFRGDRCTSLVGKPKLFFIQACRGTDLDAGIEMDSPPDG-----------------SPVK-------IPVEADFLYAYSTAPGYYSWRNTMTGSWFMQSLCEMVSK 237          
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005841.1 (pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-1 gene:ENSPMAG00000005266.1 transcript:ENSPMAT00000005841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 3.636e-28
Identity = 75/242 (30.99%), Postives = 124/242 (51.24%), Query Frame = 1
Query:  874 RVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEEL-VSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEKALSLHNQCMELLENNDE 1584
            + KS C+IIN +N+        RKG++RD   +   F  L F ++ Y++L   +M+   K  S  E   + +  VC IL+HG +  +Y  +  L VSI   + IF+ K+C +   KPKLFFIQAC+G  F EG+ +  +   + S   ++    KPP+           E DF+Y  STV  Y ++R+ +KGSW+I  LC+ + + +     + +  + V  N +  + +  C   +  ND+
Sbjct:   11 QAKSKCIIINNENFSPQTGMNRRKGTDRDAMQLQVCFLSLGFQVESYKDLTCKQMVENLKKASS-EDHGTRACFVCAILSHGEEGVLYGTDGTLPVSI--LADIFSEKHCPSLAGKPKLFFIQACRGSMFDEGVDQ--VDGLRRSDDTDSRGYSKPPV-----------EPDFLYAFSTVPGYYSWRNEEKGSWFIQSLCEELLRNSSQ---LELVKILVCVNRRVATQYVSCSRDITYNDK 233          
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005498.1 (pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 gene:ENSPMAG00000004980.1 transcript:ENSPMAT00000005498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 1.570e-27
Identity = 72/208 (34.62%), Postives = 108/208 (51.92%), Query Frame = 1
Query:  859 YPESDRVKSVCLIIN----IKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            YP  +  + +CLIIN      +++  P    R+G+  D   + K F  L F I  + NL   +MI    + SK+   K+  + VC IL HG  +C++  + + + I E +  FN   C++   KPKLFFIQACQG   HE       + S+  L  +       P+     S  IP+EAD + GM+TV+ Y++FR  ++GSWYI  LC
Sbjct:  268 YPVKNNPRGICLIINNEEFSSDFKTSPKLKKREGTHIDAEKLEKVFKYLGFKILLHNNLTVGQMIETLMSCSKMN-HKNHDVFVCCILTHGEINCVFGSDGKSLLITEVTSYFNGSACKSLLGKPKLFFIQACQG---HE-------KQSECHLAADADIDADGPVSPISYS--IPDEADILLGMATVSGYLSFRHRREGSWYIQTLC 462          
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005440.1 (pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 gene:ENSPMAG00000004940.1 transcript:ENSPMAT00000005440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 2.218e-17
Identity = 55/208 (26.44%), Postives = 101/208 (48.56%), Query Frame = 1
Query:  889 CLIINIKNYEHYPRKG------SERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPE----EADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQ 1482
            C+IIN +N+  +PR G      ++ DV+ + + F  L F ++  ++L   EM +  K  S+ E  K+ + LVC +L+HG    +Y  +  L  + +    F   +C +   KP+L FIQAC+G    +G+ +                   P +K+   + ++P     + DF++  +TV+ Y ++R+   GS +I  LC  + +  Q
Sbjct:   13 CIIINNENF--FPRAGMAKRNGTQMDVSRLSECFDSLGFDVKYRKDLTCEEMRTFLKEVSQ-ENLKNCACLVCVVLSHGEDGVVYGTDGPL-PLSDIVKPFADSSCPSLVGKPRLVFIQACRGTLLDKGVDKVECDGD-------------PDVKE---ASLLPTVDLMQPDFLFAFATVSGYFSWRNPANGSCFIQLLCSELQEHGQ 200          
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008466.1 (pep scaffold:Pmarinus_7.0:GL480648:32494:50197:-1 gene:ENSPMAG00000007669.1 transcript:ENSPMAT00000008466.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 4.297e-15
Identity = 54/213 (25.35%), Postives = 95/213 (44.60%), Query Frame = 1
Query:  862 PESDRVKSVCLIINIKNYEH---YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINE-ELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQIS-LTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 1485
            P     +   LIIN  N+       R GSE DV  +   F +L +T   +++ +  E+ ++ K ++K++           +++HGC   ++   + +L+SI       N  NC   K+KPK+  +QAC+ DR    + +    S+    +   N                +P E+D     ST+ D V++RS  KGS+ I  L + + + A T
Sbjct:   19 PRGPARQRQALIINNMNFTGEGLLKRNGSEEDVKYLVWLFKELDYTPIVHKDQSAEEIENLVKKFAKMDEHMHSDSTFVVVMSHGCNRGVFGKGKNDLLSIETIYTALNNNNCPGLKDKPKIIIVQACRADRLALSVVDIATDSAAPKEVVDANWE---------TGGCRVPRESDMTCLYSTLPDDVSYRSRIKGSFLIQHLVEVMKEHACT 222          
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008527.1 (pep scaffold:Pmarinus_7.0:GL477443:35181:37755:1 gene:ENSPMAG00000007721.1 transcript:ENSPMAT00000008527.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 5.447e-11
Identity = 36/119 (30.25%), Postives = 60/119 (50.42%), Query Frame = 1
Query:  889 CLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQAC 1233
            C+IIN K ++       R G++ D   + K F  + F ++   N+ + EM+S     ++ +  +  +  VC +L+HG +  IY  +  L  IR+ +  F    C +   KPKLFFIQ C
Sbjct:   24 CVIINNKTFDQSTGMGERTGTDVDRDMLEKLFKDIGFKVEVKNNMKRKEMVSYITEVAE-KDHRQCACFVCILLSHGDEGVIYGTDNYL-PIRDLTTPFRGDLCRSLVGKPKLFFIQVC 140          
BLAST of caspase-8 vs. Ensembl Nematostella
Match: EDO34460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA7])

HSP 1 Score: 126.331 bits (316), Expect = 6.806e-33
Identity = 77/228 (33.77%), Postives = 123/228 (53.95%), Query Frame = 1
Query:  859 YPESDRVKSVCLIINIKNY---EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEK 1533
            YP + R + +CLII+ +++   E   R G+E+DV N+ +TF  LHF ++  ++   +EM ++A+ +S I+ S +  + VC IL+HG    IY  +  L+ I E S  F    C    +KPKLFFIQAC+G  F  GI     +    S            ++Q  N++  P E+ F+ G +T   YV++RS   GSWYIS LC+ ++   + +    +  + VK N+K
Sbjct:    4 YPMTSRPRGICLIISNQHFDKPELRKRDGNEQDVENLKRTFENLHFVVEIRQDKTASEMYTIAREFSSIDHS-AYDLFVCCILSHGMLGSIYGSDSNLIEINEISSQFKGNACPTLAHKPKLFFIQACRGQDFDRGIQADATRDMDAS----------DAVRQ--NAE--PNESHFLLGYATPPGYVSWRSQVHGSWYISFLCEVLSTYCERY---DLVTMMVKVNDK 213          
BLAST of caspase-8 vs. Ensembl Nematostella
Match: EDO41263 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9])

HSP 1 Score: 100.523 bits (249), Expect = 4.946e-23
Identity = 65/220 (29.55%), Postives = 105/220 (47.73%), Query Frame = 1
Query:  889 CLIINIKNYEH----YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEKA 1536
            CLIIN   ++       R GS+ D +N+   F  L + +++  +L   +M +    ++K     S S++VC IL+HG +  IY ++  L++I +   +FN    +    KPKLFF+QAC+G  F  G     I S                     +   +P EADF+   +TV  YV++R  +KGSW+I  L +    +A T     V ++ +K N K 
Sbjct:  129 CLIINNVRFDADSGLKSRAGSDIDASNLQSLFMSLRYRVKRLNDLTMRQMKNTLFDFAKNNHKNSDSVVVC-ILSHGLEGRIYGVDGGLLNISDVISMFNGYQAKDLIGKPKLFFLQACRGGDFDHGARMEQIDSP-------------------TDKSSLPSEADFLIAYATVPGYVSWRHQEKGSWFIQALVEVFKTDATTE---DVLSMLIKVNRKV 325          
BLAST of caspase-8 vs. Ensembl Nematostella
Match: EDO41832 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364])

HSP 1 Score: 86.2705 bits (212), Expect = 4.025e-18
Identity = 58/204 (28.43%), Postives = 90/204 (44.12%), Query Frame = 1
Query:  880 KSVCLIINIKNY------EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            + V +IIN K++        YPR G+  D  ++ KTF  L F ++ + N    E   + K   +   S   +M+   IL HG +  +Y   +  + IR     F   N      KPK+F  QACQG  + +G   +       +  Q                  +P EADF+Y  STV  Y ++R++  GSW+I  +C+  NK
Sbjct:  155 RGVAVIINNKDFLPASGMHRYPRNGTNVDRDSLEKTFKALQFDVEVHNNKTTYETNRIIKELGQRSYSNYNAMIFA-ILTHGEEGILY-TTDGTIEIRSMMKAFKGDNLVG---KPKIFIFQACQGHEYMDGKDATDAGPEDANRVQ------------------VPVEADFLYAYSTVPGYYSWRNSVNGSWFIQSICEVFNK 335          
BLAST of caspase-8 vs. Ensembl Nematostella
Match: EDO31855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 78.5666 bits (192), Expect = 1.826e-16
Identity = 57/227 (25.11%), Postives = 104/227 (45.81%), Query Frame = 1
Query:  880 KSVCLIINIKNY---EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEKALSLHN 1551
            K   LIIN + +       RKGS  DV  +Y+ F     T++  +N    EM+ + +  S+ + +K     +C IL+HG    IY ++E+ V +   +  F    C + + KPK+FF+QAC+G +      ES   S  + +    L                P ++DF+   ++   Y ++R+ + GSW+I  +        +T     + +L ++ N +  SL++
Sbjct:    2 KGYVLIINNQEFPSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQNKTSLEMLELLEETSEKDFTKF-DCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSLQGKPKVFFLQACRGAKKELVAVES--DSEPVPIRHSGL----------------PSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEH---LMDLMLRVNHRVASLNS 206          
BLAST of caspase-8 vs. Ensembl Nematostella
Match: EDO42564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 78.5666 bits (192), Expect = 1.826e-16
Identity = 57/227 (25.11%), Postives = 104/227 (45.81%), Query Frame = 1
Query:  880 KSVCLIINIKNY---EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIPVRNLNVKTNEKALSLHN 1551
            K   LIIN + +       RKGS  DV  +Y+ F     T++  +N    EM+ + +  S+ + +K     +C IL+HG    IY ++E+ V +   +  F    C + + KPK+FF+QAC+G +      ES   S  + +    L                P ++DF+   ++   Y ++R+ + GSW+I  +        +T     + +L ++ N +  SL++
Sbjct:    2 KGYVLIINNQEFPSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQNKTSLEMLELLEETSEKDFTKF-DCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSLQGKPKVFFLQACRGAKKELVAVES--DSEPVPIRHSGL----------------PSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEH---LMDLMLRVNHRVASLNS 206          
BLAST of caspase-8 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 115.161 bits (287), Expect = 4.587e-28
Identity = 71/205 (34.63%), Postives = 104/205 (50.73%), Query Frame = 1
Query:  883 SVCLIINIKNYEH----YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 1485
             +CLIIN KN+       PR G++ D A  +K+F KL + IQ Y +   ++M  + +  S  + SK  S   C IL+HG +  IY  +   VS  +       ++C +   KPKLFFIQAC+G  F EGI       +                     S+ IP EADF++  STV+ Y ++RST  GSW+I  LC+ + K ++T
Sbjct:   58 GICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSKFAS-FACVILSHGEEGVIYGTDGP-VSFNKLIECLKGRSCLSLVGKPKLFFIQACRGTLFDEGIEHDAKDDT---------------------SEKIPLEADFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKT 239          
BLAST of caspase-8 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 114.775 bits (286), Expect = 4.751e-28
Identity = 71/205 (34.63%), Postives = 104/205 (50.73%), Query Frame = 1
Query:  883 SVCLIINIKNYEH----YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 1485
             +CLIIN KN+       PR G++ D A  +K+F KL + IQ Y +   ++M  + +  S  + SK  S   C IL+HG +  IY  +   VS  +       ++C +   KPKLFFIQAC+G  F EGI       +                     S+ IP EADF++  STV+ Y ++RST  GSW+I  LC+ + K ++T
Sbjct:   56 GICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSKFAS-FACVILSHGEEGVIYGTDGP-VSFNKLIECLKGRSCLSLVGKPKLFFIQACRGTLFDEGIEHDAKDDT---------------------SEKIPLEADFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKT 237          
BLAST of caspase-8 vs. Ensembl Medaka
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:101161677])

HSP 1 Score: 112.849 bits (281), Expect = 2.745e-27
Identity = 73/241 (30.29%), Postives = 118/241 (48.96%), Query Frame = 1
Query:  766 EKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            +K  +   P   YS+E   +++       + Y  S +    C+IIN KN++       R G++RD   +YK F  L F +  Y +   ++M  + K  S+ + S S S   C +L+HG +  IY   +  + I+  + +F    C++   KPKLFFIQAC+G  F EG+  +SG  +  I       H              IP EADF++  STV  Y ++R+  +GSW++  LC  +N+
Sbjct:   13 KKNKDGQKPEKDYSSESHPRIVS----STFQYKMSHQRVGKCIIINNKNFDDNTGMNVRNGTDRDAGELYKCFKSLGFDVSIYNDQTCDKMEHLLKEASQEDHSDS-SCFACILLSHGEEGMIYGT-DGAIPIKTMTSLFRGDKCKSLVGKPKLFFIQACRGSEFDEGVQTDSGPPNDTIETDANPSHK-------------IPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNE 234          
BLAST of caspase-8 vs. Ensembl Medaka
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:101161677])

HSP 1 Score: 113.235 bits (282), Expect = 2.951e-27
Identity = 72/233 (30.90%), Postives = 115/233 (49.36%), Query Frame = 1
Query:  790 PNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP----RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGI-PESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK 1473
            P   YS+E   +++       + Y  S +    C+IIN KN++       R G++RD   +YK F  L F +  Y +   ++M  + K  S+ + S S S   C +L+HG +  IY   +  + I+  + +F    C++   KPKLFFIQAC+G  F EG+  +SG  +  I       H              IP EADF++  STV  Y ++R+  +GSW++  LC  +N+
Sbjct:   50 PEKDYSSESHPRIVS----STFQYKMSHQRVGKCIIINNKNFDDNTGMNVRNGTDRDAGELYKCFKSLGFDVSIYNDQTCDKMEHLLKEASQEDHSDS-SCFACILLSHGEEGMIYGT-DGAIPIKTMTSLFRGDKCKSLVGKPKLFFIQACRGSEFDEGVQTDSGPPNDTIETDANPSHK-------------IPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNE 263          
BLAST of caspase-8 vs. Ensembl Medaka
Match: ENSORLT00000013986.2 (caspase-8 [Source:NCBI gene;Acc:100125536])

HSP 1 Score: 110.153 bits (274), Expect = 1.182e-25
Identity = 65/236 (27.54%), Postives = 114/236 (48.31%), Query Frame = 1
Query:  832 KYKHDEFYPYPESDRVKSVCLIINIKNY-EHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISV-----------------AKTYSKI------EASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV 1467
            + K +E Y    + R   +C+IIN +N+ +   R+G+E+D  ++ + F  L F +   ++   ++M                    A+ +S+       +A + G   VC IL+HG K  +  I++  V I+  + IF A    A   KPK+F IQACQG + H+G+  + +++   S                  +  IPEEAD +  ++TV DY A+R   +GSW++  LC+++
Sbjct:  121 RQKREEVYQL--NTRPVGICVIINNQNFLDGSVRRGTEKDAESLAEVFSWLGFRVLMCKDQTSDQMKGTLECLSLLSSSTDLLKLQAQEWSESRYAGPQQALQHGDAFVCCILSHGQKGMVLGIDQMPVPIKHITRIFKASEQSALTGKPKMFLIQACQGGQIHKGVALTDVEADDCS------------------TQTIPEEADILVALATVEDYPAYRHISEGSWFVQSLCQQL 336          
BLAST of caspase-8 vs. Planmine SMEST
Match: SMESG000005044.1 (SMESG000005044.1)

HSP 1 Score: 927.161 bits (2395), Expect = 0.000e+0
Identity = 457/479 (95.41%), Postives = 464/479 (96.87%), Query Frame = 1
Query:  124 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIP-----VRNLNVKTNEKALSL 1545
            MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNL INEQSILKKLNMILKLCIKDPDIFNHFQ YFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT+  I      + ++++KT+  A  L
Sbjct:    1 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLIINEQSILKKLNMILKLCIKDPDIFNHFQLYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTNDIISILTNVIHDVSMKTHMNACQL 479          
BLAST of caspase-8 vs. Planmine SMEST
Match: SMESG000005044.1 (SMESG000005044.1)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 452/455 (99.34%), Postives = 452/455 (99.34%), Query Frame = 1
Query:  124 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKLCIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTH 1488
            MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNL INEQSILKKLNMILKLCIKDPDIFNHFQ YFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQT 
Sbjct:    1 MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFLLLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSKRLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLIINEQSILKKLNMILKLCIKDPDIFNHFQLYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITEDEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTQ 455          
BLAST of caspase-8 vs. Planmine SMEST
Match: SMESG000053168.1 (SMESG000053168.1)

HSP 1 Score: 115.931 bits (289), Expect = 7.858e-29
Identity = 78/226 (34.51%), Postives = 111/226 (49.12%), Query Frame = 1
Query:  886 VCLIINIKNYEHYP------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNKEAQTHWPIP--VR-NLNVKTNEKA 1536
            +C IIN  N E  P      R G++RD   +   F KL FT++ ++N   + M+   +  S+ +  K  SM VCFIL+HG +  IY   +  + I      F    C+    KPKLFFIQAC+GDRF +GI      S+ I                    + IP EAD + G STV  Y ++R++  GSWY+  LC    K A++   +   VR N NV +N K+
Sbjct:   19 LCYIIN--NEEFDPKLNLSVRSGTQRDFEKLKALFRKLGFTVENHKNCTADMMLKNLEEISQRKNLKDYSMFVCFILSHGDEGIIYG-RDHFIQIDRLLGYFKGDKCKGLVGKPKLFFIQACRGDRFDKGIFADAGDSNNI--------------------EKIPIEADVLVGYSTVPGYFSWRNSSNGSWYVQALCNEFEKNAKSDDVVSLLVRVNANVASNFKS 221          
BLAST of caspase-8 vs. Planmine SMEST
Match: SMESG000053166.1 (SMESG000053166.1)

HSP 1 Score: 107.842 bits (268), Expect = 5.528e-26
Identity = 75/222 (33.78%), Postives = 105/222 (47.30%), Query Frame = 1
Query:  811 EGRVKMLKYKHDEFYPYPESDRVKSVCLIINIKNYEHYP------RKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELC 1458
            E    M+  K  E Y   E  ++K +C IIN  N E  P      R G+  D   + + F KL F ++ Y+N   +E+ S  K  S+ +  K  S+LV  IL+HG +  IY  +  +   R F   F    C     KPK+F IQAC+GD++  G+      S+ I                    + IP EADF+ G STVA Y ++R+ K GSWYI  LC
Sbjct:   13 EDNFDMVDGKESEIY---EISKIK-LCFIIN--NEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGY-FKGDKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--------------------EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLC 207          
BLAST of caspase-8 vs. Planmine SMEST
Match: SMESG000016936.1 (SMESG000016936.1)

HSP 1 Score: 102.449 bits (254), Expect = 3.481e-24
Identity = 71/231 (30.74%), Postives = 110/231 (47.62%), Query Frame = 1
Query:  880 KSVCLIINIKNYEH----YPRKGSERDVANIYKTFGKLHFTIQKYENLNKNEMISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIFNAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLKPPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRV----NKEAQTHWPIPVRNLNVKTNEKALSLH 1548
            K  C IIN + ++       RKG+ +D  N++ T  K  F I    N    EM+   K  S        S+ +C IL+HG  + IY   E+ + IR     F    C+A + KPK+F IQAC+G++   G+    + S+ I+                     +P E +F+ G STV+DY+++R+   GSWYI   C+ V    +KE   H  + V N NV +  K+ S++
Sbjct:   18 KKFCYIINNEVFDAKLRLSKRKGTNKDFQNLFDTLTKFEFEIYWANNCRSLEMLQNLKKISLRPDLGEYSIFLCIILSHGSDEIIYGF-EDFIEIRRLLHPFKENECKALQGKPKVFIIQACKGNKCDPGVLADDLYSNNIA--------------------AVPMELNFLIGYSTVSDYLSWRNEVVGSWYIHSFCEIVRKYGDKEDLLHLLVRVNN-NVSSKFKSKSMY 226          
The following BLAST results are available for this feature:
BLAST of caspase-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASP88.990e-2932.87caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509][more]
CASP88.990e-2932.87caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509][more]
CASP81.123e-2832.87caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509][more]
CASP81.134e-2832.87caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509][more]
CASP81.134e-2832.87caspase 8 [Source:HGNC Symbol;Acc:HGNC:1509][more]
back to top
BLAST of caspase-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ced-33.852e-2427.56Cell death protein 3 Cell death protein 3 subunit ... [more]
ced-31.231e-2227.70Cell death protein 3 Cell death protein 3 subunit ... [more]
csp-16.984e-1926.16Caspase A Caspase A subunit p16 Caspase A subunit ... [more]
csp-11.354e-1726.16Caspase A Caspase A subunit p16 Caspase A subunit ... [more]
csp-22.800e-1124.15Putative inactive caspase B Putative inactive casp... [more]
back to top
BLAST of caspase-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drice1.937e-1929.66gene:FBgn0019972 transcript:FBtr0085482[more]
Decay2.262e-1827.62gene:FBgn0028381 transcript:FBtr0083304[more]
Dcp-14.744e-1726.15gene:FBgn0010501 transcript:FBtr0072062[more]
Dredd4.637e-1424.88gene:FBgn0020381 transcript:FBtr0114560[more]
Dredd5.147e-1424.88gene:FBgn0020381 transcript:FBtr0114559[more]
back to top
BLAST of caspase-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp3a2.727e-2732.16caspase 3, apoptosis-related cysteine peptidase a ... [more]
casp3a2.727e-2732.16caspase 3, apoptosis-related cysteine peptidase a ... [more]
casp3b3.322e-2734.54caspase 3, apoptosis-related cysteine peptidase b ... [more]
casp77.439e-2531.40caspase 7, apoptosis-related cysteine peptidase [S... [more]
dytn2.001e-2430.95dystrotelin [Source:NCBI gene;Acc:563097][more]
back to top
BLAST of caspase-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp3.21.295e-2532.41caspase 3, gene 2 [Source:NCBI gene;Acc:100151728][more]
casp101.616e-2535.41caspase 10 [Source:NCBI gene;Acc:548432][more]
casp101.621e-2535.41caspase 10 [Source:NCBI gene;Acc:548432][more]
ENSXETT00000003846.14.912e-2327.35caspase 3, gene 1 [Source:NCBI gene;Acc:100486222][more]
bmt21.067e-2130.94base methyltransferase of 25S rRNA 2 homolog [Sour... [more]
back to top
BLAST of caspase-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Casp86.935e-3527.73caspase 8 [Source:MGI Symbol;Acc:MGI:1261423][more]
Casp86.935e-3527.73caspase 8 [Source:MGI Symbol;Acc:MGI:1261423][more]
Casp83.022e-3327.33caspase 8 [Source:MGI Symbol;Acc:MGI:1261423][more]
Casp83.022e-3327.33caspase 8 [Source:MGI Symbol;Acc:MGI:1261423][more]
Casp36.107e-2634.27caspase 3 [Source:MGI Symbol;Acc:MGI:107739][more]
back to top
BLAST of caspase-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O89110|CASP8_MOUSE2.114e-3227.33Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 S... [more]
sp|Q9JHX4|CASP8_RAT8.586e-3026.54Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 P... [more]
sp|Q14790|CASP8_HUMAN5.447e-2832.87Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV... [more]
sp|Q92851|CASPA_HUMAN1.005e-2634.67Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 ... [more]
sp|Q8MKI5|CASP3_CANLF2.226e-2534.27Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CAS... [more]
back to top
BLAST of caspase-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U5QER60.000e+095.20Caspase-8 OS=Schmidtea mediterranea OX=79327 GN=ca... [more]
A0A097ZJ820.000e+058.30Caspase-8 OS=Dugesia japonica OX=6161 GN=casp8 PE=... [more]
A0A218UXT81.576e-3527.57Caspase-8 OS=Lonchura striata domestica OX=299123 ... [more]
A0A091TQH12.283e-3436.87Caspase-8 (Fragment) OS=Phaethon lepturus OX=97097... [more]
A0A0Q3P7N43.953e-3428.18Caspase-8-like protein OS=Amazona aestiva OX=12930... [more]
back to top
BLAST of caspase-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp3b6.682e-2831.67caspase-3 [Source:NCBI gene;Acc:103025383][more]
casp3b6.992e-2629.93caspase-3 [Source:NCBI gene;Acc:103025383][more]
casp78.303e-2632.08caspase 7 [Source:NCBI gene;Acc:103041716][more]
casp78.303e-2632.08caspase 7 [Source:NCBI gene;Acc:103041716][more]
ENSAMXT00000034295.17.605e-2531.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of caspase-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005841.13.636e-2830.99pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-... [more]
ENSPMAT00000005498.11.570e-2734.62pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 ge... [more]
ENSPMAT00000005440.12.218e-1726.44pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 ge... [more]
ENSPMAT00000008466.14.297e-1525.35pep scaffold:Pmarinus_7.0:GL480648:32494:50197:-1 ... [more]
ENSPMAT00000008527.15.447e-1130.25pep scaffold:Pmarinus_7.0:GL477443:35181:37755:1 g... [more]
back to top
BLAST of caspase-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of caspase-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344606.806e-3333.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412634.946e-2329.55Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9][more]
EDO418324.025e-1828.43Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364][more]
EDO318551.826e-1625.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425641.826e-1625.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of caspase-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp34.587e-2834.63caspase 3 [Source:NCBI gene;Acc:100049215][more]
casp34.751e-2834.63caspase 3 [Source:NCBI gene;Acc:100049215][more]
casp72.745e-2730.29caspase 7 [Source:NCBI gene;Acc:101161677][more]
casp72.951e-2730.90caspase 7 [Source:NCBI gene;Acc:101161677][more]
ENSORLT00000013986.21.182e-2527.54caspase-8 [Source:NCBI gene;Acc:100125536][more]
back to top
BLAST of caspase-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005044.10.000e+095.41SMESG000005044.1[more]
SMESG000005044.10.000e+099.34SMESG000005044.1[more]
SMESG000053168.17.858e-2934.51SMESG000053168.1[more]
SMESG000053166.15.528e-2633.78SMESG000053166.1[more]
SMESG000016936.13.481e-2430.74SMESG000016936.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033974
GenBankAGY56134.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033974 ID=SMED30033974|Name=caspase-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1869bp
AAAGATTATAACATTTAGCGAAATTTATTTGTATGCTTTTTGATAATAAA
GTTTATCCGAATTCCTAGATTTTATAAATATAACTTTCATATTTATTCAT
TATTTTATTTACTCATTCGCAAAATGTGTCTTAGTAATTTTCATAACTTT
TATAAATATGATTTGAACGACGATGATACAGAATGTTTGAAATTTCTGTT
ATCAGATTTTCTACGTAACTGGGACATTTTTCAAAATGACAGTGGAAGGA
GAATCCAAGATTTTGTTTTTTTATTACTAATAAATGGATTTAGTGAAAAT
GAAACTCTAAATATCATAATTGAATCGTTGTTTTATATTCCCAGACTAGA
TATATTATACGAATGCTCGGTACCCATTGATTCTTATAAAACATCTCCGT
TTGGGAAATTGATTTGTAGTAAAAGATTGTTTTTATTTAAAATATTTAAC
GAATTCGAAGAACGCGATTTCAAAACTTTATTAAATAATTTCTGTCGAGC
GTATTGTAAAAGTTTTAATTTAAAAATAAATGAACAATCAATTTTAAAAA
AGTTAAATATGATTTTGAAACTTTGTATAAAGGATCCGGATATTTTTAAT
CATTTCCAATCGTATTTTTTAAATTACGGAAATAATCGAACGGAAAAACT
TGTTGAGAGTTTTAAAGATTTTGAAGAACTACAGATATCTCCAAGTGAAC
AATTATGGGAAAAAATTACAGAAGATGAAAAACATTGTCTTGATGAAAAC
TATTATCTTGCTCTCGAAAAAGGGGATGAAGTTTCTACACCGAATTTTGT
ATATAGTGCTGAAGGCCGAGTGAAAATGTTGAAATATAAACACGACGAAT
TTTATCCATATCCTGAATCGGATCGAGTTAAAAGTGTTTGTTTAATAATT
AACATTAAAAATTATGAGCATTATCCAAGGAAAGGATCTGAAAGAGACGT
TGCTAACATTTACAAAACTTTTGGAAAATTGCATTTTACAATACAAAAGT
ACGAAAATCTTAATAAAAATGAGATGATTTCAGTTGCTAAAACCTATTCT
AAAATAGAAGCCAGTAAATCCGGATCAATGCTGGTTTGTTTCATATTAGC
TCATGGTTGCAAGGACTGTATTTATGATATCAACGAAGAATTAGTAAGCA
TAAGGGAATTTAGTCTGATTTTCAATGCAAAAAATTGCGAAGCATACAAA
AATAAACCCAAATTATTTTTTATACAAGCTTGTCAAGGAGATCGATTTCA
CGAAGGTATTCCAGAATCAGGAATTCAATCATCTCAAATCTCTTTAACTC
AAGAAAATTTACATCTCTTAAAACCTCCAATAAAACAATACAAGAACTCG
GATATAATACCCGAAGAAGCTGATTTTATTTATGGAATGTCAACAGTTGC
GGATTATGTTGCATTTAGATCTACCAAAAAGGGATCTTGGTATATTTCTG
AGCTTTGTAAAAGAGTCAATAAAGAGGCTCAAACACACTGGCCTATTCCA
GTCAGAAATTTGAATGTAAAAACTAATGAAAAGGCTCTTTCTCTTCACAA
TCAATGCATGGAGTTGTTAGAAAATAACGATGAAGATTACGAGCGAGTAA
ATGCTATTAAACGTGGCTGTAATGCATTGCTTGATGGTTATCGGCAAATT
TTGCGCAATAAACGTAGAGAAGCCAAACAAGGGGATCTAGATTTCTTTAT
ACAACGTCGAGAAAATGAATAAATCATTAATTTATCCATTGTATTTTTTT
TAAAATTCTTAATGTTATTTTCAATGTTTATTTAATTTTTTATGTTTTTT
CTATACTTGCCATTTACCAGAGCGAATTTTTATATTTTTCATTATCCTTA
ATATAATTTTTTTTACTCC
back to top

protein sequence of SMED30033974-orf-1

>SMED30033974-orf-1 ID=SMED30033974-orf-1|Name=SMED30033974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=533bp
MCLSNFHNFYKYDLNDDDTECLKFLLSDFLRNWDIFQNDSGRRIQDFVFL
LLINGFSENETLNIIIESLFYIPRLDILYECSVPIDSYKTSPFGKLICSK
RLFLFKIFNEFEERDFKTLLNNFCRAYCKSFNLKINEQSILKKLNMILKL
CIKDPDIFNHFQSYFLNYGNNRTEKLVESFKDFEELQISPSEQLWEKITE
DEKHCLDENYYLALEKGDEVSTPNFVYSAEGRVKMLKYKHDEFYPYPESD
RVKSVCLIINIKNYEHYPRKGSERDVANIYKTFGKLHFTIQKYENLNKNE
MISVAKTYSKIEASKSGSMLVCFILAHGCKDCIYDINEELVSIREFSLIF
NAKNCEAYKNKPKLFFIQACQGDRFHEGIPESGIQSSQISLTQENLHLLK
PPIKQYKNSDIIPEEADFIYGMSTVADYVAFRSTKKGSWYISELCKRVNK
EAQTHWPIPVRNLNVKTNEKALSLHNQCMELLENNDEDYERVNAIKRGCN
ALLDGYRQILRNKRREAKQGDLDFFIQRRENE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR002398Pept_C14
IPR015917Pept_C14A
IPR029030Caspase-like_dom_sf
IPR033139Caspase_cys_AS
IPR001875DED_dom
IPR002138Pept_C14_p10
IPR001309Pept_C14_p20
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0005515protein binding
GO:0004197cysteine-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0042981regulation of apoptotic process
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015917Peptidase C14A, caspase catalytic domainPRINTSPR00376IL1BCENZYMEcoord: 252..265
score: 29.87
coord: 287..305
score: 17.07
coord: 430..441
score: 46.72
coord: 355..373
score: 57.26
coord: 320..328
score: 40.4
IPR015917Peptidase C14A, caspase catalytic domainSMARTSM00115caspase_2coord: 245..486
e-value: 1.8E-27
score: 107.2
NoneNo IPR availablePFAMPF00656Peptidase_C14coord: 255..468
e-value: 9.3E-35
score: 120.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.1460coord: 232..479
e-value: 2.1E-57
score: 196.2
NoneNo IPR availablePANTHERPTHR10454:SF162CASPASE-8coord: 13..451
IPR002398Peptidase C14 familyPANTHERPTHR10454CASPASEcoord: 13..451
IPR033139Peptidase family C14A, cysteine active sitePROSITEPS01122CASPASE_CYScoord: 361..372
IPR001309Peptidase C14, p20 domainPROSITEPS50208CASPASE_P20coord: 252..374
score: 32.723
IPR001875Death effector domainPROSITEPS50168DEDcoord: 13..78
score: 10.207
IPR002138Peptidase C14, caspase non-catalytic subunit p10PROSITEPS50207CASPASE_P10coord: 412..452
score: 16.288
IPR029030Caspase-like domain superfamilySUPERFAMILYSSF52129Caspase-likecoord: 238..453