SMED30033970

Overview
NameSMED30033970
Smed IDSMED30033970
Length (bp)330
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033970 (SMED30033970) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033970 (SMED30033970) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033970 (SMED30033970) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033970 (SMED30033970) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033970

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30033970 SmedASXL_061222SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30033970 SmedASXL_061222SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30033970 dd_Smed_v4_101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033970 dd_Smed_v4_101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033970 dd_Smed_v4_101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033970 dd_Smed_v4_101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033970 dd_Smed_v4_101_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30033970 dd_Smed_v6_101_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
goblet cellSMED30033970 dd_Smed_v6_101_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033970 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.019840:1606..1924 -1290
v31.027409:3165..3483 +1286
Homology
BLAST of SMED30033970 vs. Ensembl Human
Match: EPPIN (epididymal peptidase inhibitor [Source:HGNC Symbol;Acc:HGNC:15932])

HSP 1 Score: 61.6178 bits (148), Expect = 4.876e-13
Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = -2
Query:   96 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 299
            C+F    +  + K   C +P ETG C AYF+ + +D K   C  FVYGGC  N+NNF ++A C   C+
Sbjct:   45 CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCK 112          
BLAST of SMED30033970 vs. Ensembl Human
Match: EPPIN (epididymal peptidase inhibitor [Source:HGNC Symbol;Acc:HGNC:15932])

HSP 1 Score: 61.6178 bits (148), Expect = 7.397e-13
Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = -2
Query:   96 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 299
            C+F    +  + K   C +P ETG C AYF+ + +D K   C  FVYGGC  N+NNF ++A C   C+
Sbjct:   61 CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCK 128          
BLAST of SMED30033970 vs. Ensembl Human
Match: EPPIN-WFDC6 (EPPIN-WFDC6 readthrough [Source:HGNC Symbol;Acc:HGNC:38825])

HSP 1 Score: 61.2326 bits (147), Expect = 2.289e-12
Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = -2
Query:   96 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 299
            C+F    +  + K   C +P ETG C AYF+ + +D K   C  FVYGGC  N+NNF ++A C   C+
Sbjct:   61 CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCK 128          
BLAST of SMED30033970 vs. Ensembl Human
Match: EPPIN-WFDC6 (EPPIN-WFDC6 readthrough [Source:HGNC Symbol;Acc:HGNC:38825])

HSP 1 Score: 61.2326 bits (147), Expect = 3.255e-12
Identity = 28/68 (41.18%), Postives = 39/68 (57.35%), Query Frame = -2
Query:   96 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 299
            C+F    +  + K   C +P ETG C AYF+ + +D K   C  FVYGGC  N+NNF ++A C   C+
Sbjct:   61 CVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCK 128          
BLAST of SMED30033970 vs. Ensembl Human
Match: WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30916])

HSP 1 Score: 62.7734 bits (151), Expect = 3.440e-12
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LP   G C+AY  R+ ++ + G+C++FVYGGC  N NNF +R  CEE C
Sbjct:  293 CSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEESC 343          
BLAST of SMED30033970 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 61.6178 bits (148), Expect = 3.254e-12
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -2
Query:   99 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 290
            V  LQ + ++A  C+LP E G C+ Y +R+ F+  L +C+ F +GGC  N NNF    +CE  C
Sbjct:  526 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 2 Score: 60.8474 bits (146), Expect = 5.775e-12
Identity = 26/67 (38.81%), Postives = 34/67 (50.75%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            C    V+ + +S    C   +E G C   F R+ FD  +  CR+F YGGC  N NNF T  EC  +C
Sbjct:  850 CRSRCVMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 916          

HSP 3 Score: 55.4546 bits (132), Expect = 5.359e-10
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +P + G+C  Y  R+ F+ + G+C  F YG C  N+NNF  R  CE +C
Sbjct: 2177 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2227          

HSP 4 Score: 52.373 bits (124), Expect = 5.061e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = -2
Query:   93 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 254
            +C  P+E G C+ +  R+ F+V  G C  F YGGC  N N+F T+ ECE  C +
Sbjct: 1082 KCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1135          

HSP 5 Score: 50.447 bits (119), Expect = 2.693e-8
Identity = 23/60 (38.33%), Postives = 29/60 (48.33%), Query Frame = -2
Query:   93 TESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 272
            T      C  P ++G C   FVR+ FD +   C  F Y GC  N NNF ++ EC   C K
Sbjct:  730 TTDSVNRCLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 789          

HSP 6 Score: 47.3654 bits (111), Expect = 3.303e-7
Identity = 19/44 (43.18%), Postives = 24/44 (54.55%), Query Frame = -2
Query:   99 GLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 230
            G C   F RY ++    KC  F Y GC  N NN+ +R  CE+RC
Sbjct:  430 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 7 Score: 45.8246 bits (107), Expect = 1.019e-6
Identity = 20/53 (37.74%), Postives = 27/53 (50.94%), Query Frame = -2
Query:   99 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 257
            P C  P+  G C+   +RY +D     CR F Y GC  N NNF +  +C+  C
Sbjct: 2740 PLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2792          
BLAST of SMED30033970 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 61.6178 bits (148), Expect = 3.383e-12
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -2
Query:   99 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 290
            V  LQ + ++A  C+LP E G C+ Y +R+ F+  L +C+ F +GGC  N NNF    +CE  C
Sbjct:  526 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 2 Score: 60.8474 bits (146), Expect = 6.004e-12
Identity = 26/67 (38.81%), Postives = 34/67 (50.75%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            C    V+ + +S    C   +E G C   F R+ FD  +  CR+F YGGC  N NNF T  EC  +C
Sbjct:  841 CRSRCVMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 907          

HSP 3 Score: 55.0694 bits (131), Expect = 5.571e-10
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +P + G+C  Y  R+ F+ + G+C  F YG C  N+NNF  R  CE +C
Sbjct: 2168 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2218          

HSP 4 Score: 52.373 bits (124), Expect = 5.261e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = -2
Query:   93 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 254
            +C  P+E G C+ +  R+ F+V  G C  F YGGC  N N+F T+ ECE  C +
Sbjct: 1073 KCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1126          

HSP 5 Score: 50.0618 bits (118), Expect = 3.820e-8
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C  P ++G C   FVR+ FD +   C  F Y GC  N NNF ++ EC   C K
Sbjct:  728 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 780          

HSP 6 Score: 47.3654 bits (111), Expect = 3.367e-7
Identity = 19/44 (43.18%), Postives = 24/44 (54.55%), Query Frame = -2
Query:   99 GLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 230
            G C   F RY ++    KC  F Y GC  N NN+ +R  CE+RC
Sbjct:  430 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 7 Score: 45.8246 bits (107), Expect = 1.039e-6
Identity = 20/53 (37.74%), Postives = 27/53 (50.94%), Query Frame = -2
Query:   99 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 257
            P C  P+  G C+   +RY +D     CR F Y GC  N NNF +  +C+  C
Sbjct: 2731 PLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2783          
BLAST of SMED30033970 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 61.6178 bits (148), Expect = 3.762e-12
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -2
Query:   99 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 290
            V  LQ + ++A  C+LP E G C+ Y +R+ F+  L +C+ F +GGC  N NNF    +CE  C
Sbjct:  397 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 460          

HSP 2 Score: 60.8474 bits (146), Expect = 6.299e-12
Identity = 26/67 (38.81%), Postives = 34/67 (50.75%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            C    V+ + +S    C   +E G C   F R+ FD  +  CR+F YGGC  N NNF T  EC  +C
Sbjct:  721 CRSRCVMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 787          

HSP 3 Score: 55.0694 bits (131), Expect = 5.788e-10
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +P + G+C  Y  R+ F+ + G+C  F YG C  N+NNF  R  CE +C
Sbjct: 2048 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2098          

HSP 4 Score: 52.373 bits (124), Expect = 5.466e-9
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = -2
Query:   93 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 254
            +C  P+E G C+ +  R+ F+V  G C  F YGGC  N N+F T+ ECE  C +
Sbjct:  953 KCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1006          

HSP 5 Score: 50.447 bits (119), Expect = 2.908e-8
Identity = 23/60 (38.33%), Postives = 29/60 (48.33%), Query Frame = -2
Query:   93 TESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 272
            T      C  P ++G C   FVR+ FD +   C  F Y GC  N NNF ++ EC   C K
Sbjct:  601 TTDSVNRCLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 660          

HSP 6 Score: 47.3654 bits (111), Expect = 3.567e-7
Identity = 19/44 (43.18%), Postives = 24/44 (54.55%), Query Frame = -2
Query:   99 GLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 230
            G C   F RY ++    KC  F Y GC  N NN+ +R  CE+RC
Sbjct:  301 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 344          

HSP 7 Score: 45.8246 bits (107), Expect = 1.111e-6
Identity = 20/53 (37.74%), Postives = 27/53 (50.94%), Query Frame = -2
Query:   99 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 257
            P C  P+  G C+   +RY +D     CR F Y GC  N NNF +  +C+  C
Sbjct: 2611 PLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2663          
BLAST of SMED30033970 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 57.7658 bits (138), Expect = 7.039e-11
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -2
Query:   99 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 290
            V  LQ + ++A  C+LP E G C+ Y +R+ F+  L +C+ F +GGC  N NNF    +CE  C
Sbjct:  526 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 2 Score: 56.6102 bits (135), Expect = 1.973e-10
Identity = 25/62 (40.32%), Postives = 33/62 (53.23%), Query Frame = -2
Query:   99 VLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 284
            V+ + +S    C   +E G C   F R+ FD  +  CR+F YGGC  N NNF T  EC  +C
Sbjct:  855 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 916          

HSP 3 Score: 53.1434 bits (126), Expect = 3.274e-9
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +P + G+C  Y  R+ F+ + G+C  F YG C  N+NNF  R  CE +C
Sbjct: 1223 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1273          

HSP 4 Score: 50.0618 bits (118), Expect = 3.611e-8
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = -2
Query:   93 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 254
            +C  P+E G C+ +  R+ F+V  G C  F YGGC  N N+F T+ ECE  C +
Sbjct: 1082 KCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 1135          

HSP 5 Score: 46.9802 bits (110), Expect = 4.605e-7
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C  P ++G C   FVR+ FD +   C  F Y GC  N NNF ++ EC   C K
Sbjct:  737 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 789          

HSP 6 Score: 45.8246 bits (107), Expect = 1.125e-6
Identity = 19/44 (43.18%), Postives = 24/44 (54.55%), Query Frame = -2
Query:   99 GLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 230
            G C   F RY ++    KC  F Y GC  N NN+ +R  CE+RC
Sbjct:  430 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          
BLAST of SMED30033970 vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 57.7658 bits (138), Expect = 7.124e-11
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -2
Query:   99 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 290
            V  LQ + ++A  C+LP E G C+ Y +R+ F+  L +C+ F +GGC  N NNF    +CE  C
Sbjct:  305 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 368          

HSP 2 Score: 56.6102 bits (135), Expect = 1.939e-10
Identity = 25/62 (40.32%), Postives = 33/62 (53.23%), Query Frame = -2
Query:   99 VLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 284
            V+ + +S    C   +E G C   F R+ FD  +  CR+F YGGC  N NNF T  EC  +C
Sbjct:  634 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 695          

HSP 3 Score: 53.1434 bits (126), Expect = 2.728e-9
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +P + G+C  Y  R+ F+ + G+C  F YG C  N+NNF  R  CE +C
Sbjct: 1430 CAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1480          

HSP 4 Score: 50.0618 bits (118), Expect = 3.550e-8
Identity = 23/54 (42.59%), Postives = 32/54 (59.26%), Query Frame = -2
Query:   93 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 254
            +C  P+E G C+ +  R+ F+V  G C  F YGGC  N N+F T+ ECE  C +
Sbjct:  861 KCLQPVEPGPCKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECEVHCAR 914          

HSP 5 Score: 46.9802 bits (110), Expect = 4.028e-7
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C  P ++G C   FVR+ FD +   C  F Y GC  N NNF ++ EC   C K
Sbjct:  516 CLHPRDSGNCRGQFVRWFFDDEKKNCDVFTYTGCQGNGNNFASKEECMAICHK 568          

HSP 6 Score: 46.2098 bits (108), Expect = 9.287e-7
Identity = 19/44 (43.18%), Postives = 24/44 (54.55%), Query Frame = -2
Query:   99 GLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 230
            G C   F RY ++    KC  F Y GC  N NN+ +R  CE+RC
Sbjct:  209 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 252          
BLAST of SMED30033970 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0300337)

HSP 1 Score: 63.1586 bits (152), Expect = 1.082e-12
Identity = 29/66 (43.94%), Postives = 35/66 (53.03%), Query Frame = -2
Query:   96 FVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 293
            F     + E     C LP ETG C  Y V+Y FD   G C  F YGGC  NDN F + AEC++ C+
Sbjct: 1598 FGGCENVQEPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 2 Score: 50.8322 bits (120), Expect = 2.437e-8
Identity = 22/55 (40.00%), Postives = 29/55 (52.73%), Query Frame = -2
Query:   93 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 257
            P C  P+E+G C   F R+ +D +   CR F YGGC  N NN+ T   C   C +
Sbjct: 1728 PTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          
BLAST of SMED30033970 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301839)

HSP 1 Score: 63.1586 bits (152), Expect = 1.099e-12
Identity = 29/66 (43.94%), Postives = 35/66 (53.03%), Query Frame = -2
Query:   96 FVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 293
            F     + E     C LP ETG C  Y V+Y FD   G C  F YGGC  NDN F + AEC++ C+
Sbjct: 1598 FGGCENVQEPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 2 Score: 53.5286 bits (127), Expect = 2.622e-9
Identity = 20/52 (38.46%), Postives = 32/52 (61.54%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            +C+ P + G C+ + + + ++   G+C++F YGGC  NDN F T  EC  RC
Sbjct: 1943 QCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARC 1994          

HSP 3 Score: 50.8322 bits (120), Expect = 2.524e-8
Identity = 22/55 (40.00%), Postives = 29/55 (52.73%), Query Frame = -2
Query:   93 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 257
            P C  P+E+G C   F R+ +D +   CR F YGGC  N NN+ T   C   C +
Sbjct: 1728 PTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 4 Score: 49.6766 bits (117), Expect = 5.709e-8
Identity = 20/51 (39.22%), Postives = 29/51 (56.86%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+     G C  + +++ FD K+G CR F YG C  N N F T  +C++RC
Sbjct: 1865 CDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRC 1915          

HSP 5 Score: 49.6766 bits (117), Expect = 6.867e-8
Identity = 21/53 (39.62%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C +P E G C  Y   + +D +   CR F YGGC  N+N F T   C  RC++
Sbjct: 1792 CEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDR 1844          

HSP 6 Score: 43.5134 bits (101), Expect = 9.267e-6
Identity = 22/67 (32.84%), Postives = 31/67 (46.27%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            CI   V++ +      C  P E G C+     + +D +   C  F Y GC  N N F TR +CE +C
Sbjct: 2121 CIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQC 2187          
BLAST of SMED30033970 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301838)

HSP 1 Score: 63.1586 bits (152), Expect = 1.131e-12
Identity = 29/66 (43.94%), Postives = 35/66 (53.03%), Query Frame = -2
Query:   96 FVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 293
            F     + E     C LP ETG C  Y V+Y FD   G C  F YGGC  NDN F + AEC++ C+
Sbjct: 1598 FGGCENVQEPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 2 Score: 53.5286 bits (127), Expect = 2.496e-9
Identity = 20/52 (38.46%), Postives = 32/52 (61.54%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            +C+ P + G C+ + + + ++   G+C++F YGGC  NDN F T  EC  RC
Sbjct: 2000 QCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARC 2051          

HSP 3 Score: 50.8322 bits (120), Expect = 2.547e-8
Identity = 22/55 (40.00%), Postives = 29/55 (52.73%), Query Frame = -2
Query:   93 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 257
            P C  P+E+G C   F R+ +D +   CR F YGGC  N NN+ T   C   C +
Sbjct: 1728 PTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 4 Score: 49.6766 bits (117), Expect = 5.651e-8
Identity = 20/51 (39.22%), Postives = 29/51 (56.86%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+     G C  + +++ FD K+G CR F YG C  N N F T  +C++RC
Sbjct: 1922 CDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRC 1972          

HSP 5 Score: 49.6766 bits (117), Expect = 6.602e-8
Identity = 21/53 (39.62%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C +P E G C  Y   + +D +   CR F YGGC  N+N F T   C  RC++
Sbjct: 1849 CEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDR 1901          

HSP 6 Score: 44.2838 bits (103), Expect = 4.976e-6
Identity = 20/53 (37.74%), Postives = 26/53 (49.06%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C LP +TG C     ++ F     +C  F Y GC  N NNF T   CE+ C +
Sbjct: 1790 CALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPR 1842          

HSP 7 Score: 43.5134 bits (101), Expect = 9.537e-6
Identity = 22/67 (32.84%), Postives = 31/67 (46.27%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            CI   V++ +      C  P E G C+     + +D +   C  F Y GC  N N F TR +CE +C
Sbjct: 2178 CIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQC 2244          
BLAST of SMED30033970 vs. Ensembl Fly
Match: Ppn (gene:FBgn0003137 transcript:FBtr0301837)

HSP 1 Score: 63.1586 bits (152), Expect = 1.165e-12
Identity = 29/66 (43.94%), Postives = 35/66 (53.03%), Query Frame = -2
Query:   96 FVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 293
            F     + E     C LP ETG C  Y V+Y FD   G C  F YGGC  NDN F + AEC++ C+
Sbjct: 1598 FGGCENVQEPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDNRFESEAECKDTCQ 1663          

HSP 2 Score: 53.5286 bits (127), Expect = 2.648e-9
Identity = 20/52 (38.46%), Postives = 32/52 (61.54%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            +C+ P + G C+ + + + ++   G+C++F YGGC  NDN F T  EC  RC
Sbjct: 2000 QCSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARC 2051          

HSP 3 Score: 50.8322 bits (120), Expect = 2.549e-8
Identity = 22/55 (40.00%), Postives = 29/55 (52.73%), Query Frame = -2
Query:   93 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 257
            P C  P+E+G C   F R+ +D +   CR F YGGC  N NN+ T   C   C +
Sbjct: 1728 PTCEQPVESGPCAGNFERWYYDNETDICRPFTYGGCKGNKNNYPTEHACNYNCRQ 1782          

HSP 4 Score: 49.6766 bits (117), Expect = 5.823e-8
Identity = 20/51 (39.22%), Postives = 29/51 (56.86%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+     G C  + +++ FD K+G CR F YG C  N N F T  +C++RC
Sbjct: 1922 CDEEPAPGECSTWVLKWHFDRKIGACRQFYYGNCGGNGNRFETENDCQQRC 1972          

HSP 5 Score: 49.6766 bits (117), Expect = 7.004e-8
Identity = 21/53 (39.62%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C +P E G C  Y   + +D +   CR F YGGC  N+N F T   C  RC++
Sbjct: 1849 CEIPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCDR 1901          

HSP 6 Score: 44.2838 bits (103), Expect = 5.029e-6
Identity = 20/53 (37.74%), Postives = 26/53 (49.06%), Query Frame = -2
Query:   93 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 251
            C LP +TG C     ++ F     +C  F Y GC  N NNF T   CE+ C +
Sbjct: 1790 CALPKQTGDCSEKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPR 1842          

HSP 7 Score: 43.5134 bits (101), Expect = 9.452e-6
Identity = 22/67 (32.84%), Postives = 31/67 (46.27%), Query Frame = -2
Query:   99 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 299
            CI   V++ +      C  P E G C+     + +D +   C  F Y GC  N N F TR +CE +C
Sbjct: 2178 CIGEPVVEPSAPTYSVCAEPPEAGECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQC 2244          
BLAST of SMED30033970 vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0077545)

HSP 1 Score: 60.077 bits (144), Expect = 1.229e-12
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            +C+ P ETG C A F RY ++V    C  FVYGGC  N NNF ++ +CE+ C
Sbjct:   54 DCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105          
BLAST of SMED30033970 vs. Ensembl Zebrafish
Match: wfikkn2b (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-110414-1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.655e-12
Identity = 27/68 (39.71%), Postives = 42/68 (61.76%), Query Frame = -2
Query:   99 SCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 302
            SC+   +L ++ S    C LP+  G C+AY +R+ +   L +CR F+YGGC  N+NNF ++  CE+ C
Sbjct:  362 SCMSSCLLNISAS----CMLPIHKGPCKAYELRWAYSSTLHQCRLFIYGGCKANENNFKSKRSCEDAC 425          
BLAST of SMED30033970 vs. Ensembl Zebrafish
Match: wfikkn2a (info WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-120914-1])

HSP 1 Score: 59.6918 bits (143), Expect = 2.369e-11
Identity = 26/54 (48.15%), Postives = 35/54 (64.81%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C+LP   G C+AY  R+ +   L KC++FVYGGC  N+NNF ++  CEE C
Sbjct:  380 AAPCSLPSVQGPCKAYKPRWAYSHALKKCQSFVYGGCGGNENNFESKEACEEMC 433          
BLAST of SMED30033970 vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 57.3806 bits (137), Expect = 1.452e-10
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   99 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 257
            P C L    G C  Y +R+ ++ +   C  F YGGC  NDN FHT  EC+  C
Sbjct: 1134 PRCQLSFVQGSCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTC 1186          
BLAST of SMED30033970 vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 57.3806 bits (137), Expect = 1.453e-10
Identity = 22/53 (41.51%), Postives = 28/53 (52.83%), Query Frame = -2
Query:   99 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 257
            P C L    G C  Y +R+ ++ +   C  F YGGC  NDN FHT  EC+  C
Sbjct: 1150 PRCQLSFVQGSCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTC 1202          
BLAST of SMED30033970 vs. Ensembl Zebrafish
Match: ambp (alpha-1-microglobulin/bikunin precursor [Source:ZFIN;Acc:ZDB-GENE-040426-1608])

HSP 1 Score: 57.3806 bits (137), Expect = 1.576e-10
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C LP++ G C+A+   + FD   GKC +  YGGC  N N F+++ EC+E C
Sbjct:  281 CRLPMDAGPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYC 331          
BLAST of SMED30033970 vs. Ensembl Xenopus
Match: WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:NCBI gene;Acc:100486381])

HSP 1 Score: 63.1586 bits (152), Expect = 2.089e-12
Identity = 24/51 (47.06%), Postives = 36/51 (70.59%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            CN P   G+C+AY  R+ ++ +L +C++F+YGGC  NDNNF T+  CE+ C
Sbjct:  370 CNFPALQGMCKAYKPRWAYNKQLKQCQSFIYGGCGGNDNNFETKETCEDMC 420          
BLAST of SMED30033970 vs. Ensembl Xenopus
Match: cmtr2 (cap methyltransferase 2 [Source:Xenbase;Acc:XB-GENE-6035233])

HSP 1 Score: 56.9954 bits (136), Expect = 6.713e-12
Identity = 24/49 (48.98%), Postives = 29/49 (59.18%), Query Frame = -2
Query:  105 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEE 251
            C LP+  G C+A    + FD   GKC TF YGGC  N N F+T  EC+E
Sbjct:    6 CRLPITPGPCKAAKTHWAFDAAQGKCVTFAYGGCQGNGNQFYTEKECKE 54          
BLAST of SMED30033970 vs. Ensembl Xenopus
Match: cmtr2 (cap methyltransferase 2 [Source:Xenbase;Acc:XB-GENE-6035233])

HSP 1 Score: 56.6102 bits (135), Expect = 1.155e-11
Identity = 24/49 (48.98%), Postives = 29/49 (59.18%), Query Frame = -2
Query:  105 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEE 251
            C LP+  G C+A    + FD   GKC TF YGGC  N N F+T  EC+E
Sbjct:    6 CRLPITPGPCKAAKTHWAFDAAQGKCVTFAYGGCQGNGNQFYTEKECKE 54          
BLAST of SMED30033970 vs. Ensembl Xenopus
Match: rlbp1 (retinaldehyde binding protein 1 [Source:Xenbase;Acc:XB-GENE-976303])

HSP 1 Score: 56.9954 bits (136), Expect = 2.959e-10
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = -2
Query:   96 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 290
            +   ++  SKA   +LP +TG C A F R+ +D  + KC  F YGGC  NDNNFH  ++C   CE
Sbjct:  363 LQTFEIPNSKARCVDLP-DTGPCRASFSRFYYDPNIRKCLRFTYGGCAGNDNNFHRESDCMRYCE 426          
BLAST of SMED30033970 vs. Ensembl Xenopus
Match: rlbp1 (retinaldehyde binding protein 1 [Source:Xenbase;Acc:XB-GENE-976303])

HSP 1 Score: 56.9954 bits (136), Expect = 3.213e-10
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = -2
Query:   96 VAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 290
            +   ++  SKA   +LP +TG C A F R+ +D  + KC  F YGGC  NDNNFH  ++C   CE
Sbjct:  363 LQTFEIPNSKARCVDLP-DTGPCRASFSRFYYDPNIRKCLRFTYGGCAGNDNNFHRESDCMRYCE 426          
BLAST of SMED30033970 vs. Ensembl Mouse
Match: Spint3 (serine peptidase inhibitor, Kunitz type, 3 [Source:MGI Symbol;Acc:MGI:3651470])

HSP 1 Score: 61.6178 bits (148), Expect = 1.870e-13
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = -2
Query:   99 ESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 269
            +S  P C LP + G C A FVR+ ++ K GKC  F YGGC  N+NNF +R++C+  C
Sbjct:   29 KSLPPMCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85          
BLAST of SMED30033970 vs. Ensembl Mouse
Match: Eppin (epididymal peptidase inhibitor [Source:MGI Symbol;Acc:MGI:1922776])

HSP 1 Score: 61.2326 bits (147), Expect = 7.631e-13
Identity = 26/69 (37.68%), Postives = 42/69 (60.87%), Query Frame = -2
Query:   93 CIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 299
            C+F    +    +   C+LP ++G C AYF R+ F+ +   C+ F+YGGC  N+NNF +++ C+  CEK
Sbjct:   61 CVFNCGKKCLNPQQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACEK 129          
BLAST of SMED30033970 vs. Ensembl Mouse
Match: Wfikkn2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:MGI Symbol;Acc:MGI:2669209])

HSP 1 Score: 60.8474 bits (146), Expect = 1.035e-11
Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LP   G C+AY  R+ ++ + G C++FVYGGC  N NNF +R  CEE C
Sbjct:  381 CSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFESREACEESC 431          
BLAST of SMED30033970 vs. Ensembl Mouse
Match: Ambp (alpha 1 microglobulin/bikunin precursor [Source:MGI Symbol;Acc:MGI:88002])

HSP 1 Score: 57.3806 bits (137), Expect = 1.350e-10
Identity = 24/51 (47.06%), Postives = 30/51 (58.82%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            CNLP+  G C A+   + FD   GKC  F YGGC  N N F++  EC+E C
Sbjct:  286 CNLPIVQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKEYC 336          
BLAST of SMED30033970 vs. Ensembl Mouse
Match: Col7a1 (collagen, type VII, alpha 1 [Source:MGI Symbol;Acc:MGI:88462])

HSP 1 Score: 55.4546 bits (132), Expect = 7.634e-10
Identity = 26/53 (49.06%), Postives = 30/53 (56.60%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLG--KCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LPL+ G C AY +R+      G   C  FVYGGC  N N F TR  CE RC
Sbjct: 2879 CSLPLDEGSCTAYTLRWYHRAVPGGTACHPFVYGGCGGNANRFGTREACERRC 2931          
BLAST of SMED30033970 vs. UniProt/SwissProt
Match: sp|P0DJ50|VKT31_MESMA (Kunitz-type serine protease inhibitor BmKTT-2 OS=Mesobuthus martensii OX=34649 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 3.956e-18
Identity = 31/76 (40.79%), Postives = 51/76 (67.11%), Query Frame = -2
Query:   96 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 323
            MN + +   I   V  +++++  +C LP +TG C+AYF+RY ++ K G+C+ FVYGGC  N NNF T+++C ++C 
Sbjct:    2 MNVITVVGIILSVVCTISDAEGVDCTLPSDTGRCKAYFIRYFYNQKAGECQKFVYGGCEGNSNNFLTKSDCCKQCS 77          
BLAST of SMED30033970 vs. UniProt/SwissProt
Match: sp|D8KY58|VKT_BOMTE (Kunitz-type serine protease inhibitor Bt-KTI OS=Bombus terrestris OX=30195 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.555e-15
Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = -2
Query:   99 AVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 287
            +V Q++      C LPL TG C  YF R+G++V++GKC  F+YGGC  N NNF    EC++ C
Sbjct:   18 SVHQVSAEIPSHCTLPLATGTCRGYFPRFGYNVEMGKCVEFIYGGCDGNANNFRNLEECQQSC 80          
BLAST of SMED30033970 vs. UniProt/SwissProt
Match: sp|Q589G4|VKT19_ANOSM (Kunitz-type serine protease inhibitor As-fr-19 OS=Anoplius samariensis OX=200614 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.812e-14
Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = -2
Query:   93 AVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 287
            A+LQ++ S +  C LP+  G C  Y +RY F   +  CR F +GGC  NDNNF TR +CE  CE+
Sbjct:   10 AILQVSHSVS-FCLLPIVPGPCTQYVIRYAFQPSISACRRFTFGGCEGNDNNFMTRRDCEHYCEE 73          
BLAST of SMED30033970 vs. UniProt/SwissProt
Match: sp|P81906|ISPI2_GALME (Inducible serine protease inhibitor 2 (Fragment) OS=Galleria mellonella OX=7137 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.463e-14
Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = -2
Query:  129 PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNF 257
            P+C LPLETG+C A   R+G+D KL +C  FVYGGCH N+NNF
Sbjct:    3 PKCTLPLETGICRAELHRFGYDTKLKECTQFVYGGCHHNENNF 45          
BLAST of SMED30033970 vs. UniProt/SwissProt
Match: sp|P0C8W3|VKT11_HOFGE (Kunitz-type serine protease inhibitor Hg1 OS=Hoffmannihadrurus gertschi OX=380989 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.960e-14
Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = -2
Query:   96 LVIFSCIFVAVLQLTESKAPE--------CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 314
            ++IF  +F ++L LT     E        C LP +TG C+  F RY FD++ G C+ F+YGGC  N NNF  +  CE+RC 
Sbjct:    1 MIIFYGLF-SILVLTSINIAEAGHHNRVNCLLPPKTGPCKGSFARYYFDIETGSCKAFIYGGCEGNSNNFSEKHHCEKRCR 80          
BLAST of SMED30033970 vs. TrEMBL
Match: A0A3S2LXI9 (BPTI/Kunitz inhibitor domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_008805 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.886e-15
Identity = 37/77 (48.05%), Postives = 48/77 (62.34%), Query Frame = -2
Query:   93 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 323
            MN  +IF   FVAV    E +   C  P+E GLC AYF R+G++ ++ KC  FVYGGC  NDN F T  ECE+ C++
Sbjct:    1 MNKFLIFLLAFVAVASALEKR---CEEPIERGLCYAYFPRFGYNKEINKCEFFVYGGCQGNDNRFITAEECEKVCQR 74          
BLAST of SMED30033970 vs. TrEMBL
Match: A0A0R3WBP8 (BPTI/Kunitz inhibitor domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8078 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.189e-15
Identity = 32/69 (46.38%), Postives = 47/69 (68.12%), Query Frame = -2
Query:   93 IFVAV-LQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 296
            +FV V + LTE++   C LP+E GLC AY  R+G+D + G+C  F+YGGC  N N+FH++ +CE  C +
Sbjct:   27 LFVLVAISLTEARIDPCKLPIEPGLCRAYMPRWGYDQESGECVRFIYGGCGGNKNHFHSKEQCENMCGR 95          
BLAST of SMED30033970 vs. TrEMBL
Match: T1GSQ8 (BPTI/Kunitz inhibitor domain-containing protein OS=Megaselia scalaris OX=36166 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 9.096e-15
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = -2
Query:   96 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 323
            MN+L + + IF   + L  S+  +CNLPL  G C+AYF RYGF+  L KC  F+YGGC  N NNF     C+  CE
Sbjct:    1 MNTLCLSAIIFFGSVFLVYSQNSDCNLPLYQGPCKAYFKRYGFNSTLQKCVLFIYGGCGANGNNFEDLESCQAACE 76          
BLAST of SMED30033970 vs. TrEMBL
Match: A0A5J4N8H1 (BPTI/Kunitz inhibitor domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003862 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.588e-15
Identity = 30/82 (36.59%), Postives = 50/82 (60.98%), Query Frame = -2
Query:   81 KMNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK*FYN 326
            +  ++VI + +   ++Q + +    C LP E+G C  YF+RY +D + G+C  FVYGGC  N N F ++ ECE++C +  Y+
Sbjct:    5 RPTAMVIAALVCTLIVQESSALQQRCLLPPESGPCMGYFMRYAYDARSGQCVKFVYGGCQGNGNRFDSKEECEDQCARTLYD 86          
BLAST of SMED30033970 vs. TrEMBL
Match: A0A068Y467 (Trypsin inhibitor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000419200 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.088e-14
Identity = 35/78 (44.87%), Postives = 46/78 (58.97%), Query Frame = -2
Query:   99 SLVIFSCIFVAVLQL-----TESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 317
            S++ F+    ++L L       S    CNLP+ +G C  YF+RYG+D K  +CR FVYGGC  N NNF T  EC +RC
Sbjct:   10 SIIFFAFFVASMLNLGCCRGKMSYINRCNLPISSGRCRGYFLRYGYDSKTDECRRFVYGGCRGNRNNFFTYKECMKRC 87          
BLAST of SMED30033970 vs. Ensembl Cavefish
Match: wfikkn2b (WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 [Source:NCBI gene;Acc:103024700])

HSP 1 Score: 63.5438 bits (153), Expect = 7.719e-13
Identity = 26/54 (48.15%), Postives = 36/54 (66.67%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C+LP   G C+AY  R+ + + LG+C+ F+YGGC  N+NNF TR  CE+ C
Sbjct:  371 AVPCSLPSLQGPCKAYEPRWAYSITLGQCQPFIYGGCEGNENNFETRETCEDSC 424          
BLAST of SMED30033970 vs. Ensembl Cavefish
Match: col28a2a (collagen alpha-1(XXVIII) chain-like [Source:NCBI gene;Acc:103029985])

HSP 1 Score: 60.4622 bits (145), Expect = 1.268e-11
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = -2
Query:   99 LTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 275
            +T    P C+L L  G C  Y +R+ +D     C  F YGGC  N+N F T AEC++ C
Sbjct: 1186 ITTPLDPRCSLSLNQGPCREYLIRWYYDKAANSCAQFWYGGCEGNENRFETEAECKKTC 1244          
BLAST of SMED30033970 vs. Ensembl Cavefish
Match: ENSAMXT00000002208.2 (pep primary_assembly:Astyanax_mexicanus-2.0:13:36140062:36218718:1 gene:ENSAMXG00000002013.2 transcript:ENSAMXT00000002208.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 3.958e-11
Identity = 27/64 (42.19%), Postives = 37/64 (57.81%), Query Frame = -2
Query:   99 AVLQLTESKAPE-CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 287
            AV Q  E K  + C LPL+ G C  Y + + F+ ++G CR FVY GC  N N +  + ECE+ C
Sbjct: 2215 AVKQKREVKGEDPCALPLDEGDCSRYTLHWYFNSQVGACRPFVYSGCGGNANRYTQKEECEKHC 2278          
BLAST of SMED30033970 vs. Ensembl Cavefish
Match: ambp (alpha-1-microglobulin/bikunin precursor [Source:NCBI gene;Acc:103022541])

HSP 1 Score: 57.7658 bits (138), Expect = 7.894e-11
Identity = 27/61 (44.26%), Postives = 36/61 (59.02%), Query Frame = -2
Query:   99 LQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 281
            LQ   ++A  C LP++ G C      + FD  +GKC +F YGGC  N N F+T+ ECEE C
Sbjct:  273 LQTCRTEAA-CRLPMDAGPCNTPQELWAFDSSIGKCVSFKYGGCKGNGNKFYTQKECEEYC 332          

HSP 2 Score: 46.595 bits (109), Expect = 7.775e-7
Identity = 21/54 (38.89%), Postives = 28/54 (51.85%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C    ++G C     RY ++  L  C+ FV+GGC  N NNF T  EC + C
Sbjct:  223 AESCTAEPDSGPCFGMIQRYYYNSSLMACQQFVFGGCMGNQNNFVTEKECLQTC 276          
BLAST of SMED30033970 vs. Ensembl Cavefish
Match: ambp (alpha-1-microglobulin/bikunin precursor [Source:NCBI gene;Acc:103022541])

HSP 1 Score: 57.7658 bits (138), Expect = 7.948e-11
Identity = 27/61 (44.26%), Postives = 36/61 (59.02%), Query Frame = -2
Query:   99 LQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 281
            LQ   ++A  C LP++ G C      + FD  +GKC +F YGGC  N N F+T+ ECEE C
Sbjct:  273 LQTCRTEAA-CRLPMDAGPCNTPQELWAFDSSIGKCVSFKYGGCKGNGNKFYTQKECEEYC 332          

HSP 2 Score: 46.595 bits (109), Expect = 7.842e-7
Identity = 21/54 (38.89%), Postives = 28/54 (51.85%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C    ++G C     RY ++  L  C+ FV+GGC  N NNF T  EC + C
Sbjct:  223 AESCTAEPDSGPCFGMIQRYYYNSSLMACQQFVFGGCMGNQNNFVTEKECLQTC 276          
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 58.5362 bits (140), Expect = 6.192e-12
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = -2
Query:   96 ESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 269
            E +   C LP + G C A F RY F+    +C +F+YGGCH N+NNF T  EC   C 
Sbjct:   21 EDQRVTCTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAACS 78          

HSP 2 Score: 46.595 bits (109), Expect = 1.153e-7
Identity = 23/52 (44.23%), Postives = 29/52 (55.77%), Query Frame = -2
Query:  111 KAPE-CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAEC 263
            K P+ C    ETG C A+  RY +++ LG C  FVYGGC  N+N F     C
Sbjct:   82 KIPKLCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESC 133          
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 56.9954 bits (136), Expect = 3.288e-11
Identity = 19/51 (37.25%), Postives = 37/51 (72.55%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LP++ G C+ + +R+ ++  + +C++F+YGGC  N+NNF ++  CE+ C
Sbjct:  374 CSLPVQQGPCKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDNC 424          
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008261.1 (pep scaffold:Pmarinus_7.0:GL478901:735:1448:1 gene:ENSPMAG00000007479.1 transcript:ENSPMAT00000008261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.556e-9
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LP   G C+A+  R+ ++    +C TF+YGGC  N N+F +R+ CE  C
Sbjct:   21 CSLPPVQGPCKAWETRWSYNPLGKRCATFLYGGCEGNGNSFASRSACERAC 71          
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 6.477e-9
Identity = 28/65 (43.08%), Postives = 35/65 (53.85%), Query Frame = -2
Query:   99 LQLTESK---APE-CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 281
            LQL   +   AP+ C L +E G+C A   RY F++  G C  F YGGC  N NNF   A C + C
Sbjct:   61 LQLRRKQTDIAPKACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 125          

HSP 2 Score: 45.4394 bits (106), Expect = 2.881e-7
Identity = 21/52 (40.38%), Postives = 28/52 (53.85%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
             C + L+ G C AY  R  ++    +C  F YGGC  N NNF + AEC  +C
Sbjct:    2 SCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 3 Score: 42.743 bits (99), Expect = 2.792e-6
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +  + G C A   R+ ++ K   C +F YGGC  NDNNF +   C   C
Sbjct:  167 CLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 217          
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 9.726e-9
Identity = 25/55 (45.45%), Postives = 31/55 (56.36%), Query Frame = -2
Query:   99 APE-CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            AP+ C L +E G+C A   RY F++  G C  F YGGC  N NNF   A C + C
Sbjct:   70 APKACRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 124          

HSP 2 Score: 45.8246 bits (107), Expect = 2.281e-7
Identity = 21/52 (40.38%), Postives = 28/52 (53.85%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
             C + L+ G C AY  R  ++    +C  F YGGC  N NNF + AEC  +C
Sbjct:    2 SCMMDLDPGPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          

HSP 3 Score: 43.1282 bits (100), Expect = 2.399e-6
Identity = 19/51 (37.25%), Postives = 26/51 (50.98%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C +  + G C A   R+ ++ K   C +F YGGC  NDNNF +   C   C
Sbjct:  166 CLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 216          
BLAST of SMED30033970 vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 60.8474 bits (146), Expect = 5.052e-14
Identity = 27/52 (51.92%), Postives = 35/52 (67.31%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            EC  P  TG C AYF R+ ++    KC+ FVYGGC  N NNF ++AECE++C
Sbjct:    1 ECLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of SMED30033970 vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 60.8474 bits (146), Expect = 5.052e-14
Identity = 27/52 (51.92%), Postives = 35/52 (67.31%), Query Frame = -2
Query:   99 ECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 254
            EC  P  TG C AYF R+ ++    KC+ FVYGGC  N NNF ++AECE++C
Sbjct:    1 ECLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of SMED30033970 vs. Ensembl Nematostella
Match: EDO38466 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV3])

HSP 1 Score: 58.9214 bits (141), Expect = 3.400e-13
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = -2
Query:   96 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 251
            C+LP  TG C A F+R+ +D++  +C+ F YGGC  N NNF ++A C ++C 
Sbjct:   15 CSLPKLTGPCMARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKCS 66          
BLAST of SMED30033970 vs. Ensembl Nematostella
Match: EDO26072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY8])

HSP 1 Score: 58.9214 bits (141), Expect = 3.590e-13
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = -2
Query:   96 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 251
            C+LP  TG C A F+R+ +D++  +C+ F YGGC  N NNF ++A C ++C 
Sbjct:   15 CSLPKLTGPCMARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKCS 66          
BLAST of SMED30033970 vs. Ensembl Nematostella
Match: EDO38284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDB9])

HSP 1 Score: 58.5362 bits (140), Expect = 4.600e-13
Identity = 26/59 (44.07%), Postives = 36/59 (61.02%), Query Frame = -2
Query:   99 LTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 275
            ++E     C LP   G C A   R+ ++ K+GKC++FV+GGC  N NNF TR  CE +C
Sbjct:    5 ISERIKSVCKLPKFAGPCMASIERFYYNAKIGKCQSFVFGGCLPNGNNFKTRKACEAKC 63          
BLAST of SMED30033970 vs. Ensembl Medaka
Match: paplna (papilin, proteoglycan like sulfated glycoprotein [Source:NCBI gene;Acc:101162499])

HSP 1 Score: 62.7734 bits (151), Expect = 1.834e-12
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = -2
Query:   99 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 251
            C+LP   G C ++  RY FD+   KC  F +GGCH N NNF TRAEC+  C
Sbjct:  699 CSLPRAAGSCSSWVSRYHFDILTSKCTHFWFGGCHGNGNNFLTRAECQRMC 749          
BLAST of SMED30033970 vs. Ensembl Medaka
Match: paplnb (papilin [Source:NCBI gene;Acc:101161692])

HSP 1 Score: 62.3882 bits (150), Expect = 2.270e-12
Identity = 24/54 (44.44%), Postives = 36/54 (66.67%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C+LP + G CE +  R+ +D  +GKC+ F YGGCH N NNF +  +C+++C
Sbjct:  749 ASACSLPRDEGPCEKWVARFAYDAAVGKCKEFWYGGCHGNANNFASEHDCQKQC 802          
BLAST of SMED30033970 vs. Ensembl Medaka
Match: paplna (papilin, proteoglycan like sulfated glycoprotein [Source:NCBI gene;Acc:101162499])

HSP 1 Score: 61.6178 bits (148), Expect = 4.591e-12
Identity = 29/59 (49.15%), Postives = 36/59 (61.02%), Query Frame = -2
Query:   99 ESKAPE--CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 269
            E+ AP   C+LP   G C ++  RY FD+   KC  F +GGCH N NNF TRAEC+  C
Sbjct:  424 ETAAPRSVCSLPRAAGSCSSWVSRYHFDILTSKCTHFWFGGCHGNGNNFLTRAECQRMC 482          
BLAST of SMED30033970 vs. Ensembl Medaka
Match: ENSORLT00000042019.1 (pep primary_assembly:ASM223467v1:12:15740119:15780496:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000042019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 2.066e-11
Identity = 25/55 (45.45%), Postives = 37/55 (67.27%), Query Frame = -2
Query:  102 SKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEER 266
            +K P+ ++P ++GLC  YF RY ++ + G+C  F+YGGC  N NNF T  EC +R
Sbjct:   76 TKLPQPHIPPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQR 130          

HSP 2 Score: 50.0618 bits (118), Expect = 3.649e-8
Identity = 22/47 (46.81%), Postives = 29/47 (61.70%), Query Frame = -2
Query:  111 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAEC 251
            C    ++GLC  YF RY ++ + G+C  F+YGGC  N NNF T  EC
Sbjct:   25 CAQAPDSGLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC 71          

HSP 3 Score: 49.6766 bits (117), Expect = 5.174e-8
Identity = 24/56 (42.86%), Postives = 31/56 (55.36%), Query Frame = -2
Query:   84 CNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK*FY 251
            C L  + G CE Y  RY ++ K  +C  F+YG C+ N NNF T  EC  RC   +Y
Sbjct:  133 CTLDPDPGPCECYSERYFYNFKKRRCEIFIYGCCNGNQNNFETEQECLRRCRFHYY 188          
BLAST of SMED30033970 vs. Ensembl Medaka
Match: wfikkn2a (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:NCBI gene;Acc:101168544])

HSP 1 Score: 59.3066 bits (142), Expect = 3.155e-11
Identity = 25/54 (46.30%), Postives = 35/54 (64.81%), Query Frame = -2
Query:   99 APECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 260
            A  C+LP   G C+AY  R+ +   L KC++FVYGGC  N+NNF ++  CE+ C
Sbjct:  385 AAPCSLPSLQGPCKAYEPRWAYSSTLKKCQSFVYGGCGGNENNFESKEACEQMC 438          
BLAST of SMED30033970 vs. Planmine SMEST
Match: SMESG000038052.1 (SMESG000038052.1)

HSP 1 Score: 159.844 bits (403), Expect = 1.138e-52
Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = -2
Query:   93 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 323
            MNSLVIFSCIFVAVLQLTESK+PECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK
Sbjct:    1 MNSLVIFSCIFVAVLQLTESKSPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 77          
BLAST of SMED30033970 vs. Planmine SMEST
Match: SMESG000038055.1 (SMESG000038055.1)

HSP 1 Score: 142.51 bits (358), Expect = 8.288e-46
Identity = 67/77 (87.01%), Postives = 69/77 (89.61%), Query Frame = -2
Query:   93 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK 323
            MNSL+I SC+FV  LQL E KAPECNL LETGLC AYFVRYGFDVKLGKCRTFVYGGC VNDNNFHTRAECEERCEK
Sbjct:    1 MNSLIIISCLFVTALQLIEGKAPECNLSLETGLCRAYFVRYGFDVKLGKCRTFVYGGCPVNDNNFHTRAECEERCEK 77          
BLAST of SMED30033970 vs. Planmine SMEST
Match: SMESG000037994.1 (SMESG000037994.1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.695e-28
Identity = 42/75 (56.00%), Postives = 55/75 (73.33%), Query Frame = -2
Query:   99 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERC 323
            MNS+VIF+ IF  +  L ES+APECN P +TG+C AYF R+ F+++ G C +F+YGGC  N NNF+T  ECE RC
Sbjct:    1 MNSIVIFTLIFCVIFSLGESRAPECNEPKKTGMCAAYFPRFYFNIQSGNCESFIYGGCQANGNNFNTIEECEARC 75          
BLAST of SMED30033970 vs. Planmine SMEST
Match: SMESG000037991.1 (SMESG000037991.1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.766e-25
Identity = 39/63 (61.90%), Postives = 48/63 (76.19%), Query Frame = -2
Query:   96 VLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCE 284
                +ES+APECN  +ETGLC+AYF+RYGFD KLG+C  F+YGGC VN NNF T+ ECE  C+
Sbjct:   14 TFNFSESRAPECNDTIETGLCDAYFIRYGFDTKLGECIQFIYGGCPVNKNNFKTKEECENLCK 76          
BLAST of SMED30033970 vs. Planmine SMEST
Match: SMESG000038005.1 (SMESG000038005.1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.287e-24
Identity = 46/87 (52.87%), Postives = 55/87 (63.22%), Query Frame = -2
Query:   66 MNSLVIFSCIFVAVLQLTESKAPECNLPLETGLCEAYFVRYGFDVKLGKCRTFVYGGCHVNDNNFHTRAECEERCEK*FYN-IFYNI 323
            M S++    +FV +L   E K PECN PLE GLC  Y VRYG+ V+ G+C TF YGGC  NDNNF TRAECE   +  F   +FY I
Sbjct:    1 MKSIIFL--LFVTILSCIECKEPECNQPLEIGLCRQYRVRYGYSVERGRCVTFTYGGCPYNDNNFFTRAECEHDVKTNFKKALFYEI 85          
The following BLAST results are available for this feature:
BLAST of SMED30033970 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPPIN4.876e-1341.18epididymal peptidase inhibitor [Source:HGNC Symbol... [more]
EPPIN7.397e-1341.18epididymal peptidase inhibitor [Source:HGNC Symbol... [more]
EPPIN-WFDC62.289e-1241.18EPPIN-WFDC6 readthrough [Source:HGNC Symbol;Acc:HG... [more]
EPPIN-WFDC63.255e-1241.18EPPIN-WFDC6 readthrough [Source:HGNC Symbol;Acc:HG... [more]
WFIKKN23.440e-1249.02WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlt-113.254e-1240.63pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.383e-1240.63pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.762e-1240.63pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-117.039e-1140.63pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-117.124e-1140.63pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppn1.082e-1243.94gene:FBgn0003137 transcript:FBtr0300337[more]
Ppn1.099e-1243.94gene:FBgn0003137 transcript:FBtr0301839[more]
Ppn1.131e-1243.94gene:FBgn0003137 transcript:FBtr0301838[more]
Ppn1.165e-1243.94gene:FBgn0003137 transcript:FBtr0301837[more]
CG36041.229e-1248.08gene:FBgn0031562 transcript:FBtr0077545[more]
back to top
BLAST of SMED30033970 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wfikkn2b2.655e-1239.71WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
wfikkn2a2.369e-1148.15info WAP, follistatin/kazal, immunoglobulin, kunit... [more]
col28a2a1.452e-1041.51collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
col28a2a1.453e-1041.51collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
ambp1.576e-1043.14alpha-1-microglobulin/bikunin precursor [Source:ZF... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WFIKKN22.089e-1247.06WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
cmtr26.713e-1248.98cap methyltransferase 2 [Source:Xenbase;Acc:XB-GEN... [more]
cmtr21.155e-1148.98cap methyltransferase 2 [Source:Xenbase;Acc:XB-GEN... [more]
rlbp12.959e-1043.08retinaldehyde binding protein 1 [Source:Xenbase;Ac... [more]
rlbp13.213e-1043.08retinaldehyde binding protein 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spint31.870e-1347.37serine peptidase inhibitor, Kunitz type, 3 [Source... [more]
Eppin7.631e-1337.68epididymal peptidase inhibitor [Source:MGI Symbol;... [more]
Wfikkn21.035e-1149.02WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
Ambp1.350e-1047.06alpha 1 microglobulin/bikunin precursor [Source:MG... [more]
Col7a17.634e-1049.06collagen, type VII, alpha 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30033970 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DJ50|VKT31_MESMA3.956e-1840.79Kunitz-type serine protease inhibitor BmKTT-2 OS=M... [more]
sp|D8KY58|VKT_BOMTE1.555e-1546.03Kunitz-type serine protease inhibitor Bt-KTI OS=Bo... [more]
sp|Q589G4|VKT19_ANOSM1.812e-1446.15Kunitz-type serine protease inhibitor As-fr-19 OS=... [more]
sp|P81906|ISPI2_GALME3.463e-1462.79Inducible serine protease inhibitor 2 (Fragment) O... [more]
sp|P0C8W3|VKT11_HOFGE7.960e-1440.74Kunitz-type serine protease inhibitor Hg1 OS=Hoffm... [more]
back to top
BLAST of SMED30033970 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S2LXI91.886e-1548.05BPTI/Kunitz inhibitor domain-containing protein OS... [more]
A0A0R3WBP86.189e-1546.38BPTI/Kunitz inhibitor domain-containing protein OS... [more]
T1GSQ89.096e-1547.37BPTI/Kunitz inhibitor domain-containing protein OS... [more]
A0A5J4N8H19.588e-1536.59BPTI/Kunitz inhibitor domain-containing protein OS... [more]
A0A068Y4671.088e-1444.87Trypsin inhibitor OS=Echinococcus multilocularis O... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wfikkn2b7.719e-1348.15WAP, Kazal, immunoglobulin, Kunitz and NTR domain-... [more]
col28a2a1.268e-1140.68collagen alpha-1(XXVIII) chain-like [Source:NCBI g... [more]
ENSAMXT00000002208.23.958e-1142.19pep primary_assembly:Astyanax_mexicanus-2.0:13:361... [more]
ambp7.894e-1144.26alpha-1-microglobulin/bikunin precursor [Source:NC... [more]
ambp7.948e-1144.26alpha-1-microglobulin/bikunin precursor [Source:NC... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi26.192e-1244.83tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
WFIKKN13.288e-1137.25WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
ENSPMAT00000008261.12.556e-941.18pep scaffold:Pmarinus_7.0:GL478901:735:1448:1 gene... [more]
ENSPMAT00000005038.16.477e-943.08pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.19.726e-945.45pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033970 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO416965.052e-1451.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262635.052e-1451.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384663.400e-1344.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260723.590e-1344.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382844.600e-1344.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033970 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paplna1.834e-1250.98papilin, proteoglycan like sulfated glycoprotein [... [more]
paplnb2.270e-1244.44papilin [Source:NCBI gene;Acc:101161692][more]
paplna4.591e-1249.15papilin, proteoglycan like sulfated glycoprotein [... [more]
ENSORLT00000042019.12.066e-1145.45pep primary_assembly:ASM223467v1:12:15740119:15780... [more]
wfikkn2a3.155e-1146.30WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of SMED30033970 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038052.11.138e-5298.70SMESG000038052.1[more]
SMESG000038055.18.288e-4687.01SMESG000038055.1[more]
SMESG000037994.19.695e-2856.00SMESG000037994.1[more]
SMESG000037991.13.766e-2561.90SMESG000037991.1[more]
SMESG000038005.14.287e-2452.87SMESG000038005.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033970 ID=SMED30033970|Name=SMED30033970|organism=Schmidtea mediterranea sexual|type=transcript|length=330bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTTTTTAATGTTATAAAATATATTGTAAAATTATTTTTCAC
AACGTTCTTCACACTCAGCTCTCGTGTGAAAGTTATTGTCATTTACATGA
CATCCTCCATAAACAAAAGTTCTGCATTTCCCCAATTTCACATCAAAACC
ATATCTAACAAAATAGGCTTCACATAATCCCGTTTCCAAAGGTAAATTGC
ATTCTGGAGCTTTGCTTTCTGTGAGCTGAAGTACAGCAACAAAAATACAT
GAAAAAATAACGAGTGAATTCATTTTTGTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 23..37
score: 34.47
coord: 61..76
score: 42.11
coord: 51..61
score: 52.55
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 24..77
e-value: 1.6E-18
score: 77.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 26..77
e-value: 2.6E-17
score: 62.8
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 26..76
score: 14.162
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 26..76
e-value: 5.24352E-19
score: 70.7418
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 14..78
e-value: 2.8E-21
score: 77.0
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 19..77
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 22..76
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.794
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 54..72