SMED30033968
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30033968 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Homology
BLAST of SMED30033968 vs. Planmine SMEST
Match: SMESG000040671.1 (SMESG000040671.1) HSP 1 Score: 103.219 bits (256), Expect = 6.052e-28 Identity = 46/59 (77.97%), Postives = 54/59 (91.53%), Query Frame = 2 Query: 386 YKKNISNADEKVIDGKWYIRNEDQLHSKKDLIEAWRQILEAPPFNDCMPIEDKQNMENA 562 YKKNIS+A EKVIDGKW++RNEDQ+HS KDLIEAWR ILEAPPF+DC PIED++NM+ A Sbjct: 51 YKKNISSAAEKVIDGKWFLRNEDQVHSNKDLIEAWRPILEAPPFSDCRPIEDQRNMDYA 109
BLAST of SMED30033968 vs. Planmine SMEST
Match: SMESG000040682.1 (SMESG000040682.1) HSP 1 Score: 102.834 bits (255), Expect = 1.116e-26 Identity = 47/66 (71.21%), Postives = 57/66 (86.36%), Query Frame = 2 Query: 386 YKKNISNADEKVIDGKWYIRNEDQLHSKKDLIEAWRQILEAPPFNDCMPIEDKQNMENALMKISTA 583 YKKNIS+A EKVIDGKW +RNE+Q+HS ++LIEAWR IL+APPFNDC PIED++N LM+ISTA Sbjct: 68 YKKNISSAAEKVIDGKWSLRNEEQMHSNEELIEAWRPILDAPPFNDCRPIEDQRNTGYDLMEISTA 133
BLAST of SMED30033968 vs. Planmine SMEST
Match: SMESG000030694.1 (SMESG000030694.1) HSP 1 Score: 68.1662 bits (165), Expect = 6.384e-13 Identity = 33/57 (57.89%), Postives = 44/57 (77.19%), Query Frame = 2 Query: 383 WYKKNISNADEKVIDGKWYIRNEDQLHSKKDLIEAWRQILEAPPFNDCMPIEDKQNM 553 YKKNIS+A EK I+GKW I+ E++ H+ KDLI+AW+ ILEAPPF+D E+ Q+M Sbjct: 274 LYKKNISSAAEKAINGKWSIKPEEEYHNNKDLIKAWKPILEAPPFSDSQ--ENIQSM 328
BLAST of SMED30033968 vs. Planmine SMEST
Match: SMESG000011541.1 (SMESG000011541.1) HSP 1 Score: 52.373 bits (124), Expect = 1.182e-7 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 2 Query: 614 KMAKIDIRKHSAEI*FSNAQVLLKFLNNDKGNELDIWSSW 733 KMA IDIR H AEI +S+AQVL++F+ N+KG +LDIWSSW Sbjct: 16 KMA-IDIRMHWAEIRYSDAQVLIEFIMNEKGIKLDIWSSW 54
BLAST of SMED30033968 vs. Planmine SMEST
Match: SMESG000001175.1 (SMESG000001175.1) HSP 1 Score: 49.2914 bits (116), Expect = 1.120e-6 Identity = 24/41 (58.54%), Postives = 31/41 (75.61%), Query Frame = 2 Query: 611 IKMAKIDIRKHSAEI*FSNAQVLLKFLNNDKGNELDIWSSW 733 + M +DIR H AEI FS++QVL+ F+ N KG +LDIWSSW Sbjct: 5 MAMKNMDIRMHWAEIRFSDSQVLIDFIINKKGIKLDIWSSW 45 The following BLAST results are available for this feature:
BLAST of SMED30033968 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30033968 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30033968 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30033968 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30033968 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30033968 ID=SMED30033968|Name=SMED30033968|organism=Schmidtea mediterranea sexual|type=transcript|length=734bpback to top protein sequence of SMED30033968-orf-1 >SMED30033968-orf-1 ID=SMED30033968-orf-1|Name=SMED30033968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp MRYSSYEVFLKSIYLRILWTEDRHHHQHTDAKTAIENPELKLDCSNIDERback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|