Rho GTPase activating protein

Overview
NameRho GTPase activating protein
Smed IDSMED30033957
Length (bp)2891
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase activating protein (SMED30033957) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase activating protein (SMED30033957) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase activating protein (SMED30033957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase activating protein (SMED30033957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033957SMESG000039887.1 SmedASXL_013449SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033957SMESG000039887.1 dd_Smed_v6_18024_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase activating protein vs. Ensembl Human
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:HGNC Symbol;Acc:HGNC:25841])

HSP 1 Score: 194.897 bits (494), Expect = 2.732e-50
Identity = 122/382 (31.94%), Postives = 200/382 (52.36%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL----QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWPTIKQKLIFGKSTSN 2620
            SDQP     I+G++ V+      L+      +D++C +++DS+ KAR+ + T    F + D  F I++ N+  L ++++ W+P    +R+C +G + L T        V    ++ ++LEP+GL+Y+++  +  WE S      N++  +FG     I+ VV   N     P +I  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  +  PDI+VIT VLKD+LRELP PL+T  LY  ++ +   S +        ++P      + + + LP++ + +L   +DHL  +A  +++NKMT   L+  F  +LL    +PS      + +   LA     ++ IE L YLL  WP   Q+L   KST N
Sbjct:  669 SDQPKCSQYISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLF-----RVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDINQEPIIFG---VDIQKVVEKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPV--QRLTVKKSTDN 1040          
BLAST of Rho GTPase activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 155.606 bits (392), Expect = 2.433e-38
Identity = 107/330 (32.42%), Postives = 162/330 (49.09%), Query Frame = 2
Query: 1625 RDLYCVLEIDSMRKARS-MIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL--QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWPTIK 2587
            RDL C+L++D   +AR+  +R   +    D  F ++L  +  L  L+  WDP    HR C  G + L T     Q     A ++ ++LEP+GLLY ++     + +        +  VFG P+  +   V         P +I  CV +IERRGL  VGLYRLCG+A +K  LR   E       +S  + PDI+VIT +LKD+LRELP PL+T  LY+ ++++         P        + + LP V R +L   +DHL  ++  +  N+MT   L+  F  +LL  + +  +     +  GLA     +  IE L YLL  WP  +
Sbjct:  287 RDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGCQ-----AQQLAVRLEPQGLLYAKLTLSEQQEA----PATAEPRVFGLPLPLL---VERERPPGQVPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWPDPR 604          
BLAST of Rho GTPase activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 154.836 bits (390), Expect = 2.448e-38
Identity = 107/327 (32.72%), Postives = 161/327 (49.24%), Query Frame = 2
Query: 1625 RDLYCVLEIDSMRKARS-MIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL--QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWP 2578
            RDL C+L++D   +AR+  +R   +    D  F ++L  +  L  L+  WDP    HR C  G + L T     Q     A ++ ++LEP+GLLY ++     + +        +  VFG P+  +   V         P +I  CV +IERRGL  VGLYRLCG+A +K  LR   E       +S  + PDI+VIT +LKD+LRELP PL+T  LY+ ++++         P        + + LP V R +L   +DHL  ++  +  N+MT   L+  F  +LL  + +  +     +  GLA     +  IE L YLL  WP
Sbjct:  220 RDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGCQ-----AQQLAVRLEPQGLLYAKLTLSEQQEA----PATAEPRVFGLPLPLL---VERERPPGQVPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWP 534          
BLAST of Rho GTPase activating protein vs. Ensembl Human
Match: BCR (BCR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:1014])

HSP 1 Score: 144.436 bits (363), Expect = 2.389e-34
Identity = 105/338 (31.07%), Postives = 164/338 (48.52%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINL----LTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+ PG+ G L V V +    + S     +LYC LE+DS    + KA++ +   T    W+E FEI+L  S  L IL Y+           D ++  RL   G + L    L   D+ Q+ V   + + ++L  K        F + E S  R  + +   VFG     ++  V +       P+++  CVEEIERRG++ VG+YR+ G A     L+   +  + D + M S +  D++ I   LK + RELPEPL T   Y N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+PS
Sbjct:  901 KEDDESPGLYGFLNVIVHSATGFKQSS----NLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDW-QRTVIAMNGIEVKLSVK--------FNSREFSLKRMPSRKQTGVFG-----VKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKES---CMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPS 1215          
BLAST of Rho GTPase activating protein vs. Ensembl Human
Match: ABR (ABR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:81])

HSP 1 Score: 137.117 bits (344), Expect = 2.498e-32
Identity = 105/345 (30.43%), Postives = 166/345 (48.12%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCF-YGGINLLTFIDYFQQNVAGADKVI----LQLEPKGL----------------LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+ PG+ G L V V +    + S     +LYC LE+DS    + KA++ +   T   +WDE FEI+L  S  L IL Y+         C+    +N        + N    DK++    +QL+P+ +                +   M F + ++S  R  + +   VFG  IS     V +       P+++  CVEE+E+RG++ VG+YR+ G A     L+ + +  + D   M S +  DI+ I   LK + RELPEPLLT  LY   ++    SD          M+ +  SLP  N  + ++ ++HL R+A+K  INKM++  L+T F   LL+PS
Sbjct:  494 KDDDESPGLYGFLHVIVHSAKGFKQS----ANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEK--------CYDKTKVN--------KDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKIS-----VVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN---CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPS 808          
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 182.185 bits (461), Expect = 1.729e-47
Identity = 123/380 (32.37%), Postives = 198/380 (52.11%), Query Frame = 2
Query: 1391 LYNSLVISE--PKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGI----------AGILVVNVIAGCSL---QSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI-LQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            L  SLV S   P+ P P +Q+  S + +RY          L + R   P+R++   PGI           GIL V+++ G  L   +    L  ++YCVLE+D   +AR+ + T  + F+W E F ID+ N+   +  +Y W P+  H+LC  G + LL   + F  +    D+V  L LEP+G L + + F + +  F R  N R N VFG  +S++      +      P V+T  ++EIE+RG+D  GLY LCG+ + K  LR  LE+    T++++  IPD +VI  ++KDFLRELPEPL++  ++  L++++  +   D      +++ I + L    +  L+  +DHL  +   +  N +T + LS  FA LL 
Sbjct:  290 LAQSLVGSPVLPRHPPPIVQDRPSAVFDRY------HVSPLMNRR--APLRAAG--PGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSLKLL---EAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNPRLNGVFGISLSRLVQRERRDT-----PIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLF 651          
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 181.8 bits (460), Expect = 9.771e-47
Identity = 123/380 (32.37%), Postives = 198/380 (52.11%), Query Frame = 2
Query: 1391 LYNSLVISE--PKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGI----------AGILVVNVIAGCSL---QSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI-LQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            L  SLV S   P+ P P +Q+  S + +RY          L + R   P+R++   PGI           GIL V+++ G  L   +    L  ++YCVLE+D   +AR+ + T  + F+W E F ID+ N+   +  +Y W P+  H+LC  G + LL   + F  +    D+V  L LEP+G L + + F + +  F R  N R N VFG  +S++      +      P V+T  ++EIE+RG+D  GLY LCG+ + K  LR  LE+    T++++  IPD +VI  ++KDFLRELPEPL++  ++  L++++  +   D      +++ I + L    +  L+  +DHL  +   +  N +T + LS  FA LL 
Sbjct:  556 LAQSLVGSPVLPRHPPPIVQDRPSAVFDRY------HVSPLMNRR--APLRAAG--PGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSLKLL---EAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNPRLNGVFGISLSRLVQRERRDT-----PIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLF 917          
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 181.8 bits (460), Expect = 1.057e-46
Identity = 123/380 (32.37%), Postives = 198/380 (52.11%), Query Frame = 2
Query: 1391 LYNSLVISE--PKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGI----------AGILVVNVIAGCSL---QSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI-LQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            L  SLV S   P+ P P +Q+  S + +RY          L + R   P+R++   PGI           GIL V+++ G  L   +    L  ++YCVLE+D   +AR+ + T  + F+W E F ID+ N+   +  +Y W P+  H+LC  G + LL   + F  +    D+V  L LEP+G L + + F + +  F R  N R N VFG  +S++      +      P V+T  ++EIE+RG+D  GLY LCG+ + K  LR  LE+    T++++  IPD +VI  ++KDFLRELPEPL++  ++  L++++  +   D      +++ I + L    +  L+  +DHL  +   +  N +T + LS  FA LL 
Sbjct:  488 LAQSLVGSPVLPRHPPPIVQDRPSAVFDRY------HVSPLMNRR--APLRAAG--PGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSLKLL---EAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNPRLNGVFGISLSRLVQRERRDT-----PIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLF 849          
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 80.4925 bits (197), Expect = 5.555e-15
Identity = 54/169 (31.95%), Postives = 90/169 (53.25%), Query Frame = 2
Query: 2027 DCKPFVITLCVEEIERRGLDNVGLYRLCG-AAKLKAHLRQLLETYHDFTDMSS--SVIP---DIHVITSVLKDFLRELPEPLLTTALYRNLVK----SSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQL 2503
            D  P ++  CV  IE  G+D VG+YR+ G  A + A    L     D  D+S   S+ P   D++V++S+LK FLR+LPEPLLT  LY   +     S+ H+ ++        +  +   LP+ + ++L + I HL  + + +D+NKM    L+  F   +++PS + +
Sbjct: 1073 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHK-------LRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDDNM 1234          
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 80.1073 bits (196), Expect = 5.874e-15
Identity = 54/169 (31.95%), Postives = 90/169 (53.25%), Query Frame = 2
Query: 2027 DCKPFVITLCVEEIERRGLDNVGLYRLCG-AAKLKAHLRQLLETYHDFTDMSS--SVIP---DIHVITSVLKDFLRELPEPLLTTALYRNLVK----SSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQL 2503
            D  P ++  CV  IE  G+D VG+YR+ G  A + A    L     D  D+S   S+ P   D++V++S+LK FLR+LPEPLLT  LY   +     S+ H+ ++        +  +   LP+ + ++L + I HL  + + +D+NKM    L+  F   +++PS + +
Sbjct:  598 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHK-------LRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDDNM 759          
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0343538)

HSP 1 Score: 219.55 bits (558), Expect = 2.878e-58
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  799 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVD-ALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1144          
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0304594)

HSP 1 Score: 218.779 bits (556), Expect = 3.275e-58
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  788 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTV-DALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1133          
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0304595)

HSP 1 Score: 219.55 bits (558), Expect = 3.449e-58
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  786 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVD-ALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1131          
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0309829)

HSP 1 Score: 219.55 bits (558), Expect = 3.453e-58
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  789 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVD-ALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1134          
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0302180)

HSP 1 Score: 219.55 bits (558), Expect = 3.545e-58
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  788 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVD-ALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1133          
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Match: SYDE2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:NCBI gene;Acc:100333199])

HSP 1 Score: 183.726 bits (465), Expect = 7.605e-48
Identity = 114/372 (30.65%), Postives = 196/372 (52.69%), Query Frame = 2
Query: 1559 IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTS-TEVFEWDEIFEIDLWNSHFLSILLYQWD--PKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSF-------HSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLI----GLA-----RQEIEFLQYLLTQWPTIKQKLIFGKSTS 2617
            I+G++ ++      L+      RD+YC +++DS+ KAR+ + T  T   + D  F I+L N+  L ++++ W+  P+  +R+C +G + L          V+   ++ ++LEP+G++Y++++ +    + +   ++    VFG    + R VV    +    P +I  C+ EIERRG   VGLYRLCG+A +K  LR+  E      ++S S  PDI+VIT VLKD+LRELP PL+T  LY  ++++         ++   + P    + +++ + LP V + SL   +DHL R+A  +++NKM    L+  F  +LL    E  +  + +      LA     ++ IE L YLL  WP +      GK +S
Sbjct:  162 ISGLMSLHFYGAEDLKLPRVDSRDIYCAIQVDSVNKARTALLTCRTSFLDMDHTFNIELENAQHLKLVVFSWESTPR-RNRVCCHGTVVLPGLF-----RVSKTHQLAVRLEPRGMIYVKLSLMEQRQNSL-DGDHPQMQVFG---VEARHVVEREASGLMVPLLIEKCISEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHSVELSESNYPDINVITGVLKDYLRELPHPLITQQLYECVLEAMMKRPLLMGNAGCENTPADSQLTVSLLDILPDVEKASLKKLLDHLKRVASHHELNKMPCQNLAVCFGPVLLSQRQEASSQAKRVFIDSEELASALHFKKHIEVLHYLLQLWPVVD---AHGKPSS 520          
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:568166])

HSP 1 Score: 159.458 bits (402), Expect = 2.233e-39
Identity = 105/380 (27.63%), Postives = 183/380 (48.16%), Query Frame = 2
Query: 1559 IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKAR-SMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKT--------HHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELS-FIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDN---PEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS--CEQLNNYQNLIGLA-------------------------RQEIEFLQYLLTQWP 2578
            ++G+L V+++    L  ++   ++++C +++D + +AR S++         +  F ++L  +  L +++    P T         +R+C  G + +       +     +  + ++LEP+GLLY+++  L   +S F R  +    +VFG    ++R +V   +     P +I  CV EI+RRGL  VGLYRLCG+A +K  LR   E       ++  + PD++VIT +LKD+LRELP PL+T  LY  ++++      Y N    +     +++ + LP+  R +L + +DHL  +A  +D N+MT   L+  F  +LL PS  C Q        G                           ++ IE L YLL  WP
Sbjct:  435 LSGLLTVHLLGVEELLRANKASKEVFCAIQVDGVTRARTSLLTCRGACLPLNHTFNLELERARLLKLVILT--PATANASSAPARNRVCCVGAVAIPALFKACR-----SQHLCVRLEPRGLLYVKLTLLEQFVSPFPRPGDLPPPAVFG---VELRPLVEKESTALRVPLIIQKCVSEIQRRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVTLNEELYPDVNVITGILKDYLRELPSPLITRTLYEVVLEAMTVRPAYRNDSDAQKSQSTVSLLHCLPEPERATLCFLLDHLSLVASYSDSNRMTCQNLAVCFGPVLLTPSQECWQAGLSAPACGGVLPGSGASRGGRSFAHSEEINSAVDFKRHIEALHYLLQLWP 804          
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:ZFIN;Acc:ZDB-GENE-040724-43])

HSP 1 Score: 141.354 bits (355), Expect = 1.403e-33
Identity = 105/335 (31.34%), Postives = 165/335 (49.25%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +   L+ S     +LYC LE+DS    + KA++ +   T   +W+E FEI+L  SH L +L Y+           D ++  R+   G + L        Q + G D     +   G+ + + M F + E S  R  + +   VFG  IS +     S       P+++  C+EEIERRG++ VG+YR+ G A     L+   +T + D + M S +  D++ I   LK + RELPEPL T  LY N       SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+P+
Sbjct:  971 KEEDESTGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGIFVNKAKTRVYRYTTEPKWNEEFEIELEGSHTLRLLCYEKSYNKAKVNKEDGESTDRIMGKGQMPLDP------QMLQGKDWQRTVIPMNGIEVKISMKFTSREFSLKRMPSRKPMGVFGVNISTVTKRERSK-----VPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALSDSVAKES---CMLNLLLSLPEPNLVTFLFLLDHLKRIAEKECVNKMSLHNLATVFGPTLLRPA 1285          
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 140.198 bits (352), Expect = 2.939e-33
Identity = 106/332 (31.93%), Postives = 159/332 (47.89%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQ-----QNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIP---DIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +   L+ S     +LYC LE+DS    + KA++ +   T    W+E FEI+L  S  L +L Y     +  + C   G N+   +   Q     Q++ G D     +   G+ + L M F + E S  R  + + + VFG  I  +     S       P ++  CVEEIERRG++ VG+YR+ G A       Q L+   D  +   SVI    D++ I   LK + RELPEPL T  LY N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+   +NKM+   L+T F   LL+PS
Sbjct:  873 KDDDESTGLCGFLNVIVHSATGLKQS----LNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCY-----SKIKQCRDDGENMDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKLSMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKREHSK-----VPLIVRQCVEEIERRGMEEVGIYRVSGVATDI----QALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKES---CMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPS 1183          
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 140.198 bits (352), Expect = 2.988e-33
Identity = 105/332 (31.63%), Postives = 159/332 (47.89%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQ-----QNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIP---DIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +   L+ S     +LYC LE+DS    + KA++ +   T    W+E FEI+L  S  L +L Y     +  + C   G N+   +   Q     Q++ G D     +   G+ + L M F + E S  R  + + + VFG  I  +     +       P ++  CVEEIERRG++ VG+YR+ G A       Q L+   D  +   SVI    D++ I   LK + RELPEPL T  LY N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+   +NKM+   L+T F   LL+PS
Sbjct:  861 KDDDESTGLCGFLNVIVHSATGLKQS----LNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCY-----SKIKQCRDDGENMDRVMAKGQIQLDPQSLQGKDWQRTVISMNGIEVKLSMRFTSREFSLKRMPSRKQSGVFGVKIGAV-----TKREHSKVPLIVRQCVEEIERRGMEEVGIYRVSGVATDI----QALKAAFDANNKDVSVIMSEMDVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALSDSVAKES---CMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPS 1171          
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 194.512 bits (493), Expect = 4.239e-50
Identity = 118/369 (31.98%), Postives = 194/369 (52.57%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFH-------SDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQE----------IEFLQYLLTQWP 2578
            SDQP     I+G++ ++      L+      +D++C +++DS+ KAR+ + T    F + D  F I+L N+  L ++++ WDP    +R+C +G + L          V    ++ ++LEP+GL+Y+++  +  WE S  R   +R+  VFG    + R VV   NA    P ++  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  S  PDI+VIT VLKD+LRELP PL+T  LY  ++K+          S   ++       +++ + LP V + +L   +DHL  +A  +++NKMT   L+  F  +LL    ++ +++ N + +  +E          IE L YLL  WP
Sbjct:  804 SDQPKCFQYISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPALF-----RVTKTHQLAVKLEPRGLIYVKLNLMEQWENSLDRPGVDREPIVFG---VEARKVVEKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQR-QETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP 1163          
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 194.897 bits (494), Expect = 4.451e-50
Identity = 118/369 (31.98%), Postives = 194/369 (52.57%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFH-------SDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQE----------IEFLQYLLTQWP 2578
            SDQP     I+G++ ++      L+      +D++C +++DS+ KAR+ + T    F + D  F I+L N+  L ++++ WDP    +R+C +G + L          V    ++ ++LEP+GL+Y+++  +  WE S  R   +R+  VFG    + R VV   NA    P ++  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  S  PDI+VIT VLKD+LRELP PL+T  LY  ++K+          S   ++       +++ + LP V + +L   +DHL  +A  +++NKMT   L+  F  +LL    ++ +++ N + +  +E          IE L YLL  WP
Sbjct: 1031 SDQPKCFQYISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPALF-----RVTKTHQLAVKLEPRGLIYVKLNLMEQWENSLDRPGVDREPIVFG---VEARKVVEKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQR-QETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP 1390          
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 140.198 bits (352), Expect = 4.632e-33
Identity = 104/338 (30.77%), Postives = 161/338 (47.63%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQW-----------DPKTHHRLCFYGGINL---LTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +    Q S +LF    C LE+DS    + KA++ +  +T    W+E FEI+L  S  L IL Y+               +  R+   G + L   L     + ++V   + V + +E K    L M F + E S  R  + +   VFG     ++  V +       P+++  CVEEIERRGL+ VG+YR+ G A     L+   +  + D + M S +  D++ I   LK + RELP PL T  LY N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+    NKM++  L+T F   LL+PS
Sbjct:  788 KEDDESSGLYGFLNVIVHSATGFQQSSNLF----CTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGVSILIEVK----LSMKFTSREFSLKRLPSRKQTGVFG-----VKIAVVTKRERSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM--DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALSDPVAKES---CMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPS 1107          
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 139.813 bits (351), Expect = 4.946e-33
Identity = 103/326 (31.60%), Postives = 159/326 (48.77%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVA-GADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +    Q S +LF    C LE+DS    + KA++ +  +T    W+E FEI+L  S  L IL Y+     +  +   GG +    +   Q  +A G D     +   G+ + L M F + E S  R  + +   VFG     ++  V +       P+++  CVEEIERRGL+ VG+YR+ G A     L+   +  + D + M S +  D++ I   LK + RELP PL T  LY N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+    NKM++  L+T F   LL+PS
Sbjct:  765 KEDDESSGLYGFLNVIVHSATGFQQSSNLF----CTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLALGKDWHRSVVSMNGIEVKLSMKFTSREFSLKRLPSRKQTGVFG-----VKIAVVTKRERSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM--DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALSDPVAKES---CMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPS 1076          
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 137.502 bits (345), Expect = 2.603e-32
Identity = 103/330 (31.21%), Postives = 158/330 (47.88%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQ-----QNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +    Q S +LF    C LE+DS    + KA++ +  +T    W+E FEI+L  S  L IL Y+     +  +   GG +    +   Q     Q   G D     +   G+ + L M F + E S  R  + +   VFG     ++  V +       P+++  CVEEIERRGL+ VG+YR+ G A     L+   +  + D + M S +  D++ I   LK + RELP PL T  LY N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+    NKM++  L+T F   LL+PS
Sbjct:  778 KEDDESSGLYGFLNVIVHSATGFQQSSNLF----CTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGIEVKLSMKFTSREFSLKRLPSRKQTGVFG-----VKIAVVTKRERSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM--DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALSDPVAKES---CMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPS 1093          
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 189.119 bits (479), Expect = 1.115e-48
Identity = 114/369 (30.89%), Postives = 190/369 (51.49%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQE----------IEFLQYLLTQWP 2578
            +DQP     I+G++ V+      L+      +D++C +++DS+ KAR+ + T    F + D  F I++ N+  L ++++ W+P    +R+C +G + L          V    ++ ++LEP+GL+Y+++  +  WE S      NR+  +FG     I+ VV   N     P +I  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  +  PDI+VIT VLKD+LRELP PL+T  LY  ++ +   S +        + P    + + + + LP V + +L   +DHL  +A  +++NKMT   L+  F  +LL    ++ + + N +    +E          IE L YLL  WP
Sbjct:  522 ADQPKCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPALF-----RVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDKNREAVMFG---VDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQR-QEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 881          
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 189.119 bits (479), Expect = 1.221e-48
Identity = 114/369 (30.89%), Postives = 190/369 (51.49%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQE----------IEFLQYLLTQWP 2578
            +DQP     I+G++ V+      L+      +D++C +++DS+ KAR+ + T    F + D  F I++ N+  L ++++ W+P    +R+C +G + L          V    ++ ++LEP+GL+Y+++  +  WE S      NR+  +FG     I+ VV   N     P +I  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  +  PDI+VIT VLKD+LRELP PL+T  LY  ++ +   S +        + P    + + + + LP V + +L   +DHL  +A  +++NKMT   L+  F  +LL    ++ + + N +    +E          IE L YLL  WP
Sbjct:  523 ADQPKCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPALF-----RVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDKNREAVMFG---VDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQR-QEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 882          
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 187.963 bits (476), Expect = 3.876e-48
Identity = 114/369 (30.89%), Postives = 190/369 (51.49%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQE----------IEFLQYLLTQWP 2578
            +DQP     I+G++ V+      L+      +D++C +++DS+ KAR+ + T    F + D  F I++ N+  L ++++ W+P    +R+C +G + L          V    ++ ++LEP+GL+Y+++  +  WE S      NR+  +FG     I+ VV   N     P +I  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  +  PDI+VIT VLKD+LRELP PL+T  LY  ++ +   S +        + P    + + + + LP V + +L   +DHL  +A  +++NKMT   L+  F  +LL    ++ + + N +    +E          IE L YLL  WP
Sbjct:  790 ADQPKCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPALF-----RVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDKNREAVMFG---VDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLN-QRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1149          
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Match: Syde1 (synapse defective 1, Rho GTPase, homolog 1 (C. elegans) [Source:MGI Symbol;Acc:MGI:1918959])

HSP 1 Score: 161.384 bits (407), Expect = 2.042e-40
Identity = 110/337 (32.64%), Postives = 168/337 (49.85%), Query Frame = 2
Query: 1607 SSHSLFRDLYCVLEIDSMRKARS-MIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQ----PSCEQLNNYQNLIGLA---RQEIEFLQYLLTQWPTIKQ 2590
            S  +  RDL C+L++D + +AR+  +R+  +    D  F ++L  +  L  L+  WDP    HR C  G + L T     Q     A ++ ++LEP+GLLY ++     + +        +  VFG P+  +   V    +    P +I  CV +IE RGL  VGLYRLCG+A +K  LR   E       +S  V PDI+VIT +LKD+LRELP PL+T  LY+ ++++           GP     +   LP V R +L   +DHL  ++  +  N+MT   L+  F  +LL     PS  +L +    +  A   ++ IE L YLL  WP  ++
Sbjct:  281 SPGATPRDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTIFRGCQ-----AQQLAVRLEPQGLLYAKLTLSEQQEA----PATAEPRVFGLPLQLL---VEREQSPGQVPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLRCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRPRLRSSGPGVTSAVDFKRHIEVLHYLLQSWPDTRR 605          
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Match: Bcr (BCR activator of RhoGEF and GTPase [Source:MGI Symbol;Acc:MGI:88141])

HSP 1 Score: 145.976 bits (367), Expect = 5.123e-35
Identity = 103/344 (29.94%), Postives = 167/344 (48.55%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI----LQLEPKGL----------------LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+ PG+ G L V V +    + S     +LYC LE+DS    + KA++ +   T    W+E FEI+L  S  L IL Y+   K ++++               +++   ADK++    +QL+P+ L                + L + F + E S  R  + +   VFG     ++  V +       P+++  CVEEIERRG++ VG+YR+ G A     L+   +  + D + M S +  D++ I   LK + RELPEPL T   Y N  +    SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+PS
Sbjct:  900 KEDDESPGLYGFLHVIVHSATGFKQSS----NLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYE---KCYNKMKMT------------KEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIEVKLSVKFTSREFSLKRMPSRKQTGVFG-----VKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKES---CMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPS 1214          
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Match: sp|Q9V9S7|SYDE_DROME (Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 3.867e-57
Identity = 128/359 (35.65%), Postives = 204/359 (56.82%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSS---------HSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQT----NNRDNSVFGRPISQIRSVVS--SNNAFDCKPFVITL--CVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEG-PMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            GI+G+L ++++AG  L+++             RDLYCV+E D + KAR+++R+    F+WDE FE+DL  +  L +L+Y WDP+  H+LC+ G I+L + +     +     ++ L++EP+G +Y+ M   +    + R+          ++FG   + + +VV+  S NA    P  I L  CVEE+ERRGLD +GLYRLCG+A  K  LR+  E      +++   +PDI+VIT VLKD+LRELPEPL T  L++  V  +    + D+PEG   +M++I + LP+ NR +L++ +DHL  +   ++ NKM+   L+T     L+L  +  Q     +      Q I  L+YLL  W
Sbjct:  799 GISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQSPLH-----QLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFG---ADLETVVNRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVD-ALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHSASAQPGADIDHA----QPIAVLKYLLQIW 1144          
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Match: sp|Q5VT97|SYDE2_HUMAN (Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 1.312e-49
Identity = 122/382 (31.94%), Postives = 200/382 (52.36%), Query Frame = 2
Query: 1541 SDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL----QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWPTIKQKLIFGKSTSN 2620
            SDQP     I+G++ V+      L+      +D++C +++DS+ KAR+ + T    F + D  F I++ N+  L ++++ W+P    +R+C +G + L T        V    ++ ++LEP+GL+Y+++  +  WE S      N++  +FG     I+ VV   N     P +I  C+ EIE+RG   VGLYRLCG+A +K  LR+  E       +  +  PDI+VIT VLKD+LRELP PL+T  LY  ++ +   S +        ++P      + + + LP++ + +L   +DHL  +A  +++NKMT   L+  F  +LL    +PS      + +   LA     ++ IE L YLL  WP   Q+L   KST N
Sbjct:  669 SDQPKCSQYISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLF-----RVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLHGLDINQEPIIFG---VDIQKVVEKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPV--QRLTVKKSTDN 1040          
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Match: sp|Q61CA4|SYD1_CAEBR (Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae OX=6238 GN=syd-1 PE=3 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 9.097e-47
Identity = 125/380 (32.89%), Postives = 197/380 (51.84%), Query Frame = 2
Query: 1391 LYNSLVISE--PKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGI----------AGILVVNVIAGCSL---QSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI-LQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            L  SLV S   P+ P P +Q+  S + +RY          L + R   P+R++   PGI           GIL V+++ G  L   +    L  ++YCVLE+D   +AR+ + T  + F+W E F ID+ N+   +  +Y W P+  H+LC  G + LL      Q N    D+V  L LEP+G L + + F + +  F R  N R N VFG P+ ++      +      P V+T  ++EIE+RG+D  GLY LCG+ + K  LR  LE+    TD+++  IPD +VI  ++KDFLRELPEPL++  ++  L++++  +   D      +++ I + L    +  L+  +DHL  +   +  N +T + LS  FA LL 
Sbjct:  530 LAQSLVGSPVLPRHPPPIVQDRPSAVFDRY------HVSPLMNRR--APLRAAG--PGINVDRLSVSSLTGILYVHILEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSLKLLEAFVVDQLN---DDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNPRLNGVFGVPLGRLVQRERRDT-----PIVLTRLIQEIEKRGVDLSGLYVLCGSVEKKKMLRAQLESNPLGTDLNAENIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAATVALPNDVQANRTLVLKIIDCLQLSAKNCLLLVLDHLSTILCSSPHNGLTPTRLSLIFAPLLF 891          
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Match: sp|Q86NH1|SYD1_CAEEL (Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans OX=6239 GN=syd-1 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.243e-45
Identity = 123/380 (32.37%), Postives = 198/380 (52.11%), Query Frame = 2
Query: 1391 LYNSLVISE--PKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGI----------AGILVVNVIAGCSL---QSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVI-LQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            L  SLV S   P+ P P +Q+  S + +RY          L + R   P+R++   PGI           GIL V+++ G  L   +    L  ++YCVLE+D   +AR+ + T  + F+W E F ID+ N+   +  +Y W P+  H+LC  G + LL   + F  +    D+V  L LEP+G L + + F + +  F R  N R N VFG  +S++      +      P V+T  ++EIE+RG+D  GLY LCG+ + K  LR  LE+    T++++  IPD +VI  ++KDFLRELPEPL++  ++  L++++  +   D      +++ I + L    +  L+  +DHL  +   +  N +T + LS  FA LL 
Sbjct:  556 LAQSLVGSPVLPRHPPPIVQDRPSAVFDRY------HVSPLMNRR--APLRAAG--PGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSLKLL---EAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNPRLNGVFGISLSRLVQRERRDT-----PIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLF 917          
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Match: sp|D3ZZN9|SYDE1_RAT (Rho GTPase-activating protein SYDE1 OS=Rattus norvegicus OX=10116 GN=Syde1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.015e-39
Identity = 109/331 (32.93%), Postives = 166/331 (50.15%), Query Frame = 2
Query: 1625 RDLYCVLEIDSMRKARS-MIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTH-HRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQ----PSCEQLNNYQNLIGLA---RQEIEFLQYLLTQWPTIKQ 2590
            RDL C+L++D + +AR+  +R+  +    D  F ++L  +  L  L+  WDP    HR C  G + L T     Q     A ++ ++LEP+GLLY ++     + +        +  VFG P+  +   V    +    P +I  CV +IE RGL  VGLYRLCG+A +K  LR   E       +S  V PDI+VIT +LKD+LRELP PL+T  LY+ ++++           GP     + + LP V R +L   +DHL  ++  +  N+MT   L+  F  +LL     PS  +L      +  A   ++ IE L YLL  WP  ++
Sbjct:  287 RDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTIFRGCQ-----AQQLAVRLEPQGLLYAKLTLSEQQEA----PATVEPRVFGLPLQLL---VEREQSPGQVPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRTRLRGSGPGVSSAVDFKRHIEVLHYLLQSWPDTRR 605          
BLAST of Rho GTPase activating protein vs. TrEMBL
Match: A0A267G9H2 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014851g2 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.718e-82
Identity = 150/364 (41.21%), Postives = 219/364 (60.16%), Query Frame = 2
Query: 1493 DFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIR-QTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPE-GPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQ-NLIGLARQEIEFLQYLLTQW 2575
            +FR   S+R  + +     P GI G+L V+V+AG  L +     RDLYC+LE+DS+R ARS+IRTSTE F WDE F++    +  L  LLYQWDP   HRLCF+G +NL++    F+     ++++ L +EPKG LY E+   +      R Q+    +S+FG PI  +   V    +    P ++  C++E+ERRGLD  G+YRLCG+ K K  LR+  E      D+S+  +PDIH +T +LKDF+RELPEPL T ALYR L+  +   +I  +P  G  +M++I + LP VN+E+L+  +DHL R+A ++D NKMT+ +L+T    LLL PS +     + + + L R     LQY+L  W
Sbjct:  111 EFRPCPSDRSARSL-GPGHPAGIDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDIL---VRREKSGQQVPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLL-DALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMS-HVLQYILDIW 468          
BLAST of Rho GTPase activating protein vs. TrEMBL
Match: A0A267DD13 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033009g1 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.980e-82
Identity = 150/364 (41.21%), Postives = 219/364 (60.16%), Query Frame = 2
Query: 1493 DFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIR-QTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPE-GPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQ-NLIGLARQEIEFLQYLLTQW 2575
            +FR   S+R  + +     P GI G+L V+V+AG  L +     RDLYC+LE+DS+R ARS+IRTSTE F WDE F++    +  L  LLYQWDP   HRLCF+G +NL++    F+     ++++ L +EPKG LY E+   +      R Q+    +S+FG PI  +   V    +    P ++  C++E+ERRGLD  G+YRLCG+ K K  LR+  E      D+S+  +PDIH +T +LKDF+RELPEPL T ALYR L+  +   +I  +P  G  +M++I + LP VN+E+L+  +DHL R+A ++D NKMT+ +L+T    LLL PS +     + + + L R     LQY+L  W
Sbjct:  113 EFRPCPSDRSARSL-GPGHPAGIDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDIL---VRREKSGQQVPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLL-DALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMS-HVLQYILDIW 470          
BLAST of Rho GTPase activating protein vs. TrEMBL
Match: A0A267DXS3 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014851g1 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 9.240e-81
Identity = 150/364 (41.21%), Postives = 219/364 (60.16%), Query Frame = 2
Query: 1493 DFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIR-QTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPM-IMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQ-NLIGLARQEIEFLQYLLTQW 2575
            +FR   S+R  + +     P GI G+L V+V+AG  L +     RDLYC+LE+DS+R ARS+IRTSTE F WDE F++    +  L  LLYQWDP   HRLCF+G +NL++    F+     ++++ L +EPKG LY E+   +      R Q+    +S+FG PI  +   V    +    P ++  C++E+ERRGLD  G+YRLCG+ K K  LR+  E      D+S+  +PDIH +T +LKDF+RELPEPL T ALYR L+  +   +I  +P G   +M++I + LP VN+E+L+  +DHL R+A ++D NKMT+ +L+T    LLL PS +     + + + L R     LQY+L  W
Sbjct:  221 EFRPCPSDRSARSL-GPGHPAGIDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDIL---VRREKSGQQVPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLL-DALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMS-HVLQYILDIW 578          
BLAST of Rho GTPase activating protein vs. TrEMBL
Match: A0A267GUS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g2 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.569e-80
Identity = 151/342 (44.15%), Postives = 215/342 (62.87%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPE-GPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQ-NLIGLARQEIEFLQYLLTQW 2575
            G+ G+L V+VIAG  L SS SL RDLYC+LE+DS R ARSMIRTST+ FEWDE F+I    +  L  LLYQWDP++ HRLCFYG +NL++ +  F+Q    ++K+ L LEPKG LY E+ F      F R+   R + VFG P+  +     S+      P ++  C++E+ERRGL+  G+YRLCG+++ K  +R  L+      D+S+  +PDIH +T VLKDFL ELPEPL T ALYR ++  +    +  +P+ G  +M++I + LP  N+E+L+  +DHL R+A K D+NKMT  +L+T    LLL PS +        ++ L R   + L+Y+L  W
Sbjct:  600 GVDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVHEVFCREPAQR-SGVFGVPLDLLARREKSS-----IPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVRDALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMML-DALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLGRMS-DVLKYILEIW 933          
BLAST of Rho GTPase activating protein vs. TrEMBL
Match: A0A267F832 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g1 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 4.235e-80
Identity = 150/341 (43.99%), Postives = 213/341 (62.46%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPE-GPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQW 2575
            G+ G+L V+VIAG  L SS SL RDLYC+LE+DS R ARSMIRTST+ FEWDE F+I    +  L  LLYQWDP++ HRLCFYG +NL++ +  F+Q    ++K+ L LEPKG LY E+ F      F R+   R   VFG P+  +     S+      P ++  C++E+ERRGL+  G+YRLCG+++ K  +R+ L+      D+S+  +PDIH +T VLKDFL ELPEPL T ALYR ++  +    +  +P+ G  +M++I + LP  N+E+L+  +DHL R+A K D+NKMT  +L+T    LLL PS +        I    +  + L+Y+L  W
Sbjct:  600 GVDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVPDVFCREPAQRIG-VFGVPLDLLARREKSS-----IPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVREALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMML-DALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLDRMSDVLKYILEIW 933          
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:103025539])

HSP 1 Score: 187.193 bits (474), Expect = 6.005e-48
Identity = 122/389 (31.36%), Postives = 203/389 (52.19%), Query Frame = 2
Query: 1526 KPIRSSDQPPG---IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWD--PKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDN--SVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIY-------DNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL----QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWPTIKQKLIFGKSTS 2617
            +P   S+QP     I+G++ ++      L+   +  R +YC +++DS+ KAR+ + T    F + D  F I+L N+  L + L+ W+  P+  +R+C +G + L        +      ++ ++LEP+G++Y+++  +  W+ S     + R+   +VFG  +   R VV    A    P +I  C+ EIERRG   VGLYRLCG+A +K  LR+  E      ++S S  PDI+VIT VLKD+LRELP PL++  LY  ++ S     +        ++P      +++  +LP+V + +L   +DHL R+A  +++NKMT   L+  F  +LL      SC     + +   LA     ++ IE L YLL  WP +  +   GK +S
Sbjct: 1017 RPYNFSEQPKCTAYISGLMSLHFYGAEGLKPPRADSRHVYCAIQVDSVNKARTALLTCRTAFLDMDHTFNIELENAQHLKLALFSWEAVPR-RNRVCCHGTVVLPPLF----RTATRTHQLAVRLEPRGIIYVKLGLMEQWKNSLRGPDSEREGEANVFG--VEAAR-VVEREGAGLMVPLIIEKCITEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHAIELSESNYPDINVITGVLKDYLRELPFPLISKPLYEAVIDSMAKRPLLIGSGGCENDPAESEHTVSLLETLPEVEKMTLRKLLDHLKRVASHHEVNKMTCQNLAVCFGPVLLSQRQDASCHSNRVFVDSEELASALHFKKHIEVLHYLLQLWPVVDAE---GKPSS 1394          
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 144.436 bits (363), Expect = 1.454e-34
Identity = 106/335 (31.64%), Postives = 164/335 (48.96%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+ PG+ G L V + +   L+ S     +LYC LE+DS    + KA++ +   T   +W+E FEI+L  S  L +L Y+           D  +  R+   G I L        Q + G D     +   G+ + L M F + E S  R  + +   VFG  IS +     S       P+++  C+EEIERRG++ VG+YR+ G A     L+   +T + D + M S +  D++ I   LK + RELPEPL T  LY N       SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+P+
Sbjct:  891 KEEDESPGLHGFLNVIIHSASGLKQS----LNLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDP------QMLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRMPSCKQAGVFGVKISTVTKRERSK-----VPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALSDSVAKES---CMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPA 1205          
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 144.436 bits (363), Expect = 1.564e-34
Identity = 106/335 (31.64%), Postives = 164/335 (48.96%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+ PG+ G L V + +   L+ S     +LYC LE+DS    + KA++ +   T   +W+E FEI+L  S  L +L Y+           D  +  R+   G I L        Q + G D     +   G+ + L M F + E S  R  + +   VFG  IS +     S       P+++  C+EEIERRG++ VG+YR+ G A     L+   +T + D + M S +  D++ I   LK + RELPEPL T  LY N       SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+P+
Sbjct:  986 KEEDESPGLHGFLNVIIHSASGLKQS----LNLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDP------QMLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRMPSCKQAGVFGVKISTVTKRERSK-----VPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALSDSVAKES---CMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPA 1300          
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 134.035 bits (336), Expect = 3.880e-33
Identity = 87/255 (34.12%), Postives = 132/255 (51.76%), Query Frame = 2
Query: 1865 KVILQLEPKGLLYLEMAFLN-WELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNL-----VKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLA-----------RQEIEFLQYLLTQWP 2578
            ++ ++LEP+GLLY+++  L  WE    R +     +VFG    ++R +V         P +I  CV EIE RGL  VGLYRLCG+A +K  LR   E       ++  + PDI+VIT +LKD+LRELP  L+T  LY  +     V+ +  +D  ++ +     + + + LP+  R +L + +DHL  +A  +D N MT   L+  F  +LL P+ E       L G +           ++ IE L YLL  WP
Sbjct:   48 QLCVKLEPRGLLYVKLTLLEQWEAPSPRLSELPPPAVFG---VELRRLVEKEQHQLKVPLIIQKCVAEIETRGLKVVGLYRLCGSAAVKKELRDAFEKDSAVVTLNEELYPDINVITGILKDYLRELPSALITRTLYEVVLEAMCVRPAGRND--NDTQRSQSTVALLHCLPEPERATLSFLLDHLSLVASFSDCNLMTCQNLAVCFGPVLLTPTQESWR--AGLPGSSSEGFGASAVDFKRHIEALHYLLQLWP 295          
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 134.806 bits (338), Expect = 1.233e-31
Identity = 103/335 (30.75%), Postives = 162/335 (48.36%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQW----------DPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLET-YHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  ++  G+ G L V V +    + S     +LYC LE+DS    + KA++ +   T   +W+E FEI+L  S  L IL Y+           D +   ++   G + L        Q V   +  +  +E  G+ +   M F + +LS  R  + + + VFG  IS     V +       P+++  C+EE+E+RG+D VG+YR+ G A     L+   +T   D   M S +  DI+ I   LK + RELPEPLLT  LY   ++    SD          M+ +  SLP  N  + +  ++HL R+A+K  INKM++  L+T F   LL+PS
Sbjct:  805 KDDEESSGLYGFLHVIVHSATGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYEKCYDKSKLNKDDNEIVDKIMGKGQVQLDP------QTVQSKNWHVDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKIS-----VVTKRERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN---CMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPS 1119          
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Match: si:ch1073-416j23.1 (si:ch1073-416j23.1 [Source:ZFIN;Acc:ZDB-GENE-100922-35])

HSP 1 Score: 87.4261 bits (215), Expect = 5.597e-18
Identity = 54/150 (36.00%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 2036 PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSS-SVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            P ++  CV+EIERRG+  VGLYR+ G+ +    +++L E +     + + + + ++HV+  +LKDFLR L EPLLT  L+   +K+    +I D       M      LPQ NR++L Y + HL R+A+  +  KM  S LS  F   L+
Sbjct:  363 PSLVLHCVDEIERRGMMEVGLYRIPGSDR---DVKELKERWLRGKGLPALARVDNVHVVCGLLKDFLRSLKEPLLTHRLHHTFLKA---IEISDEDNRAAAMYGAIGQLPQPNRDTLAYLMLHLQRVAESTEC-KMNQSNLSRVFGPTLV 505          
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 84.3445 bits (207), Expect = 7.033e-18
Identity = 50/153 (32.68%), Postives = 82/153 (53.59%), Query Frame = 2
Query: 2036 PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHL--IRLAQKNDINKMTISELSTNFASLLLQP 2488
            P V+ +C+ EIE RGL + GLYR+ G + L   +R   +   +  D+S+    D++VIT  LK + RELP PL+T   Y + V+++  SD  +  E    +     +LP  + ++L   + HL   R++Q+   N M+   LS  F   L++P
Sbjct:  126 PMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERLEQ---LRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRP 275          
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 81.2629 bits (199), Expect = 1.699e-17
Identity = 54/174 (31.03%), Postives = 90/174 (51.72%), Query Frame = 2
Query: 2033 KPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFL 2554
            +P V+ +C++EIE RGL + GLYR+ G ++    ++   +   +  D+S++   DI++IT  LK + R+LP PL+T   Y   +++S   D  +  EG   +      LP  + ESL Y + HL R+   +  N M+   L+  F   L++P  + +    N I   R  IE L
Sbjct:   45 RPMVVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEG---IHEALRLLPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPPEQDVLATLNDIRYQRLVIETL 215          
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003939.1 (pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 gene:ENSPMAG00000003551.1 transcript:ENSPMAT00000003939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 3.466e-17
Identity = 56/153 (36.60%), Postives = 83/153 (54.25%), Query Frame = 2
Query: 2036 PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPD--IHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQP 2488
            PF++   +  IE  GL   G+YR  GA      LRQ L+      D++S  + D  +HVI SVLK +LRELP PL+T  LY   +++     + +  E    + +I   LP VN  +L   I HL+R+AQ  D N+M+ + L+  FA  +L+P
Sbjct: 1130 PFLLEKLLNYIEIHGLYTEGIYRKSGANTKVKELRQQLDN-----DVNSVNLDDYQVHVIGSVLKQWLRELPVPLMTLDLYDEFLRAV---GVPEKKEKIKAVYSIIGQLPSVNYSTLERIIFHLVRIAQYEDTNRMSCNALAIVFAPCILRP 1274          
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.093e-14
Identity = 54/177 (30.51%), Postives = 81/177 (45.76%), Query Frame = 2
Query: 1970 VFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHL-IRLAQKNDINKMTISELSTNFASLLLQPSCE 2497
            VFG P+  +     S       P    L V+ +ER GL   G+YR+ G       LR +++ + +  D+      D+HVIT  LK F RELPEPL     + + + +     I D  E    M  +   LP  NRE++    +HL  R+      N+M++  L+  F   LL+P  E
Sbjct:  411 VFGCPLQTLCEREGS-----AVPNFARLSVQCVERTGLQVDGIYRVSGNLATIQKLRFIVD-HEEKLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINA---IKIKDYAEKIRCMGKLIAILPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTLLRPEQE 578          
BLAST of Rho GTPase activating protein vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 60.8474 bits (146), Expect = 1.065e-9
Identity = 52/177 (29.38%), Postives = 82/177 (46.33%), Query Frame = 2
Query: 1964 NSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPD----IHVITSVLKDFLRELPEPLLTTALYRNL----VKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA 2470
            N +FG P+     V    N     P ++   +EEIE RGLD VGLYR+ G+      L+   +     TD S ++  D    ++ I    K +LRELP+ L + A+  +     +K   H+ +  N E   +M  +   LP    ++L   + HL ++ Q    NKM  S L+  F+
Sbjct: 1962 NKIFGVPL---EDVCERENTL--IPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDE-EGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMV--NEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFS 2130          
BLAST of Rho GTPase activating protein vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 55.0694 bits (131), Expect = 3.158e-8
Identity = 63/229 (27.51%), Postives = 91/229 (39.74%), Query Frame = 2
Query: 1934 SFIRQTNNRDNSVFGRPISQIRSVV-------SSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIP-DIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNP--EGPMI----------MITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNF-ASLLLQPSCEQL-NNYQNLIGLARQEIEFL 2554
            +F    N  D  VFG  + +   V         S N     P VI    + ++   LD  G++R+ G+ K    L+ +     D+          ++H I ++LK +L  L EPL+  ALY          DI+ NP  E P I             I+  LPQ NR  ++Y    L   A+    N M+ S L+     SLL  P  E     Y+     +R  IEFL
Sbjct:   35 TFTNLQNEFDGKVFGVSLEESLKVAQEEVIIQKSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRELQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALY----------DIFRNPILENPKINEHKEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLLSHPKDEMCPKEYE----ASRTVIEFL 249          
BLAST of Rho GTPase activating protein vs. Ensembl Yeast
Match: SAC7 (GTPase activating protein (GAP) for Rho1p; regulator of a Tor2p-mediated, Rho1p GTPase switch that controls organization of the actin cytoskeleton; negative regulator of the RHO1-PKC1-MAPK cell integrity (CWI) and membrane fluidity homeostasis signaling pathways; potential Cdc28p substrate; SAC7 has a paralog, BAG7, that arose from the whole genome duplication [Source:SGD;Acc:S000002797])

HSP 1 Score: 50.0618 bits (118), Expect = 1.595e-6
Identity = 36/136 (26.47%), Postives = 64/136 (47.06%), Query Frame = 2
Query: 1916 FLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNN-------AFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDF-TDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALY---RNLVKS 2290
            F N+   F+   N     VFG  +++  SV S+         +F   P V+  C   ++  GL+  G++R+ G  K    L+ +  +  D+ T  +      +H + S+L+ +L  L EPL+  +LY   RN ++S
Sbjct:  104 FKNYRDMFLSNRNGFTGRVFGVTLAESLSVASAEVIVQSELVSFGRIPIVVAKCGAYLKANGLETSGIFRIAGNGKRVKALQYIFSSPPDYGTKFNDWETYTVHDVASLLRRYLNNLAEPLIPLSLYEQFRNPLRS 239          
BLAST of Rho GTPase activating protein vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 48.521 bits (114), Expect = 5.464e-6
Identity = 44/162 (27.16%), Postives = 78/162 (48.15%), Query Frame = 2
Query: 2078 GLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIP--------DIHVITSVLKDFLRELPEPLLTTALYRNLV----------KSSFHSDIY-DNPEGPMI-------MITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQ 2485
            GL+  GLYR  G+  L   +    E   + +  S ++ P        DIH + SVLK +LR+LP+P+L+ ++Y  L+          +   ++D + D+P+   I       ++ IF  LP  ++E L     H+ ++ + ++ N M +  LS  FA  L+ 
Sbjct:  818 GLNMEGLYRKSGSQTLVEEIEN--EFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIH 977          
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 132.109 bits (331), Expect = 1.740e-31
Identity = 103/337 (30.56%), Postives = 166/337 (49.26%), Query Frame = 2
Query: 1565 GILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEI-----------------FEIDLWNSHFLSILLYQWDPKTHHR--LCFYGGINLLTFIDYFQQNVAGADK--VILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVI---PDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            G+L V+V  G     S     DLYC LE+D     ++KAR+ I  +T    WD+                  F++++  +  L I +Y     T  R   C  G I L       ++++A   K  + + L+ +G + L + +        R+ +     VFG  I      V+S  + D  P ++  CV EIE+RGL+ VG+YRL GA+   + +++L E + D    S+ V+    DIH +  + K +LR+LPEPL T  LY   VK+   +D  +  E    M+ +F SLP  NR +  Y   HL ++A+K++++KM ++ LST F   +L+PS
Sbjct:  460 GVLYVHVQNGKGFHRS-----DLYCTLEVDHFGQFVKKARTKIAKTTGDPVWDQGTGGETLDTCPFINMSQDFDLEVEGTKELRIHVYSKSRYTLQRDEECGLGRIQLR------RESLADLKKRTITIALDKQGAITLSLQYSKTRQGIERKKSVNSVGVFGVDIE----TVTSRESCDI-PLIVIGCVREIEKRGLEEVGIYRLSGAS---SDVKRLKEGF-DENSQSALVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRE---TMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPS 773          
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Match: EDO38242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK1])

HSP 1 Score: 120.939 bits (302), Expect = 2.362e-31
Identity = 68/196 (34.69%), Postives = 110/196 (56.12%), Query Frame = 2
Query: 1898 LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNP--EGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLL 2479
            +++E+ F   +    R  +++ + VFG      R  V+S       P ++  CV EIE+RGL++VGLYR+ G A+ K  LR   +   +  D+S    PDI+VIT +LKD+LRELPEPL+T  +   L K++  ++I D    E   +M  + + LP  NR +L++ ++HL  + +K + NKM    LS   A ++
Sbjct:    1 VHVELEFTELKTLLKRVQSSKKSGVFG-----FRLNVTSELEQSSVPLLVRKCVLEIEKRGLESVGLYRISGNARRKKELRGFFDENSEAVDISEENCPDINVITGILKDYLRELPEPLITEKMTEGLRKAA-KNEIQDKKVDEQKQVMSELLSGLPDPNRHTLVFILNHLRHVMEKKEFNKMDARNLSVCLAPVM 190          
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Match: EDO49053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX5])

HSP 1 Score: 91.2781 bits (225), Expect = 7.262e-19
Identity = 56/150 (37.33%), Postives = 84/150 (56.00%), Query Frame = 2
Query: 2036 PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETY-HDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL 2482
            P ++  C+ EIE+RGL+ VGLYR+ GA +    +++L + + H  T      I DIHV+  VLKDFLR L EPL+T  L+   V ++   D  D+      M    + LPQ NR++L   + HL +++Q  D  KM +S L+  F   L+
Sbjct:  383 PAIVVQCISEIEKRGLNEVGLYRVPGAER---SIKELKDKFLHGKTQNLHETI-DIHVVCGVLKDFLRNLAEPLVTYHLWGAFVNAANKDDDQDSFSA---MYQAVSELPQANRDTLACLVVHLQKVSQCTDC-KMPVSNLARVFGPTLV 524          
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 85.5001 bits (210), Expect = 2.356e-17
Identity = 55/183 (30.05%), Postives = 92/183 (50.27%), Query Frame = 2
Query: 2033 KPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLE--------TYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA-SLLLQPSCEQLNNYQNLIGLARQEIEFL 2554
            +PFV+ +C+ E+E+RGLD+ GLYR+ G A     L+   +         Y D   ++ S   DI+ IT V K + R+LP PL+T   Y   + ++   D +   E    +      LPQ + E++ + + HL R++Q+   N MT   LS  F  +L+  P  + L++  ++    R  +E L
Sbjct:  268 RPFVVDICINEVEKRGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFIAAAKTQDKHLRIEE---LSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAPEGDSLDSLVDM-KFQRLAVELL 446          
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 84.3445 bits (207), Expect = 5.323e-17
Identity = 55/172 (31.98%), Postives = 90/172 (52.33%), Query Frame = 2
Query: 1967 SVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH----DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFA 2470
            SVFG P+ +   V   + AF     V+  C+  +    L   GL+R+ G++     +R+L   +     D T+       D+H IT VLK +LRELPEPL+T ALY + +++   + I D+         + + LP+ N+++L Y I  L +LA  +++NKMT S ++   A
Sbjct:  251 SVFGCPLEEHLKVQRRSIAF-----VLEECLTYLHEEALQEQGLFRMAGSS---GKIRKLKAAFDAGMVDLTEFDC----DVHAITGVLKQYLRELPEPLMTFALYDDWIQA---ASIQDSGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIA 407          
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:101168857])

HSP 1 Score: 196.823 bits (499), Expect = 5.460e-51
Identity = 120/364 (32.97%), Postives = 197/364 (54.12%), Query Frame = 2
Query: 1559 IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVF-EWDEIFEIDLWNSHFLSILLYQWDP-KTHHRLCFYGGINLLTF--IDYFQQNVAGADKVILQLEPKGLLYLEMAFL-NWELSFIRQTN-NRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMI-------MITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLL----QPSCEQLNNYQNLIGLA-----RQEIEFLQYLLTQWPTI 2584
            I+G++ ++      L+      RD+YC +++DS+ KAR+ + T    F + D  F I+L N+  L ++++ W+P    +R+C +G + L +   +  F Q       + ++LEP+GL+Y++++ + +W+ S  R  + +R+  VFG  +   R VV   N     P +I+ C+ EIE+RG   VGLYRLCG+A +K  LR+  E      +++ SV PDI+VIT VLKD+LRELP PL+   LY  +++S     +     G  I        +++   LP+V R +L   ++HL R+A   D+NKMT   L+  F  +LL    + SC     + +   LA     ++ IE L YLL  WP +
Sbjct: 1018 ISGLMSLHFYGAEDLKPPRIDSRDVYCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWEPTPKRNRVCCHGTVVLPSIFRVTRFHQ-------LAVKLEPRGLIYVKLSLIEHWQNSLDRGPDADREPQVFG--VEAWR-VVERENTGLMVPLIISKCINEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSHAVELNESVYPDINVITGVLKDYLRELPFPLINKPLYEAVLESMATKPLKMGAAGCEIEQADSEHTVSLLEHLPEVERMTLRTLLNHLKRVASHQDVNKMTCQNLAVCFGPVLLSQRQEASCHTNRVFIDSEELASALHFKKHIEVLHYLLQLWPVV 1371          
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Match: bcr (breakpoint cluster region protein [Source:NCBI gene;Acc:101174443])

HSP 1 Score: 142.51 bits (358), Expect = 6.200e-34
Identity = 107/335 (31.94%), Postives = 161/335 (48.06%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSM----RKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +   L+ S     +LYC LE+DS      KA++ +   T   +W+E FEI+L  S  L +L Y+           D     R+   G I L        Q++ G D     +   G+ + L M F + E S  R    +   VFG  IS +     S       P+++  C+EEIERRG++ VG+YR+ G A     L+   +T + D + M S +  D++ I   LK + RELPEPL T  LY N       SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+PS
Sbjct:  999 KDEDESSGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYEKCYNKTKQNKEDGDGTDRIMGKGQIPLEP------QSLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRTPTRKPMGVFGVKISSVTKRERSK-----VPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITLSDSVAKES---CMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRPS 1313          
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Match: bcr (breakpoint cluster region protein [Source:NCBI gene;Acc:101174443])

HSP 1 Score: 142.51 bits (358), Expect = 6.218e-34
Identity = 107/335 (31.94%), Postives = 161/335 (48.06%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSM----RKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYH-DFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  D+  G+ G L V V +   L+ S     +LYC LE+DS      KA++ +   T   +W+E FEI+L  S  L +L Y+           D     R+   G I L        Q++ G D     +   G+ + L M F + E S  R    +   VFG  IS +     S       P+++  C+EEIERRG++ VG+YR+ G A     L+   +T + D + M S +  D++ I   LK + RELPEPL T  LY N       SD          M+ +  SLP+ N  + ++ +DHL R+A+K  +NKM++  L+T F   LL+PS
Sbjct:  999 KDEDESSGLYGFLNVIVHSASGLKQS----LNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYEKCYNKTKQNKEDGDGTDRIMGKGQIPLEP------QSLQGKDWQRTVIPMNGIEVKLSMKFTSREFSLKRTPTRKPMGVFGVKISSVTKRERSK-----VPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM--DVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITLSDSVAKES---CMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRPS 1313          
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:101165963])

HSP 1 Score: 140.198 bits (352), Expect = 2.077e-33
Identity = 118/420 (28.10%), Postives = 195/420 (46.43%), Query Frame = 2
Query: 1436 PIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSL-FRDLYCVLEIDSMRKARSMIRT-STEVFEWDEIFEIDLWNSHFLSIL-LYQWDPK------------THHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFL-NWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGP-----MIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNN----------------YQNLIGLA--RQEIEFLQYLLTQWP 2578
            P Q    +   + +P +   FRL        P R S +   + G+L V+++    +++S S   +D++  ++ID   +AR+ + T        +  F ++L  +  L I+ L   +P             T +R+C  GG+++       +     + ++ ++LEP+GLLYL+++    W+   +  T+   N VFG  + Q+   V    +    P +I   V EIERRGL  VGLYRLCG+A +K  LR   E       +S  + PDI+V+T +LKD+LRELP PL+T  LY+ + ++         PE P        + + + LP   R +L   +DHL  +A  +  N+MT   L+  F  +LL P+ E                     + + G    ++ IE L YLL  WP
Sbjct:  395 PRQQAPQVSSPQEVPCDVSSFRLYLG---ADPPRCSQR---VTGLLTVHLLGLEDMKTSRSENSKDIFVAIQIDGATRARTALLTLKGSSLTLNHTFHLELERARQLRIVVLTPANPAAGGHQPATSGGPTRNRVCCLGGVSIPPLFKGSR-----SQQLCVKLEPRGLLYLKLSLQEKWDTQPMGDTSTPAN-VFGIELHQL---VEKEESAVPVPLLIQKTVAEIERRGLKVVGLYRLCGSAAVKKELRDWFERNSSAVRLSEDLYPDINVVTGILKDYLRELPSPLITRTLYQVVREAMAIRTAPSPPESPDPQLSRSTVGLLSCLPTPERATLSLLLDHLSLVASFSSFNRMTHQNLAVCFGPVLLTPTQEAWKTGGGGRAGKGAGKGFGPGEEMNGAVDFKRHIEALHYLLQLWP 799          
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 135.576 bits (340), Expect = 6.103e-32
Identity = 103/335 (30.75%), Postives = 163/335 (48.66%), Query Frame = 2
Query: 1535 RSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS----MRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQ----------WDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGL-LYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLET-YHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPS 2491
            +  ++  G+ G L V V +    + S     +LYC LE+DS    + KA++ +   T    W+E FEI+L  S +L IL Y+           D +   ++   G + L        Q V   +  +  +E  G+ +   M F + +LS  R  + + + VFG  IS +     S       P+++  C+EE+E+RG+D VG+YR+ G A     L+   +T   D   M S +  DI+ I   LK + RELPEPLLT  LY   ++    SD          M+ +  SLP+ N  + +  +DHL R+A+K  +NKM++  L+T F   LL+PS
Sbjct:  729 KDDEESSGLYGFLHVIVHSAKGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDP------QTVQSKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKRERSK-----VPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKLAFDTNTKDILMMLSDM--DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN---CMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRPS 1043          
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Match: SMESG000039887.1 (SMESG000039887.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 431/441 (97.73%), Postives = 435/441 (98.64%), Query Frame = 2
Query: 1268 FQYFTXXXXXXXXXXEKNCATDMVMSSTHGTQSNEQSVGNNLYNSLVISEPKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPTIKQ 2590
            F  F   + +KKQQIEKNCATDMVMSSTHGTQSNEQSVGNNLYNSLVISEPKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDS+RKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPTIK+
Sbjct:  487 FSVFYNNENEKKQQIEKNCATDMVMSSTHGTQSNEQSVGNNLYNSLVISEPKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSIRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPTIKR 927          

HSP 2 Score: 479.174 bits (1232), Expect = 0.000e+0
Identity = 252/259 (97.30%), Postives = 254/259 (98.07%), Query Frame = 2
Query:    2 GNPSDSSLMHLQPGDQILSVNGFNLNTYPSLDSIVTLMSKASSLTLKLARWKSSTIVNDENFCTDSGRENINAEFNWPNCEKKSLIFPSNQGRESTNKRMSLFFDEDKNLNTVXXXXXXXXXXXXXXXXXXXXLVHDSLFQNPSMKRTQVENPFDEPSLVNRNLDIRRLQLEQPSADDSNDSGLSSENSHNSRDMFCPRYNDLANHPYIQGVYQKQNIQQRKLQNFNEQTNRNYLPPAVYDTGSKFDLRCPLNIILTPK 778
            GNP DSSLMHLQPGDQILSVNGFNLNTYPSLDSIVTLMSKASSLTLKLARWKSSTIVNDENFCTDSGRENINAEFNWPNCEKKSLIFPSNQGRESTNKRMSLFFDEDKNLNTVENNNYNASENNIEISNSSPELVHDSLFQNPSMKRTQVENPFDEPSLVNRNLDIRRLQLEQPSADDSNDSGLSSENSHNSRDMFCPRYNDLANHPYIQGVYQKQNIQQRKLQNFNEQTNRNYLPPAVYDTGSKFDLRCPL   + P+
Sbjct:   65 GNPFDSSLMHLQPGDQILSVNGFNLNTYPSLDSIVTLMSKASSLTLKLARWKSSTIVNDENFCTDSGRENINAEFNWPNCEKKSLIFPSNQGRESTNKRMSLFFDEDKNLNTVENNNYNASENNIEISNSSPELVHDSLFQNPSMKRTQVENPFDEPSLVNRNLDIRRLQLEQPSADDSNDSGLSSENSHNSRDMFCPRYNDLANHPYIQGVYQKQNIQQRKLQNFNEQTNRNYLPPAVYDTGSKFDLRCPLKYYINPQ 323          

HSP 3 Score: 320.472 bits (820), Expect = 0.000e+0
Identity = 174/177 (98.31%), Postives = 176/177 (99.44%), Query Frame = 1
Query:  751 PTEYYINPQNNFHSTQTNIFPLLSSRENNFKPIHLVNQHFPRKQTCSNPIPPLVPREDKSTQCCRLDLANAPSTNSCYKRYPLDYNSDSEIAAYENTNEYYLSSTDKYNSINRTASLRNSNFFQRNTARSNRNSLTDENMQDFQSSGNNFKKPSVNYXXXXXXXXXXXXXXXXXVFY 1281
            P +YYINPQNNFHSTQTNIFPLLSSRENNFKPIHLVNQHFPRKQTCSNPIPPLVPREDKSTQCCRLDLANAPSTNSCYKRYPLDYNSDSEIAAYENTNEYYLSSTDKYNSINRTASLRNSNFFQRNTARSNRNSLTDENMQDFQSSGN+FKKPSVNYRSSSKDSSSLRKSKDFSVFY
Sbjct:  315 PLKYYINPQNNFHSTQTNIFPLLSSRENNFKPIHLVNQHFPRKQTCSNPIPPLVPREDKSTQCCRLDLANAPSTNSCYKRYPLDYNSDSEIAAYENTNEYYLSSTDKYNSINRTASLRNSNFFQRNTARSNRNSLTDENMQDFQSSGNSFKKPSVNYRSSSKDSSSLRKSKDFSVFY 491          
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Match: SMESG000017186.1 (SMESG000017186.1)

HSP 1 Score: 320.472 bits (820), Expect = 2.268e-92
Identity = 162/403 (40.20%), Postives = 252/403 (62.53%), Query Frame = 2
Query: 1409 ISEPKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPG-------IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIR-QTNNRDNSVFGRP----ISQIRSVVSSNNAFDCK-PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWP 2578
            + +P  P     + G   + R  PNE   FR +Q+E+W   + S   P         ++G+LV++V+AG  L SS ++ RDLYCVLEIDS+R+ARSMIRTSTE+FEWDEIFE+D+ ++ +L+ L YQWDP+  HRLCFYG + L   I+ F+ +   ++K+ L LEPKG+L++E+ +L     F R +     +++FG P    +S+  +     +  +C+ P ++  C EE+E+RGLD V +YRL GA KLK  +R++LE      D+S+  +PDIH IT+VL+DFLRELPEPL T ALYR ++ +   S   DN  G  +M+ I + LP VN++++++ +DHL R++ ++++NKMT   L+ +   +L  PS E+       +   +++ + L Y+L  WP
Sbjct:  761 LRQPSRPKDQQMDHGQQSVSRLDPNE---FRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAKKLDKSLLDPKKQAQTLLYILNIWP 1160          
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Match: SMESG000037897.1 (SMESG000037897.1)

HSP 1 Score: 305.064 bits (780), Expect = 3.635e-90
Identity = 158/347 (45.53%), Postives = 225/347 (64.84%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDN--SVFGRPISQIRSVVSSNNAFDCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLL--ETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKS-SFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPT 2581
            G +G+LV+++IAG  L SSHS+ +DLYCV+E D++RKARSMIRTSTE FEWDE+FEI++ N+  LSILLYQWDP+  HRLC++G + L + I++++      +K+ LQLEPKG+LYLE+ FLN E +F R  N   N  S+FGR    ++ ++    +    P ++ +CV+EI  RG + VG+YRL G+ KLK  L+ +   E YH   ++SS  +PDIH ITSVLKDFLRELPEPL T A Y+ +V +   H     N  G  +M+ I + LP  N+  L++ IDHL+++  K++ NKM +  LS  F  LL  PS E  +     I     + E  Q+++T WP+
Sbjct:  292 GFSGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGR---SLKDLIILEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYH--INISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELHKT--SNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPS 631          
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Match: SMESG000069716.1 (SMESG000069716.1)

HSP 1 Score: 117.087 bits (292), Expect = 1.225e-26
Identity = 111/397 (27.96%), Postives = 202/397 (50.88%), Query Frame = 2
Query: 1481 NESKD----FRLLQSERWMK-PIRSSDQPP-GIAGILVVNVIAGCSLQSSH------SLFRDLYCVLEIDSMRKARSMIRTSTEVFE----WDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAF------LNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCKPFVI--TLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHS-DIYDNPEGPMI---MITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWPTIK 2587
            ++SKD    +RLL S R     +++S+Q     +G+++ +++   +LQ         S  R L C ++++S  +    I TS+E+F     WDE F +DL  S+F+SIL+YQ     + RL +YGG+NL+  I+ FQ     +D++ILQLEP+GLLY+++        LN ++ +    + +  S+     S   + +S         +++  +L   E ++R L  V +Y+   +     HL + +     + +     I +IH +TS++   LREL EPL+     + L+    H  +IYD P G ++   ++++F SLP  N+ +++    HL  + Q +  NK T   ++  FA L+ Q   +  N  Q+   L   +I+ ++ LL  W +++
Sbjct:  234 DQSKDLLSSYRLLMSTRDTGFRLKTSNQTDNSFSGVIIFDILRAENLQPGSVVLPISSSIRLLQCTVKMNSDVR----IETSSEIFSDKVIWDERFFVDLRESNFISILIYQSLEGCNKRLSYYGGLNLIELINEFQVQSQYSDQIILQLEPRGLLYIQLGLIYLHELLNKQICYHLSKHTQKPSLHCPRYSNFVTSISD------WIYILRWSLAAAEDKQR-LMTVNIYKTNVSENKIIHLLKHIMNIRQYGNQIQIDI-NIHSVTSLILLCLRELNEPLIPYEFSQRLLIILEHFFNIYD-PNGQLLAGEVLSVFKSLPNQNQMAILELFQHLYLVIQNSSSNKTTCHYIALLFAPLIFQ--FQDPNKCQD--HLVNYQIQLMKSLLDNWASLQ 613          
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 101.293 bits (251), Expect = 1.507e-21
Identity = 81/320 (25.31%), Postives = 143/320 (44.69%), Query Frame = 2
Query: 1556 GIAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSMR----KARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINL-LTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAF-DCKPFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCE 2497
            G++G+LV N+     L      FR  Y  +E+DS      KAR+ + T +   +W+E F+IDL  S  ++IL+Y+      ++    G     L   D+  Q++     ++     K  L   + +        RQ +     +FG  +  + +     N   +  P +I  C + IE  GLD  G+YR+ G+      L + L     +  +S+    D+H IT ++K +LRELPEPLL T  Y  +++    + + +  E       +  SLP+ N  ++I+ + H  ++   +  N+M    L       L+ P C+
Sbjct:  590 GVSGVLVTNIFKVDGLNPD---FR-YYLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEASLKYEAKNELLKRQPSIMKTGLFGFSLKSVVTREKKGNVLVENVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYA-ISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQI---AKLEEEVERFSRYNEVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMPPCD 901          
The following BLAST results are available for this feature:
BLAST of Rho GTPase activating protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE22.732e-5031.94synapse defective Rho GTPase homolog 2 [Source:HGN... [more]
SYDE12.433e-3832.42synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
SYDE12.448e-3832.72synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
BCR2.389e-3431.07BCR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
ABR2.498e-3230.43ABR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd-11.729e-4732.37Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-19.771e-4732.37Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-11.057e-4632.37Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
pac-15.555e-1531.95GTPase-activating protein pac-1 [Source:UniProtKB... [more]
pac-15.874e-1531.95GTPase-activating protein pac-1 [Source:UniProtKB... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP100F2.878e-5835.65gene:FBgn0039883 transcript:FBtr0343538[more]
RhoGAP100F3.275e-5835.65gene:FBgn0039883 transcript:FBtr0304594[more]
RhoGAP100F3.449e-5835.65gene:FBgn0039883 transcript:FBtr0304595[more]
RhoGAP100F3.453e-5835.65gene:FBgn0039883 transcript:FBtr0309829[more]
RhoGAP100F3.545e-5835.65gene:FBgn0039883 transcript:FBtr0302180[more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE27.605e-4830.65synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
SYDE12.233e-3927.63synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
bcr1.403e-3331.34BCR activator of RhoGEF and GTPase [Source:ZFIN;Ac... [more]
si:dkey-91m11.52.939e-3331.93si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.52.988e-3331.63si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il64.239e-5031.98interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
il64.451e-5031.98interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
bcr4.632e-3330.77BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr4.946e-3331.60BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr2.603e-3231.21BCR, RhoGEF and GTPase activating protein [Source:... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syde21.115e-4830.89synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde21.221e-4830.89synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde23.876e-4830.89synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde12.042e-4032.64synapse defective 1, Rho GTPase, homolog 1 (C. ele... [more]
Bcr5.123e-3529.94BCR activator of RhoGEF and GTPase [Source:MGI Sym... [more]
back to top
BLAST of Rho GTPase activating protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V9S7|SYDE_DROME3.867e-5735.65Rho GTPase-activating protein 100F OS=Drosophila m... [more]
sp|Q5VT97|SYDE2_HUMAN1.312e-4931.94Rho GTPase-activating protein SYDE2 OS=Homo sapien... [more]
sp|Q61CA4|SYD1_CAEBR9.097e-4732.89Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|Q86NH1|SYD1_CAEEL1.243e-4532.37Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|D3ZZN9|SYDE1_RAT2.015e-3932.93Rho GTPase-activating protein SYDE1 OS=Rattus norv... [more]
back to top
BLAST of Rho GTPase activating protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G9H24.718e-8241.21Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267DD134.980e-8241.21Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267DXS39.240e-8141.21Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267GUS31.569e-8044.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F8324.235e-8043.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE26.005e-4831.36synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
bcr1.454e-3431.64BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
bcr1.564e-3431.64BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
SYDE13.880e-3334.12synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
ABR1.233e-3130.75ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-416j23.15.597e-1836.00si:ch1073-416j23.1 [Source:ZFIN;Acc:ZDB-GENE-10092... [more]
chn27.033e-1832.68chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
chn21.699e-1731.03chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
ENSPMAT00000003939.13.466e-1736.60pep scaffold:Pmarinus_7.0:GL477112:28457:91290:-1 ... [more]
ENSPMAT00000004494.12.093e-1430.51pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
BEM21.065e-929.38Rho GTPase activating protein (RhoGAP); involved i... [more]
BAG73.158e-827.51Rho GTPase activating protein (RhoGAP); stimulates... [more]
SAC71.595e-626.47GTPase activating protein (GAP) for Rho1p; regulat... [more]
RGA25.464e-627.16GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474411.740e-3130.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382422.362e-3134.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490537.262e-1937.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421762.356e-1730.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479955.323e-1731.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase activating protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE25.460e-5132.97synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
bcr6.200e-3431.94breakpoint cluster region protein [Source:NCBI gen... [more]
bcr6.218e-3431.94breakpoint cluster region protein [Source:NCBI gen... [more]
SYDE12.077e-3328.10synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
ABR6.103e-3230.75ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase activating protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039887.10.000e+097.73SMESG000039887.1[more]
SMESG000017186.12.268e-9240.20SMESG000017186.1[more]
SMESG000037897.13.635e-9045.53SMESG000037897.1[more]
SMESG000069716.11.225e-2627.96SMESG000069716.1[more]
SMESG000025211.11.507e-2125.31SMESG000025211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033957 ID=SMED30033957|Name=Rho GTPase activating protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2891bp
TGGAAATCCCTCTGATTCTTCTTTAATGCACTTGCAACCGGGAGATCAGA
TTCTGTCGGTGAATGGATTCAACCTGAATACATATCCCTCTCTTGATTCC
ATAGTCACATTGATGTCAAAGGCCTCATCATTAACTTTGAAACTAGCCCG
ATGGAAGTCCTCGACAATTGTCAATGATGAAAATTTCTGCACCGATTCAG
GTAGAGAAAACATAAACGCAGAATTCAATTGGCCAAATTGCGAGAAGAAA
AGTTTAATTTTTCCATCAAATCAAGGCAGAGAATCGACTAACAAACGAAT
GTCATTGTTTTTTGATGAAGACAAAAACTTGAATACCGTGGAAAACAATA
ACTATAATGCCAGTGAAAACAATATAGAAATATCTAATTCGTCTCCTGAG
TTGGTCCATGATTCTCTATTTCAAAACCCATCGATGAAGCGAACACAAGT
CGAAAACCCATTTGATGAGCCTTCTTTAGTCAATCGTAATTTGGATATTC
GTCGATTGCAACTTGAACAACCGTCGGCCGATGATTCGAATGATAGTGGA
TTATCAAGCGAGAATTCTCACAATTCCCGAGACATGTTTTGTCCTCGATA
CAACGATCTCGCAAATCATCCATATATCCAAGGCGTATATCAAAAGCAAA
ATATTCAACAGAGAAAACTACAGAACTTTAACGAACAAACTAATCGTAAC
TATCTGCCTCCTGCTGTTTACGACACGGGTAGTAAATTCGACCTTCGTTG
CCCACTGAATATTATATTAACCCCCAAAACAATTTCCATTCGACACAGAC
AAATATTTTCCCATTATTGTCGTCGAGAGAAAATAATTTCAAACCGATAC
ATTTGGTCAATCAACATTTTCCAAGAAAACAAACTTGCTCAAATCCCATT
CCTCCTTTGGTTCCACGAGAAGACAAGTCTACCCAATGCTGTCGTTTAGA
TCTTGCAAATGCTCCTTCTACCAATTCTTGTTACAAAAGATATCCTTTGG
ATTATAATTCCGATTCAGAAATCGCTGCCTATGAAAATACAAATGAGTAT
TATTTATCATCAACGGACAAATATAACTCAATTAATAGAACTGCTTCTTT
GAGGAATTCTAATTTCTTTCAAAGAAATACTGCCCGTTCAAATAGAAATA
GTTTAACCGACGAAAATATGCAAGATTTTCAATCATCTGGAAACAATTTC
AAAAAGCCTTCCGTAAATTACAGATCCTCGAGCAAGGATTCAAGTTCATT
GAGAAAATCAAAAGATTTTTCAGTATTTTACAATAATGAAAATGAAAAAA
AAACAACAAATTGAGAAAAACTGTGCAACTGATATGGTAATGAGTTCAAC
TCATGGAACACAATCAAATGAACAAAGTGTGGGTAATAACCTATATAATT
CTTTAGTAATATCAGAACCAAAATTCCCTGCTCCTCCTATACAAAATACT
GGTTCTTTGTTAATGGAAAGATACATTCCAAATGAGAGTAAAGATTTCAG
ATTGCTTCAATCTGAAAGATGGATGAAACCTATCAGAAGTTCAGACCAAC
CTCCAGGAATAGCAGGAATTCTTGTTGTTAATGTTATTGCAGGGTGCTCT
CTTCAGTCCAGTCATTCTTTATTCCGAGATTTGTATTGTGTTTTAGAAAT
CGATTCAATGAGAAAAGCTAGATCAATGATTAGAACTAGCACAGAAGTCT
TTGAATGGGATGAAATATTTGAAATAGACCTTTGGAACAGTCATTTTCTT
TCCATTCTTCTTTATCAATGGGACCCAAAAACCCATCACAGGTTGTGTTT
CTACGGAGGAATCAACCTTTTGACTTTTATTGACTATTTTCAACAAAATG
TTGCCGGTGCTGATAAAGTAATTTTACAGTTAGAGCCAAAAGGTCTTTTG
TATTTAGAAATGGCTTTTTTAAATTGGGAGCTTTCATTTATTCGTCAAAC
AAACAATAGGGACAATTCCGTTTTTGGTCGACCAATAAGTCAAATACGAT
CGGTTGTATCCTCAAATAATGCATTTGACTGCAAGCCTTTTGTAATTACA
TTGTGCGTGGAAGAGATCGAAAGACGGGGTCTTGACAACGTCGGATTGTA
TCGGTTGTGCGGGGCGGCAAAACTTAAAGCACATCTTCGACAATTGTTGG
AAACTTACCATGATTTTACAGATATGTCAAGCAGTGTAATACCCGACATT
CACGTTATTACTTCAGTTTTGAAGGACTTTCTACGAGAATTGCCGGAGCC
ATTATTGACCACAGCATTGTACAGAAATCTTGTGAAATCTTCCTTTCATT
CTGATATTTATGACAATCCGGAAGGACCTATGATTATGATTACTATATTC
AATTCACTGCCTCAAGTTAACAGAGAATCTTTGATTTATTTCATAGACCA
TTTAATCAGACTTGCTCAAAAGAACGATATAAATAAAATGACAATTTCCG
AACTGTCAACCAACTTCGCATCATTACTTTTGCAACCATCTTGCGAACAA
TTGAATAATTATCAAAATTTGATTGGTTTAGCCCGGCAAGAAATAGAATT
TTTGCAGTATCTCCTCACTCAATGGCCAACCATCAAACAGAAATTGATTT
TTGGGAAATCTACCTCAAACCAAAGGAAGACAGCCTCAAGCTCCAATGTG
AATAATGCCAGCAGCTGCTCGATAGCCATTCAAACGTCAGATGATAGTCA
TTCTAACAAGACTCAAACAAGGAACTGTAATTCTTCAACACCAAAGAAAT
CACTGTCCACCAGCCAAACGCATCAGAATAAATCTATTTTACGGAATTCC
TCTTCGAGGGCTACCGGATTTTATAATCGGTCATTGCATGACACATCAAA
TGATGAACTCCTTTAAAATGATGGATGCAAAGCGAAAATAT
back to top

protein sequence of SMED30033957-orf-1

>SMED30033957-orf-1 ID=SMED30033957-orf-1|Name=SMED30033957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
GNPSDSSLMHLQPGDQILSVNGFNLNTYPSLDSIVTLMSKASSLTLKLAR
WKSSTIVNDENFCTDSGRENINAEFNWPNCEKKSLIFPSNQGRESTNKRM
SLFFDEDKNLNTVENNNYNASENNIEISNSSPELVHDSLFQNPSMKRTQV
ENPFDEPSLVNRNLDIRRLQLEQPSADDSNDSGLSSENSHNSRDMFCPRY
NDLANHPYIQGVYQKQNIQQRKLQNFNEQTNRNYLPPAVYDTGSKFDLRC
PLNIILTPKTISIRHRQIFSHYCRREKIISNRYIWSINIFQENKLAQIPF
LLWFHEKTSLPNAVV*
back to top

protein sequence of SMED30033957-orf-2

>SMED30033957-orf-2 ID=SMED30033957-orf-2|Name=SMED30033957-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MKMKKKQQIEKNCATDMVMSSTHGTQSNEQSVGNNLYNSLVISEPKFPAP
PIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPGIAGILVVNV
IAGCSLQSSHSLFRDLYCVLEIDSMRKARSMIRTSTEVFEWDEIFEIDLW
NSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLE
PKGLLYLEMAFLNWELSFIRQTNNRDNSVFGRPISQIRSVVSSNNAFDCK
PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSS
VIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMI
MITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQ
PSCEQLNNYQNLIGLARQEIEFLQYLLTQWPTIKQKLIFGKSTSNQRKTA
SSSNVNNASSCSIAIQTSDDSHSNKTQTRNCNSSTPKKSLSTSQTHQNKS
ILRNSSSRATGFYNRSLHDTSNDELL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
IPR000198RhoGAP_dom
IPR000008C2_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 3..64
e-value: 3.7E-5
score: 25.6
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 11..53
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 172..191
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..191
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1..52
score: 10.396