Fmp27_GFWDK domain-containing protein

Overview
NameFmp27_GFWDK domain-containing protein
Smed IDSMED30033936
Length (bp)7561
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fmp27_GFWDK domain-containing protein (SMED30033936) t-SNE clustered cells

Violin plots show distribution of expression levels for Fmp27_GFWDK domain-containing protein (SMED30033936) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fmp27_GFWDK domain-containing protein (SMED30033936) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fmp27_GFWDK domain-containing protein (SMED30033936) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033936

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033936SMESG000004754.1 SMESG000004753.1 dd_Smed_v4_7673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033936SMESG000016307.1 SMESG000004753.1 OX_Smed_1.0.21649ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Human
Match: KIAA0100 (KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960])

HSP 1 Score: 555.058 bits (1429), Expect = 2.118e-161
Identity = 411/1371 (29.98%), Postives = 681/1371 (49.67%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDE---ISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKA 6259
            NR W +    V + FPY+Y F++   + + ++K++K +H        +    S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ +  ++ +D  SPFP E +     WCRM+  N  S+  ++R+Y + L+ ++D  + GRLV  EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V +G+L I  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S+WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R    SN+T       S+   DPT  +         H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q                    P K+    V   +++   +   NT S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    +  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP  LE  E   +    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    + E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +S +    G  L + L    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG++
Sbjct:  671 NRVWLLSFGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHQG------TRAWASPSPVPLPPDLLLKVEHFSWVFLDDVFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVVEQVQELDPGSPFPPEGLDLVIQWCRMLKCNVKSFLVRIRDYPRYLFEIRDWRLMGRLVGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFKGDLDINVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILLYSSTLRWMQNFWATWTSVTRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISDWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLVTKTHLLSLSSLTYQR---HSNRTAEEEL--SARDGDPTFHT---------HQLHLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQ-------------------MPAKKPKRGVPTSASAPPRV---NTPSFSGQPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RQRSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVLENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRQLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVVLRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGRS 1891          

HSP 2 Score: 58.5362 bits (140), Expect = 2.265e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1957 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2023          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Human
Match: KIAA0100 (KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960])

HSP 1 Score: 555.058 bits (1429), Expect = 2.323e-161
Identity = 410/1371 (29.91%), Postives = 681/1371 (49.67%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDE---ISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKA 6259
            NR W +    V + FPY+Y F++   + + ++K++K +H        +    S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ +  ++ +D  SPFP E +     WCRM+  N  S+  ++R+Y + L+ ++D  + GRLV  EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V +G+L I  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S+WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R    SN+T       S+   DPT  +         H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q                    P K+    V   +++   +   NT S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    +  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP  LE  E   +    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    + E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K +L   +S +    G  L + L    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG++
Sbjct:  671 NRVWLLSFGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHQG------TRAWASPSPVPLPPDLLLKVEHFSWVFLDDVFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVVEQVQELDPGSPFPPEGLDLVIQWCRMLKCNVKSFLVRIRDYPRYLFEIRDWRLMGRLVGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFKGDLDINVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILLYSSTLRWMQNFWATWTSVTRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISDWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLVTKTHLLSLSSLTYQR---HSNRTAEEEL--SARDGDPTFHT---------HQLHLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQ-------------------MPAKKPKRGVPTSASAPPRV---NTPSFSGQPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RQRSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVLENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRQLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKAILRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGRS 1891          

HSP 2 Score: 58.5362 bits (140), Expect = 2.303e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1957 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2023          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Human
Match: KIAA0100 (KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960])

HSP 1 Score: 554.673 bits (1428), Expect = 1.295e-160
Identity = 411/1371 (29.98%), Postives = 681/1371 (49.67%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDE---ISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKA 6259
            NR W +    V + FPY+Y F++   + + ++K++K +H        +    S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ +  ++ +D  SPFP E +     WCRM+  N  S+  ++R+Y + L+ ++D  + GRLV  EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V +G+L I  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S+WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R    SN+T       S+   DPT  +         H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q                    P K+    V   +++   +   NT S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    +  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP  LE  E   +    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    + E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +S +    G  L + L    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG++
Sbjct:  814 NRVWLLSFGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHQG------TRAWASPSPVPLPPDLLLKVEHFSWVFLDDVFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVVEQVQELDPGSPFPPEGLDLVIQWCRMLKCNVKSFLVRIRDYPRYLFEIRDWRLMGRLVGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFKGDLDINVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILLYSSTLRWMQNFWATWTSVTRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISDWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLVTKTHLLSLSSLTYQR---HSNRTAEEEL--SARDGDPTFHT---------HQLHLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQ-------------------MPAKKPKRGVPTSASAPPRV---NTPSFSGQPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RQRSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVLENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRQLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVVLRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGRS 2034          

HSP 2 Score: 58.5362 bits (140), Expect = 2.264e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2100 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2166          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Human
Match: KIAA0100 (KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960])

HSP 1 Score: 125.176 bits (313), Expect = 1.462e-30
Identity = 89/287 (31.01%), Postives = 145/287 (50.52%), Query Frame = 2
Query: 3152 DPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKC 3997
            DPSPPLPWWDKSRL  HG         DW+  +                   ++    ++V +G+L I  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S+WS+ QM S + + + V L+    E + D C
Sbjct:    1 DPSPPLPWWDKSRLLFHG---------DWHMDI---------------EQANLHQLATEFVFKGDLDINVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILLYSSTLRWMQNFWATWTSVTRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISDWSVTQMVSDLSQ-VTVHLMASPTEENADHC 261          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Celegans
Match: F31C3.3 (pep chromosome:WBcel235:I:15041433:15050700:-1 gene:WBGene00009285.1 transcript:F31C3.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F31C3.3)

HSP 1 Score: 488.034 bits (1255), Expect = 9.360e-140
Identity = 467/1787 (26.13%), Postives = 797/1787 (44.60%), Query Frame = 2
Query: 1286 FHRWESAIFMGNVFV-WVHKNR-------AGCLMNQVQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKES-NLRSQSGSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQ--------KVNVIQLNKTSRELIEIDFKFCGTVYD---MIDENQEFYSTTT--------------DFNDTSTQSPY-FKRVCNINQIKMEFFPSKLA-----LSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTM------KSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQA--IPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQ-YISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQ-SASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSR----NLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQI----EDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ--WL--NTCDVEDQIDNEDLLSG-TPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSY------DRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD---RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK----AEEVDVEKGSDNMSFVK--SESLELRRIVDNTEGVLLGQNI-EMTDLDQ 6394
            +H W   +F+G     W   ++        GC  + V+ EWSD LA   R+I   I  +   + ++ G+E+ NL        +  A +       +  L A  SK  FI          K+ +++     RE  E D      +++   +++E  E +S+ T              +    + Q  + FK+   +N   +EF   K +     +SV    +V   W   +H+ + +A+ ++ K    V+LL    S P+  T+      K HII+   N VE++  +++ + +  + +         + ++ T  + +  + ++I++V+N +       +   Q +     L+ ATN+ W   ADK +   P+ + F Q + + + I K+IK VH  K           E  +A  +P D  I F E  L+L+DD FE +L  +  L  DE  E E+R   ++ +L  L K     ++ E  + +    ++K S+ YI R    +  +  +S   L KW   G ++ + +D   +G E  I+ M+  D  SP PE+  +STLW R +  + D W    ++Y      +KDL+ +G LV AE  S    S R   + +  P+    + +NM  IKF++D      E    YGP WE CL  I++ W  I+  S+DPS PLP+WDK R  LHG+L + S+ +      S DPYN TE     W    ++W   +  ++  L IF R+AS+YD D Q+++ P+++LKI + W C GDP+ H  V  C P  +    +T +HD+Y  FRS      LN D+   S  +  +  P  + Y+N  ++ E+F   +    R +RRG  +      KP L +HF  +    + P++ + YW+S +   G  + +  + L++ F   +       E N+  R   +WS   M        ++ +  +      D  PSE           D F        +    ++Y R      +TF                        P+H +   DLK+ WT  NR+   ++ D      +LR+ LS  A+K + + ++  S  DT  +    + E+                                              +TH  G S + E++  ML QL+ EV T KL A CE+ S DV + D L GV     +      W ++L NSQ++LK  +   + +V AA+T+L    H  +WK S LL+K S   K+  MQY+A +    +N  +  WL     D + Q D          +    G+AVGG+V +              +P+               ++QLQR++S+CSC +Y+  +      +  + I +P  L P    +   ++  + G   LTL H+ L   +NS QY M+V+I+N+L L+V+P +K   +   R + E  ++   +L+  I              MRY+ EL ++V    + R   LER +  L        +  S C     +  ++     L L +  ++  + T  ++  +++ IS     Q N  K         +   +   EV+RR EVCFE  TW++TE+DGQI L   ++R+F+Y++  R+ + G H FE+ +V++ +L+ +  +K  L  D +       P +R+ + +  PVGGI V E  E+ IAP+V +I+   +  MM FFFPG+     + +D E+     SF +  + +L +R     +E ++L +++ E  D+D+
Sbjct:  420 YHEWGETLFIGAFIAQWKKLSKKNLLDITVGC--DDVKFEWSDQLA---RQIEGVIHGILGAEHSANGEEAGNLCLAVQVSANRLAVLVNATNKSYAALCA--SKLEFITDNWQKDGLLKMEMMRGATGIREDTE-DHVLLADIFESQRVVEEAAEIHSSPTRRWSHLERERVYKEEREKRANQFEFKFKQFITVN--TLEFLIDKQSSVIDKISVFTSSEVFLAWSPQLHLIVFDAYKSVKK---TVQLL----SFPNPSTLTRKVPRKKHIILTAENFVEVQLELARNNRMFWQGEKFRLERLDNQMRMNTEILYVMLNEQRIISVLNPTITVQNSDDLMTQSRSAFATLSSATNKVWIWSADKFMFRLPFNFDFAQIFDEFLQIIKWIKVVHEVK---------KKEFTEASPLPSDVRIEFLEVWLELEDDEFENRLKLSAQLKEDEVYESERREQLLEERLFNLKKTAPFLSK-EMIEAIKNSLIEKNSEIYIER---WKMTEVSDSPLFLSKW--KGWNMRAFADVTLHGTEKCIQMMKAFDPLSPIPEQ-NYSTLWARAVEFDVDEWTVTFKDYPMKYLDIKDLHFFGTLVAAESLSEDGRSLRECVIPLPEPFPTHSVWKNMSPIKFYYDLQCASTEYNCTYGPCWEPCLSMISLVWNNISAPSKDPSQPLPFWDKMRFLLHGKLLWSSEKLVTTMLASTDPYNETETVEMLWEDFGLDWALGEIRIKSGLKIFLRTASRYD-DSQILSLPDVRLKILLGWECGGDPHEHHGVQLCSPQRLPHYSSTEEHDSYRQFRSSCVNVTLNFDVSPGSCTSKDKM-PNLLLYSNTFRWIEQFLKSLTTKNRNVRRGTVFGNRVLLKPQLSKHFGKLQFSFSLPKVLVTYWMSHSSPYGFQVFSDGLQLTSSFRQTVSHSSVNREMNVQRRKVYSWSTHHMTCTWW-ATQIHVYGETSRPPTDGSPSE-----------DTF-------LLGFGRVQYAR------ETFPGKDV-------------------PLHKVTAFDLKMAWTAQNRDACLTIADGVHRAHMLRRILSNDAVKRLNVHLEEAS--DTPKDPSPKKKEE----------------------------------------------KTHRRGYS-VTEANPWMLTQLIDEVGT-KLVAHCEQAS-DVPI-DSLLGVHQSTMDDVKLLNWQIDLFNSQLVLKGCERDGFLLVCAAKTQLLQNFHRNVWKRSLLLSKKSWSAKISGMQYFAPISATGTNKEKFRWLPREMIDEKSQQDTSGFADDFVQKFTAAGEAVGGVVQS-------------EAPDESEE-----------KVQLQRIVSRCSCQIYFCYFSDELKTESNEDISVPPQLDP----KHQSLNPDAVGIDVLTLKHNMLEATSNSEQYEMVVDIVNNLALFVDPYKKEMGEKRRRLRFECQIMEMVELRAKI--------------MRYQSELREIV---SLGRF--LERQLFYLSNGNSNSMNG-SHC-----EQPVEYTEDQLVLEAEDTKQRMLTVSEK--LATYISCYKQRQVNRVK------EFDEKSAKKGMEVVRRFEVCFEDCTWKLTESDGQIALAQTQIRNFLYTRTVRDSNCGDHLFEVGSVRITNLLPDSIYKHALHRDETRLSR--QPAIRLFVRDMPPVGGISVKEHFELNIAPMVAEITHRLFDKMMRFFFPGRNIHTNDNLDHEEEVSTFSFTRKIASTLSMRSNKSASEKLMLQKSLHEKDDIDR 2012          

HSP 2 Score: 52.373 bits (124), Expect = 6.994e-6
Identity = 27/70 (38.57%), Postives = 38/70 (54.29%), Query Frame = 2
Query: 6911 KDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            KD +  M ERA +   F+Y+KI      +SY+G K K    +N F       EYH + WTWLDL + +K+
Sbjct: 2007 KDDIDRMKERADKVNHFMYIKIPEVSFVVSYKGNKDKNLIDVNQFNFIFPLCEYHEQNWTWLDLALAVKQ 2076          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Fly
Match: hob (gene:FBgn0035420 transcript:FBtr0346807)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 482/1584 (30.43%), Postives = 790/1584 (49.87%), Query Frame = 2
Query: 1709 TDFNDTSTQSPYFKRVCNINQIKMEFFPSKLA-LSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIELGNG----VELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKY-IFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKL------VKNGGIYTEVEYRKCLYQLDLQKQSQ-YISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPER-ITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDP----AHVTTTDHDTYYFFRSRNLNL----DIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNIS-----QWLNTCDVEDQIDNEDLLSGTPEV---VGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGR---IQLQRMISKCSCMVYYVSY-DRADPIGLPQHLIPPLPLEEDEI--SHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD---RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCI-AIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGP------VLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK-AEEVDVEKGSDNMSFVKSES 6316
            TDF+D           C + +++ E     +  LS++    ++  W++++HM L     ++  + T + +     S   + T K   I+EL        E+KF  S  H I +  + + F   ++R  I   NV +  D + I TV     + V       Q+++        +N+ W          FPY +  +N    +  S  K++K VH+ K            V   +P D +I  KEF L++ DDPFE +L DNY+LL DE  E  KR      ++ +L      + +G I       + LY   ++K S+ YI R  S + R++      L  W ++ +++M+++D+  +G  N  R MR ID +SP+PE  + FSTLWCR ++++   W F +R++ + ++ +K + ++G L  AEQ  S+ +KR V ++V  P+   +I+R+MP++KF+HDF  ++   +  +G  WE  +   N+S+E I+  S+DPSPPLP+WDK RL LHGRL  ++         SLDPYN TE     WN   +   N K + +GEL +  R+AS+YD DC+L+ +PNL+L I + W+C  +PN+H AV PC P     + +   HD++  FRS NLN+    + +  + E    + P  + Y + L++FE  +  +  V RP RRG  +N  R +K  L RH++  N+++   +  ++YW+S A + G  +    +S S++  L L  I+D L HRP+++WS + M  ++    ++WL     E  D    SE   S       D F +  R+ F+ ++ + Y R      +    T+  S      T+  +  Q   P H L + DLK  WT++NR++ +++ D +     L+ NLS +A+KS +                     +E P   V  L  +RS+S I L   N   L +S           N + +     +QI  +   MLQQL+ E D  K   + ++ S     + +L G+  C +   I   W + L+NSQV+LK  ++S Y I+SAA+  +   EH P+W++  L++K++  G LECMQYYATV   ++N        WL   +++D+  +E +++  P++   VG G++VGG+V+  VG                     +  SDN G    +QLQR++SKC C  +YVSY D  DP  + +  +PP P EE +       +     TL+H +L+  TNSLQY MI++I+N+L+LYVEP+RK   +   R + +  L S E  K  I + Q  +R+L          L K+   E+   +   ERI      ++ ++   + Q I    +++   S+  D+ L        L   + Q    S ISN  + +  +                    ++R NE+CF+ A WR+TE DGQIG+ D+ L  F+Y+K ++ DDS  H  EL  +++E+L+    +++VL+   ++E+    P      VLRI   E+ PVGGI V E  EI +AP+ + I+K FY TM+ F FP + A E +V    D+ +   S S
Sbjct:  697 TDFSDVFA-------TCKMIRLEHEQVEGTMGKLSIYIPGNMEATWNSNLHMHLLTLVRDMQDLKTELAI---PASSVKKTTPKEGFIVELSAERSTIFEIKF--SDRHSIQIFVESLFFS-QKERCIIYAENVFVKIDDQHIFTVKELDLQSVPRLEVLTQERQNFPGFQLPSNKVWVTTIGSFKAIFPYDHDFYNAVNGECTSHFKWLKMVHNYKKKP-------FTVDSPLPCDLVIKIKEFLLEISDDPFEVKLRDNYVLLVDEYLESLKRKALFDKKIGELCSERLLLPSGTI-------EGLYANLVKKNSEIYIQR--SKKIRESGPVRTRLLAWIMTDVNIMAMADTSIHGYNNVTRIMREIDHESPWPEEGLEFSTLWCRGVNISCTEWKFMLRDFPQPMFCVKSMRLYGNLCGAEQMGSKRAKRDVFIDVGEPFGTDVIQRSMPSLKFYHDFDCELESCSYAFGACWEPVMAQCNLSFEKISAPSKDPSPPLPFWDKLRLLLHGRLTLIAKQFTILLHASLDPYNTTEEMELTWNNCGIVLTNAKIMFKGELNVTVRTASRYD-DCRLLHFPNLKLTIKLKWVCLANPNDHHAVMPCAPDKLPEYSSNQVHDSFRAFRSLNLNIWISFETKPKAGEDLEVDIPSLVLYGSTLRWFESLQLILSGVTRPTRRGPVFNNVRPRKKPLSRHYKKANLQMCLHKFQVLYWMSHALQKGFQLNGRRVSFSSEHSLTLNPIDDGLIHRPRADWSTIYMNCELNDA-EIWLKSILTEKMDSS--SENLASAA-----DAF-KIVRFYFLSVAKVSYGR------EALIPTTATS------TEEDVKAQSTTPTHKLVVYDLKGAWTKSNRDVAFALFDSFMKSQKLKNNLSTEAVKSYR---------------------KEGPNSAV--LKHKRSDSTITLSSTNNEVLPIS-----------NPNASMKKAPAQIHAT--AMLQQLIAEAD-HKFNVYSDDHSTQSREL-QLQGLQACSAQDIIHENWSISLVNSQVLLKGCETSGYVIISAAKAEILQREHRPVWRERSLISKTTWKGLLECMQYYATVSAGDNNSLLEKEIMWLTVDNIQDK--DETVINNLPDISHLVGSGRSVGGVVSETVG---------------------AFLSDNSGGAQPVQLQRIVSKCKCEFFYVSYGDAIDPNSITE--VPPPPSEELQSPWEKQDDPVDAFTLMHHDLDVCTNSLQYAMILDIVNNLLLYVEPQRKQAAEKLTRMRFQLQLHSTEDQKRPIQQKQTVIRSL----------LMKIRSLEKDTHMISKERIEDGDSLELRQEYDHVQQMIRESKEELNTFSEDLDMML--------LCYKETQLSQLSKISNVRSDESVT--------------------MVRTNEICFKRAQWRLTETDGQIGIADLVLSAFLYTKKSKSDDSVEHLLELGNIRMENLLPREIYRDVLL---ATEIQKDMPVDTHKRVLRIFCREKAPVGGISVKEHFEINVAPITIAITKKFYSTMLKFCFPDRDASETEVSDELDDNASTSSAS 2125          

HSP 2 Score: 72.4034 bits (176), Expect = 7.127e-12
Identity = 32/71 (45.07%), Postives = 50/71 (70.42%), Query Frame = 2
Query: 6905 VSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIK 7114
            + KD ++ M ERA++N +F+Y+KI   P+R+SY+G K+K    I +++L I  +EYHN  WTWLDL + +K
Sbjct: 2158 IEKDDVEKMKERAEKNKLFIYIKIPEVPVRVSYKGNKEKNLEDITDYSLVIPTLEYHNVTWTWLDLLLAMK 2228          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Fly
Match: hob (gene:FBgn0035420 transcript:FBtr0302302)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 482/1584 (30.43%), Postives = 790/1584 (49.87%), Query Frame = 2
Query: 1709 TDFNDTSTQSPYFKRVCNINQIKMEFFPSKLA-LSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIELGNG----VELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKY-IFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKL------VKNGGIYTEVEYRKCLYQLDLQKQSQ-YISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPER-ITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDP----AHVTTTDHDTYYFFRSRNLNL----DIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNIS-----QWLNTCDVEDQIDNEDLLSGTPEV---VGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGR---IQLQRMISKCSCMVYYVSY-DRADPIGLPQHLIPPLPLEEDEI--SHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD---RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCI-AIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGP------VLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK-AEEVDVEKGSDNMSFVKSES 6316
            TDF+D           C + +++ E     +  LS++    ++  W++++HM L     ++  + T + +     S   + T K   I+EL        E+KF  S  H I +  + + F   ++R  I   NV +  D + I TV     + V       Q+++        +N+ W          FPY +  +N    +  S  K++K VH+ K            V   +P D +I  KEF L++ DDPFE +L DNY+LL DE  E  KR      ++ +L      + +G I       + LY   ++K S+ YI R  S + R++      L  W ++ +++M+++D+  +G  N  R MR ID +SP+PE  + FSTLWCR ++++   W F +R++ + ++ +K + ++G L  AEQ  S+ +KR V ++V  P+   +I+R+MP++KF+HDF  ++   +  +G  WE  +   N+S+E I+  S+DPSPPLP+WDK RL LHGRL  ++         SLDPYN TE     WN   +   N K + +GEL +  R+AS+YD DC+L+ +PNL+L I + W+C  +PN+H AV PC P     + +   HD++  FRS NLN+    + +  + E    + P  + Y + L++FE  +  +  V RP RRG  +N  R +K  L RH++  N+++   +  ++YW+S A + G  +    +S S++  L L  I+D L HRP+++WS + M  ++    ++WL     E  D    SE   S       D F +  R+ F+ ++ + Y R      +    T+  S      T+  +  Q   P H L + DLK  WT++NR++ +++ D +     L+ NLS +A+KS +                     +E P   V  L  +RS+S I L   N   L +S           N + +     +QI  +   MLQQL+ E D  K   + ++ S     + +L G+  C +   I   W + L+NSQV+LK  ++S Y I+SAA+  +   EH P+W++  L++K++  G LECMQYYATV   ++N        WL   +++D+  +E +++  P++   VG G++VGG+V+  VG                     +  SDN G    +QLQR++SKC C  +YVSY D  DP  + +  +PP P EE +       +     TL+H +L+  TNSLQY MI++I+N+L+LYVEP+RK   +   R + +  L S E  K  I + Q  +R+L          L K+   E+   +   ERI      ++ ++   + Q I    +++   S+  D+ L        L   + Q    S ISN  + +  +                    ++R NE+CF+ A WR+TE DGQIG+ D+ L  F+Y+K ++ DDS  H  EL  +++E+L+    +++VL+   ++E+    P      VLRI   E+ PVGGI V E  EI +AP+ + I+K FY TM+ F FP + A E +V    D+ +   S S
Sbjct:  697 TDFSDVFA-------TCKMIRLEHEQVEGTMGKLSIYIPGNMEATWNSNLHMHLLTLVRDMQDLKTELAI---PASSVKKTTPKEGFIVELSAERSTIFEIKF--SDRHSIQIFVESLFFS-QKERCIIYAENVFVKIDDQHIFTVKELDLQSVPRLEVLTQERQNFPGFQLPSNKVWVTTIGSFKAIFPYDHDFYNAVNGECTSHFKWLKMVHNYKKKP-------FTVDSPLPCDLVIKIKEFLLEISDDPFEVKLRDNYVLLVDEYLESLKRKALFDKKIGELCSERLLLPSGTI-------EGLYANLVKKNSEIYIQR--SKKIRESGPVRTRLLAWIMTDVNIMAMADTSIHGYNNVTRIMREIDHESPWPEEGLEFSTLWCRGVNISCTEWKFMLRDFPQPMFCVKSMRLYGNLCGAEQMGSKRAKRDVFIDVGEPFGTDVIQRSMPSLKFYHDFDCELESCSYAFGACWEPVMAQCNLSFEKISAPSKDPSPPLPFWDKLRLLLHGRLTLIAKQFTILLHASLDPYNTTEEMELTWNNCGIVLTNAKIMFKGELNVTVRTASRYD-DCRLLHFPNLKLTIKLKWVCLANPNDHHAVMPCAPDKLPEYSSNQVHDSFRAFRSLNLNIWISFETKPKAGEDLEVDIPSLVLYGSTLRWFESLQLILSGVTRPTRRGPVFNNVRPRKKPLSRHYKKANLQMCLHKFQVLYWMSHALQKGFQLNGRRVSFSSEHSLTLNPIDDGLIHRPRADWSTIYMNCELNDA-EIWLKSILTEKMDSS--SENLASAA-----DAF-KIVRFYFLSVAKVSYGR------EALIPTTATS------TEEDVKAQSTTPTHKLVVYDLKGAWTKSNRDVAFALFDSFMKSQKLKNNLSTEAVKSYR---------------------KEGPNSAV--LKHKRSDSTITLSSTNNEVLPIS-----------NPNASMKKAPAQIHAT--AMLQQLIAEAD-HKFNVYSDDHSTQSREL-QLQGLQACSAQDIIHENWSISLVNSQVLLKGCETSGYVIISAAKAEILQREHRPVWRERSLISKTTWKGLLECMQYYATVSAGDNNSLLEKEIMWLTVDNIQDK--DETVINNLPDISHLVGSGRSVGGVVSETVG---------------------AFLSDNSGGAQPVQLQRIVSKCKCEFFYVSYGDAIDPNSITE--VPPPPSEELQSPWEKQDDPVDAFTLMHHDLDVCTNSLQYAMILDIVNNLLLYVEPQRKQAAEKLTRMRFQLQLHSTEDQKRPIQQKQTVIRSL----------LMKIRSLEKDTHMISKERIEDGDSLELRQEYDHVQQMIRESKEELNTFSEDLDMML--------LCYKETQLSQLSKISNVRSDESVT--------------------MVRTNEICFKRAQWRLTETDGQIGIADLVLSAFLYTKKSKSDDSVEHLLELGNIRMENLLPREIYRDVLL---ATEIQKDMPVDTHKRVLRIFCREKAPVGGISVKEHFEINVAPITIAITKKFYSTMLKFCFPDRDASETEVSDELDDNASTSSAS 2125          

HSP 2 Score: 72.4034 bits (176), Expect = 7.127e-12
Identity = 32/71 (45.07%), Postives = 50/71 (70.42%), Query Frame = 2
Query: 6905 VSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIK 7114
            + KD ++ M ERA++N +F+Y+KI   P+R+SY+G K+K    I +++L I  +EYHN  WTWLDL + +K
Sbjct: 2158 IEKDDVEKMKERAEKNKLFIYIKIPEVPVRVSYKGNKEKNLEDITDYSLVIPTLEYHNVTWTWLDLLLAMK 2228          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-259g3.4 (si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8118])

HSP 1 Score: 557.755 bits (1436), Expect = 9.672e-166
Identity = 431/1536 (28.06%), Postives = 736/1536 (47.92%), Query Frame = 2
Query: 1727 STQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIII--ELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXX-XPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQL--QIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDR-NKVEFSL---LSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLER-IIKNLKTDIEE-KNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKI-LKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + Q+P    V  +    + +  S  +L V     +   W  S HM L +           +   Q  K      +  S +++  EL +   L   +S+++ II  ++ +          + T ++ ++ DG  I +      + +      +Q + +   L    NR+W   A  + I FPY+Y F+  +   IS++K++K +H   I S++ +         +PPD +I   +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT+S L L++L+D   +G E     +R+ID  SPFP + +     WCR    N +++  ++R+Y + L+ ++D  + GRL+  EQ     +KR   V++  PW +VI+ RNMP +KF++D  + ++  TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     +  + +   + DPYN TE  HW+W+ +  +W   ++V +G+L +  R+ASKYD  C  +  P+L + + + W+C+G+P++H AV  C   + A VT+   HD+Y  FRS NLNL I  + ++++ E   PR + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++   + PQL + YW S A++ G+ +      + T+    L      +  R  S W++ QM S +       +    +E +D +  ++  ++     +   +  +             +R+  + N              D ++ S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK +++  Q+Q+   L   ++S S  T    P                         +  +TR            ++ N G S        MLQ+L++E D  K   F EE   D  V D+L G+A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W    L  K++    L+ MQY+AT+E+  S   +   WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H++L   TN +QY MI++I+N+L+L+VEPRRK   +R  +V F L    + E+ +++IL  QE +R                   + + +I+ LE+ I  N+++  EE +   LS+       +R+Q+Q                 NQ++T +       N      K   L+  +            V RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:    7 AAQTP--SPVLTLTAFTISYHISTCSLEVRSESALTAQWTPSDHMFLYQHVTESRSYWKALSASQNLKHSDGAKSSSSSVLVFVELAS-TRLTAHVSEKNFIIFSAEALSLSKRPGAVLMKTPHLVLNFDGNDIFSFSEAEVQMLDELEAMQQHRSQFPFLQTPRNRSWIFTAPSLAIEFPYQYNFSDTFDKAISVQKWLKTLHGGVIQSEEPS--------RLPPDLLIRINQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDKKVAELRKQHGELLPARKIEELYTSLERKHIEIYIQRSRRLYANTP--MRKSLLTWTVSELELVALADQSLHGPEQIREQLRDIDGVSPFPRDGLQLVVQWCRAFKFNLNAFLVRIRDYPRYLFEIRDWTLSGRLMGTEQDGQLRAKRKQVVQLGQPWGDVIVYRNMPPLKFYYDIHSSISLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWVMDIEQANLHQLANEDPYNTTENLHWEWSKLNFDWTPGQFVFKGDLDVNVRTASKYDDIC-FLHLPSLCMTLELQWLCHGNPHDHHAVMLCATENVADVTSGQPHDSYRAFRSENLNLSITMDLDQSAKEPCQPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRRKLGQHYKQMSYTASFPQLQVHYWASFAQQRGIQVECSKGHVFTRGAQRLIPQAGTVMRRLISEWNVTQMVSDLSLVTVHLMASTWDETADHQINAQVKKTHLLSLSSLSYQRQS------------NRIEEEVNS------------KDESNASYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLRIDTQVQTKK-LKRSMSSYSSNTAPATPV------------------------ITAATR----------PEKSQNEGTS--------MLQKLIEETD--KFVVFSEE---DAGVSDQLCGIAACQTDDVYNRNWFIELVNGQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYSDTLKQKTTWTCLLDGMQYFATMEQNPSEQEDWQLWLEVKNIEEH--RQRNLDSVLELMESGQAVGGMVST---------TTDWNQPSHVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATSIKPPEIRDQHEKEDLLKKQAGAVDTFTLIHNDLEISTNPVQYSMILDIVNNLLLHVEPRRKEHSERKQRVRFQLEISSNPEEQRSSILHLQEAVR-------------------QHLAQIRCLEKQIYSNMRSQSEEFRGDELSEI-----NLRLQNQ----------------LNQEKTDMQMKSEELNILIRCFKDFQLQRANKLELRKPPEDVSVARRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1386          

HSP 2 Score: 58.151 bits (139), Expect = 2.035e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1450 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 1516          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Match: AL954372.1 (pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:16164696:-1 gene:ENSDARG00000112499.1 transcript:ENSDART00000182295.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL954372.1)

HSP 1 Score: 558.14 bits (1437), Expect = 3.397e-163
Identity = 414/1455 (28.45%), Postives = 708/1455 (48.66%), Query Frame = 2
Query: 1964 IIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQL--QIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDR-NKVEFSL---LSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNL----KTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + +EL +   L   +S+++ II  ++ +          + T ++ ++ DG  I +      + +      +Q + +   L    NR+W   A  + I FPY+Y F+  +   IS++K++K +H   I S++ +         +PPD +I   +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT+S L L++L+D   +G E     +R+ID  SPFP + +     WCR    N +++  ++R+Y + L+ ++D  + GRL+  EQ     +KR   V++  PW +VI+ RNMP +KF++D  + ++  TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     +  + +   + DPYN TE  HW+W+ +  +W   ++V +G+L +  R+ASKYD  C  +  P+L + + + W+C+G+P++H AV  C   + A VT+   HD+Y  FRS NLNL I    +   S   PR + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++   + PQL + YW S A++ G+ +      + T+    L      +  R  S W++ QM S +       +    +E +D +  ++  ++     +   +  +             +R+  + N              D ++ S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK +++  Q+Q+   L   ++S S  T    P                         +  +TR            ++ N G S        MLQ+L++E D  K   F EE   D  V D+L G+A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W    L  K++    L+ MQY+AT+E+  S   +   WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H++L   TN +QY MI++I+N+L+L+VEPRRK   +R  +V F L    + E+ +++IL  QE +R  +      E++++  + E + + +  +   ++N     KTD++ K+  L+  I  ++  ++Q   + L LR                           +D S                    V RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  485 VFVELAS-TRLTAHVSEKNFIIFSAEALSLSKRPGAVLMKTPHLVLNFDGNDIFSFSEAEVQMLDELEAMQQHRSQFPFLQTPRNRSWIFTAPSLAIEFPYQYNFSDTFDKAISVQKWLKTLHGGVIQSEEPS--------RLPPDLLIRINQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDKKVAELRKQHGELLPARKIEELYTSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTVSELELVALADQSLHGPEQIREQLRDIDGVSPFPRDGLQLVVQWCRAFKFNLNAFLVRIRDYPRYLFEIRDWTLSGRLMGTEQDGQLRAKRKQVVQLGQPWGDVIVYRNMPPLKFYYDIHSSISLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWVMDIEQANLHQLANEDPYNTTENLHWEWSKLNFDWTPGQFVFKGDLDVNVRTASKYDDIC-FLHLPSLCMTLELQWLCHGNPHDHHAVMLCATENVADVTSGQPHDSYRAFRSENLNLSI--TMDLDQSPCQPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRRKLGQHYKQMSYTASFPQLQVHYWASFAQQRGIQVECSKGHVFTRGAQRLIPQAGTVMRRLISEWNVTQMVSDLSLVTVHLMASTWDETADHQINAQVKKTHLLSLSSLSYQRQS------------NRIEEEVNS------------KDESNASYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLRIDTQVQTKK-LKRSMSSYSSNTAPATPV------------------------ITAATRPE----------KSQNEGTS--------MLQKLIEETD--KFVVFSEE---DAGVSDQLCGIAACQTDDVYNRNWFIELVNGQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYSDTLKQKTTWTCLLDGMQYFATMEQNPSEQEDWQLWLEVKNIEEH--RQRNLDSVLELMESGQAVGGMVST---------TTDWNQPSHVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATSIKPPEIRDQHEKEDLLKKQAGAVDTFTLIHNDLEISTNPVQYSMILDIVNNLLLHVEPRRKEHSERKQRVRFQLEISSNPEEQRSSILHLQEAVRQHLAQIRCLEKQIYSNMREFRGDELSEINLRLQNQLNQEKTDMQMKSEELNILIRCFKDFQLQRANK-LELR------------------------KPPEDVS--------------------VARRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1778          

HSP 2 Score: 58.151 bits (139), Expect = 1.765e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1842 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 1908          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Match: AL954372.1 (pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:16168531:-1 gene:ENSDARG00000112499.1 transcript:ENSDART00000185081.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL954372.1)

HSP 1 Score: 558.91 bits (1439), Expect = 7.125e-163
Identity = 448/1643 (27.27%), Postives = 769/1643 (46.80%), Query Frame = 2
Query: 1430 RSVKNIDSNSVGKESNLR--------SQSGSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIEIDFKFCGTVYDMIDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIII--ELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQL--QIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDR-NKVEFSL---LSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNL----KTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            R+V +  S SV  ESN++        + +  L   F+ + L+     V+ F +S+    I  +V+ +    +              V   + E+ E            T SP    V  +    + +  S  +L V     +   W  S HM L +           +   Q  K      +  S +++  EL +   L   +S+++ II  ++ +          + T ++ ++ DG  I +      + +      +Q + +   L    NR+W   A  + I FPY+Y F+  +   IS++K++K +H   I S++ +         +PPD +I   +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT+S L L++L+D   +G E     +R+ID  SPFP + +     WCR    N +++  ++R+Y + L+ ++D  + GRL+  EQ     +KR   V++  PW +VI+ RNMP +KF++D  + ++  TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     +  + +   + DPYN TE  HW+W+ +  +W   ++V +G+L +  R+ASKYD  C  +  P+L + + + W+C+G+P++H AV  C   + A VT+   HD+Y  FRS NLNL I    +   S   PR + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++   + PQL + YW S A++ G+ +      + T+    L      +  R  S W++ QM S +       +    +E +D +  ++  ++     +   +  +             +R+  + N              D ++ S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK +++  Q+Q+   L   ++S S  T    P                         +  +TR            ++ N G S        MLQ+L++E D  K   F EE   D  V D+L G+A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W    L  K++    L+ MQY+AT+E+  S   +   WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H++L   TN +QY MI++I+N+L+L+VEPRRK   +R  +V F L    + E+ +++IL  QE +R  +      E++++  + E + + +  +   ++N     KTD++ K+  L+  I  ++  ++Q   + L LR                           +D S                    V RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  399 RTVNSSPSGSVCMESNIKGLQMEVSETCTQCLSRLFSVLKLDKAEIDVNAFTLSNVAGAISARVDTVVAEGSGESSSVSVHGVSLAVVKALTESMEPCCPAAQ-----TPSP----VLTLTAFTISYHISTCSLEVRSESALTAQWTPSDHMFLYQHVTESRSYWKALSASQNLKHSDGAKSSSSSVLVFVELAS-TRLTAHVSEKNFIIFSAEALSLSKRPGAVLMKTPHLVLNFDGNDIFSFSEAEVQMLDELEAMQQHRSQFPFLQTPRNRSWIFTAPSLAIEFPYQYNFSDTFDKAISVQKWLKTLHGGVIQSEEPS--------RLPPDLLIRINQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDKKVAELRKQHGELLPARKIEELYTSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTVSELELVALADQSLHGPEQIREQLRDIDGVSPFPRDGLQLVVQWCRAFKFNLNAFLVRIRDYPRYLFEIRDWTLSGRLMGTEQDGQLRAKRKQVVQLGQPWGDVIVYRNMPPLKFYYDIHSSISLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWVMDIEQANLHQLANEDPYNTTENLHWEWSKLNFDWTPGQFVFKGDLDVNVRTASKYDDIC-FLHLPSLCMTLELQWLCHGNPHDHHAVMLCATENVADVTSGQPHDSYRAFRSENLNLSI--TMDLDQSPCQPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRRKLGQHYKQMSYTASFPQLQVHYWASFAQQRGIQVECSKGHVFTRGAQRLIPQAGTVMRRLISEWNVTQMVSDLSLVTVHLMASTWDETADHQINAQVKKTHLLSLSSLSYQRQS------------NRIEEEVNS------------KDESNASYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLRIDTQVQTKK-LKRSMSSYSSNTAPATPV------------------------ITAATRPE----------KSQNEGTS--------MLQKLIEETD--KFVVFSEE---DAGVSDQLCGIAACQTDDVYNRNWFIELVNGQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYSDTLKQKTTWTCLLDGMQYFATMEQNPSEQEDWQLWLEVKNIEEH--RQRNLDSVLELMESGQAVGGMVST---------TTDWNQPSHVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATSIKPPEIRDQHEKEDLLKKQAGAVDTFTLIHNDLEISTNPVQYSMILDIVNNLLLHVEPRRKEHSERKQRVRFQLEISSNPEEQRSSILHLQEAVRQHLAQIRCLEKQIYSNMREFRGDELSEINLRLQNQLNQEKTDMQMKSEELNILIRCFKDFQLQRANK-LELR------------------------KPPEDVS--------------------VARRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1871          

HSP 2 Score: 58.151 bits (139), Expect = 1.867e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1935 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 2001          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Match: AL954372.1 (pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:16171122:-1 gene:ENSDARG00000112499.1 transcript:ENSDART00000187136.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL954372.1)

HSP 1 Score: 558.14 bits (1437), Expect = 1.461e-162
Identity = 414/1455 (28.45%), Postives = 708/1455 (48.66%), Query Frame = 2
Query: 1964 IIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQL--QIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDR-NKVEFSL---LSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNL----KTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + +EL +   L   +S+++ II  ++ +          + T ++ ++ DG  I +      + +      +Q + +   L    NR+W   A  + I FPY+Y F+  +   IS++K++K +H   I S++ +         +PPD +I   +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT+S L L++L+D   +G E     +R+ID  SPFP + +     WCR    N +++  ++R+Y + L+ ++D  + GRL+  EQ     +KR   V++  PW +VI+ RNMP +KF++D  + ++  TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     +  + +   + DPYN TE  HW+W+ +  +W   ++V +G+L +  R+ASKYD  C  +  P+L + + + W+C+G+P++H AV  C   + A VT+   HD+Y  FRS NLNL I    +   S   PR + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++   + PQL + YW S A++ G+ +      + T+    L      +  R  S W++ QM S +       +    +E +D +  ++  ++     +   +  +             +R+  + N              D ++ S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK +++  Q+Q+   L   ++S S  T    P                         +  +TR            ++ N G S        MLQ+L++E D  K   F EE   D  V D+L G+A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W    L  K++    L+ MQY+AT+E+  S   +   WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H++L   TN +QY MI++I+N+L+L+VEPRRK   +R  +V F L    + E+ +++IL  QE +R  +      E++++  + E + + +  +   ++N     KTD++ K+  L+  I  ++  ++Q   + L LR                           +D S                    V RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  603 VFVELAS-TRLTAHVSEKNFIIFSAEALSLSKRPGAVLMKTPHLVLNFDGNDIFSFSEAEVQMLDELEAMQQHRSQFPFLQTPRNRSWIFTAPSLAIEFPYQYNFSDTFDKAISVQKWLKTLHGGVIQSEEPS--------RLPPDLLIRINQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDKKVAELRKQHGELLPARKIEELYTSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTVSELELVALADQSLHGPEQIREQLRDIDGVSPFPRDGLQLVVQWCRAFKFNLNAFLVRIRDYPRYLFEIRDWTLSGRLMGTEQDGQLRAKRKQVVQLGQPWGDVIVYRNMPPLKFYYDIHSSISLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWVMDIEQANLHQLANEDPYNTTENLHWEWSKLNFDWTPGQFVFKGDLDVNVRTASKYDDIC-FLHLPSLCMTLELQWLCHGNPHDHHAVMLCATENVADVTSGQPHDSYRAFRSENLNLSI--TMDLDQSPCQPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRRKLGQHYKQMSYTASFPQLQVHYWASFAQQRGIQVECSKGHVFTRGAQRLIPQAGTVMRRLISEWNVTQMVSDLSLVTVHLMASTWDETADHQINAQVKKTHLLSLSSLSYQRQS------------NRIEEEVNS------------KDESNASYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLRIDTQVQTKK-LKRSMSSYSSNTAPATPV------------------------ITAATRPE----------KSQNEGTS--------MLQKLIEETD--KFVVFSEE---DAGVSDQLCGIAACQTDDVYNRNWFIELVNGQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYSDTLKQKTTWTCLLDGMQYFATMEQNPSEQEDWQLWLEVKNIEEH--RQRNLDSVLELMESGQAVGGMVST---------TTDWNQPSHVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATSIKPPEIRDQHEKEDLLKKQAGAVDTFTLIHNDLEISTNPVQYSMILDIVNNLLLHVEPRRKEHSERKQRVRFQLEISSNPEEQRSSILHLQEAVRQHLAQIRCLEKQIYSNMREFRGDELSEINLRLQNQLNQEKTDMQMKSEELNILIRCFKDFQLQRANK-LELR------------------------KPPEDVS--------------------VARRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1896          

HSP 2 Score: 58.151 bits (139), Expect = 1.823e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1960 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 2026          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-259g3.4 (si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8118])

HSP 1 Score: 558.91 bits (1439), Expect = 2.799e-162
Identity = 417/1455 (28.66%), Postives = 711/1455 (48.87%), Query Frame = 2
Query: 1964 IIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXX-XPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQL--QIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDR-NKVEFSL---LSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLER-IIKNLKTDIEE-KNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKI-LKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + +EL +   L   +S+++ II  ++ +          + T ++ ++ DG  I +      + +      +Q + +   L    NR+W   A  + I FPY+Y F+  +   IS++K++K +H   I S++ +         +PPD +I   +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT+S L L++L+D   +G E     +R+ID  SPFP + +     WCR    N +++  ++R+Y + L+ ++D  + GRL+  EQ     +KR   V++  PW +VI+ RNMP +KF++D  + ++  TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     +  + +   + DPYN TE  HW+W+ +  +W   ++V +G+L +  R+ASKYD  C  +  P+L + + + W+C+G+P++H AV  C   + A VT+   HD+Y  FRS NLNL I  + ++++ E   PR + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++   + PQL + YW S A++ G+ +      + T+    L      +  R  S W++ QM S +       +    +E +D +  ++  ++     +   +  +             +R+  + N              D ++ S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK +++  Q+Q+   L   ++S S  T    P                         +  +TR            ++ N G S        MLQ+L++E D  K   F EE   D  V D+L G+A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W    L  K++    L+ MQY+AT+E+  S   +   WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H++L   TN +QY MI++I+N+L+L+VEPRRK   +R  +V F L    + E+ +++IL  QE +R                   + + +I+ LE+ I  N+++  EE +   LS+       +R+Q+Q                 NQ++T +       N      K   L+  +            V RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  719 VFVELAS-TRLTAHVSEKNFIIFSAEALSLSKRPGAVLMKTPHLVLNFDGNDIFSFSEAEVQMLDELEAMQQHRSQFPFLQTPRNRSWIFTAPSLAIEFPYQYNFSDTFDKAISVQKWLKTLHGGVIQSEEPS--------RLPPDLLIRINQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDKKVAELRKQHGELLPARKIEELYTSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTVSELELVALADQSLHGPEQIREQLRDIDGVSPFPRDGLQLVVQWCRAFKFNLNAFLVRIRDYPRYLFEIRDWTLSGRLMGTEQDGQLRAKRKQVVQLGQPWGDVIVYRNMPPLKFYYDIHSSISLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWVMDIEQANLHQLANEDPYNTTENLHWEWSKLNFDWTPGQFVFKGDLDVNVRTASKYDDIC-FLHLPSLCMTLELQWLCHGNPHDHHAVMLCATENVADVTSGQPHDSYRAFRSENLNLSITMDLDQSAKEPCQPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRRKLGQHYKQMSYTASFPQLQVHYWASFAQQRGIQVECSKGHVFTRGAQRLIPQAGTVMRRLISEWNVTQMVSDLSLVTVHLMASTWDETADHQINAQVKKTHLLSLSSLSYQRQS------------NRIEEEVNS------------KDESNASYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLRIDTQVQTKK-LKRSMSSYSSNTAPATPV------------------------ITAATRPE----------KSQNEGTS--------MLQKLIEETD--KFVVFSEE---DAGVSDQLCGIAACQTDDVYNRNWFIELVNGQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYSDTLKQKTTWTCLLDGMQYFATMEQNPSEQEDWQLWLEVKNIEEH--RQRNLDSVLELMESGQAVGGMVST---------TTDWNQPSHVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATSIKPPEIRDQHEKEDLLKKQAGAVDTFTLIHNDLEISTNPVQYSMILDIVNNLLLHVEPRRKEHSERKQRVRFQLEISSNPEEQRSSILHLQEAVR-------------------QHLAQIRCLEKQIYSNMRSQSEEFRGDELSEI-----NLRLQNQ----------------LNQEKTDMQMKSEELNILIRCFKDFQLQRANKLELRKPPEDVSVARRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 2019          

HSP 2 Score: 58.5362 bits (140), Expect = 1.605e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2083 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 2149          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Match: KIAA0100 (KIAA0100 [Source:NCBI gene;Acc:100494392])

HSP 1 Score: 563.533 bits (1451), Expect = 8.784e-164
Identity = 454/1669 (27.20%), Postives = 775/1669 (46.43%), Query Frame = 2
Query: 1370 VQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQS---GSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIE-IDFKFCGTVYDMIDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCL-REAFVNLHKIITNVKLLQKTKSVPSEPTMKSH---IIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVE--IHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKL-KLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXX--XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ---WLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVV-------VEEQIN-RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVL--MMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            +QLE SD+ A    ++ + + +V    + S+ +     S S   G+      K+D+  ++E V+LF +SS     + +++++    T+   +E  D    G  + ++    E         D +    YF      + + + +  +  AL+V   +++   W    HM L +     L      +  + K   +P   T +S    I +EL + + L+  +S+E+  +LR+  +  H  Q    +  H  E  +  D   I    +   + +         +     L    NRAW +    V + FP++Y F+      I ++K++K +H+              V   +PPD ++  K+F     DD FE +L DNY L++DE++E  KR+  +  ++  L K  G        + LY   L+K++  I    S R         +L  WT+S L +++++D   +G EN +++MR ID+ SP P E ++    WCRM+  +  ++  ++R+Y + L+ ++D ++ GRL+ AEQS    ++R   + +  PW +  +ERNMP +KFFHDF +++   TI +GP W+     +    +L+ + S DPS PLPWWDKSRL LHG      +  + +   + DPYN TE  HW+W+ ++  W   ++V +G+L +  R+ASKYD DC  +  P+L +  ++ W+C+G+P++H  V    P  +    +   HD+Y  FRS N+NL I+       +     PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S++       +    +E +D +  +   ++     +   +  +   E           LS    +   NT Y                     H L LVDL+  WT  NR++ + + D Y+   +L++NLS +ALK +++  Q  +    K+   S R+    P K    +V  R+                  R  +  A Y                    MLQ+L++E D  K   F EEES    V ++L G A C+    ++  W +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S   +L+ MQY+AT E   + +     WL   ++E+       L    E++  G+AVGG+V+T      P E                        +Q+QR+IS+C+C +YY+SY    DP    Q   PP P+   +ED +      A T TL H +L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    ++E++++ ++         E +N +++ L+  +   K D+++K+  L+  I  ++  ++Q   + + LR           +Q   VS                                 V RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K  L   M   S   +    LRI    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG+
Sbjct:  487 LQLECSDTCAECLSRVISLLPTVPKFPAPSLKEPLPHMSPSEDQGNKQGLLWKVDV--RIEEVNLFTLSSLVGASQVRLDLL----TAIGSVESCDLSLQGVAFSLLKSITEKMELCCRAQDITEPLLYF------STLSLTYNSTIQALNVLFGEELLLQWSPWDHMYLYQHTLSTLQCKDLLLSHIVKEGQLPGSSTAESGENCITLELSS-LRLQAFVSQENIFLLRTQKLWLH--QHGGSVTLHCPEATVCADDHNIFLFKDLEAQRLTELEDMLLHRIHFPSLLTKRNRAWVLSFSSVSMEFPHRYDFSCILDHAIGVQKWLKGLHN----------FSKTVNAPLPPDLVLTVKQFSFAFLDDVFEVKLRDNYELMKDESKESAKRLRLLDDKVAALRKQHGELLPARKIEELYS-SLEKKNIEIYIQRSRRLYSNTPMRKSLLTWTMSDLEVVAVADESLHGPENVLKNMREIDSVSPLPTEGLSLVIQWCRMMKCSLKTFYVRIRDYPRYLFEIRDWHLSGRLLGAEQSGQASARRKQVLHLGIPWGDATVERNMPPLKFFHDFHSEIQLYTIVWGPCWDPAWTLVGQYVDLLTKPSVDPSTPLPWWDKSRLLLHGHFSMDIEQANLHQLATEDPYNTTENMHWEWSHLKFAWNPGQFVFKGDLDVNVRTASKYD-DCCFLHLPDLCMIFDLQWLCHGNPHDHHNVALRSPDFLSEFSSIQQHDSYRAFRSENINLSIKMDLTQPHSGRFSQPRILLYSSTLRWMQNFWATWSSVTRPICRGKLFNNLKPGKKKLGQHYKQMSYTALFPQLQIHYWASFAQQRGIQVECDQGEIFTRGVQRLIPQAGTVMRRLISEWSVPQMTSKLSFVTVHLMASACDENADHQLDNLVQKTHLLSLSSLSYERQVSIE---------TELSPTGEE---NTMY--------------------THRLHLVDLRASWTTLNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDAQMQA---KKLKRGSMRSFPP-PKKVTAPIVTGRTE-----------------RSPSGGAKY--------------------MLQKLIEETD--KFVVFTEEES---GVSEQLCGKAPCQDQDILNHNWLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPSWYGDTLKQKTSWTCQLDSMQYFATTESNPAEVEDSQCWLEVKNIEEHRHRN--LDSVQELMESGQAVGGMVSTTTDWTQPSEVQ--------------------QNLQMQRIISRCNCHMYYISYSHDIDPELAMQIKPPPTPVHPEKEDLLKGQEAAADTFTLKHQHLEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVLQIRQWEKQMYAIMKLLHDESKNESLNEQLQKLQSQLFQEKMDLQQKSEELNILIRCFKDFQLQRANK-MELR-----------KQPEDVS---------------------------------VARRTEFYFAQARWRLTEQDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVALRPQMPGQSGRQLA---LRIFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGR 1979          

HSP 2 Score: 58.9214 bits (141), Expect = 1.414e-7
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2046 DDLDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2112          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Match: KIAA0100 (KIAA0100 [Source:NCBI gene;Acc:100494392])

HSP 1 Score: 562.762 bits (1449), Expect = 1.742e-163
Identity = 454/1669 (27.20%), Postives = 775/1669 (46.43%), Query Frame = 2
Query: 1370 VQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQS---GSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIE-IDFKFCGTVYDMIDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCL-REAFVNLHKIITNVKLLQKTKSVPSEPTMKSH---IIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVE--IHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKL-KLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXX--XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ---WLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVV-------VEEQIN-RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVL--MMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            +QLE SD+ A    ++ + + +V    + S+ +     S S   G+      K+D+  ++E V+LF +SS     + +++++    T+   +E  D    G  + ++    E         D +    YF      + + + +  +  AL+V   +++   W    HM L +     L      +  + K   +P   T +S    I +EL + + L+  +S+E+  +LR+  +  H  Q    +  H  E  +  D   I    +   + +         +     L    NRAW +    V + FP++Y F+      I ++K++K +H+              V   +PPD ++  K+F     DD FE +L DNY L++DE++E  KR+  +  ++  L K  G        + LY   L+K++  I    S R         +L  WT+S L +++++D   +G EN +++MR ID+ SP P E ++    WCRM+  +  ++  ++R+Y + L+ ++D ++ GRL+ AEQS    ++R   + +  PW +  +ERNMP +KFFHDF +++   TI +GP W+     +    +L+ + S DPS PLPWWDKSRL LHG      +  + +   + DPYN TE  HW+W+ ++  W   ++V +G+L +  R+ASKYD DC  +  P+L +  ++ W+C+G+P++H  V    P  +    +   HD+Y  FRS N+NL I+       +     PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S++       +    +E +D +  +   ++     +   +  +   E           LS    +   NT Y                     H L LVDL+  WT  NR++ + + D Y+   +L++NLS +ALK +++  Q  +    K+   S R+    P K    +V  R+                  R  +  A Y                    MLQ+L++E D  K   F EEES    V ++L G A C+    ++  W +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S   +L+ MQY+AT E   + +     WL   ++E+       L    E++  G+AVGG+V+T      P E                        +Q+QR+IS+C+C +YY+SY    DP    Q   PP P+   +ED +      A T TL H +L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    ++E++++ ++         E +N +++ L+  +   K D+++K+  L+  I  ++  ++Q   + + LR           +Q   VS                                 V RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K  L   M   S   +    LRI    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG+
Sbjct:  489 LQLECSDTCAECLSRVISLLPTVPKFPAPSLKEPLPHMSPSEDQGNKQGLLWKVDV--RIEEVNLFTLSSLVGASQVRLDLL----TAIGSVESCDLSLQGVAFSLLKSITEKMELCCRAQDITEPLLYF------STLSLTYNSTIQALNVLFGEELLLQWSPWDHMYLYQHTLSTLQCKDLLLSHIVKEGQLPGSSTAESGENCITLELSS-LRLQAFVSQENIFLLRTQKLWLH--QHGGSVTLHCPEATVCADDHNIFLFKDLEAQRLTELEDMLLHRIHFPSLLTKRNRAWVLSFSSVSMEFPHRYDFSCILDHAIGVQKWLKGLHN----------FSKTVNAPLPPDLVLTVKQFSFAFLDDVFEVKLRDNYELMKDESKESAKRLRLLDDKVAALRKQHGELLPARKIEELYS-SLEKKNIEIYIQRSRRLYSNTPMRKSLLTWTMSDLEVVAVADESLHGPENVLKNMREIDSVSPLPTEGLSLVIQWCRMMKCSLKTFYVRIRDYPRYLFEIRDWHLSGRLLGAEQSGQASARRKQVLHLGIPWGDATVERNMPPLKFFHDFHSEIQLYTIVWGPCWDPAWTLVGQYVDLLTKPSVDPSTPLPWWDKSRLLLHGHFSMDIEQANLHQLATEDPYNTTENMHWEWSHLKFAWNPGQFVFKGDLDVNVRTASKYD-DCCFLHLPDLCMIFDLQWLCHGNPHDHHNVALRSPDFLSEFSSIQQHDSYRAFRSENINLSIKMDLTQPHSGRFSQPRILLYSSTLRWMQNFWATWSSVTRPICRGKLFNNLKPGKKKLGQHYKQMSYTALFPQLQIHYWASFAQQRGIQVECDQGEIFTRGVQRLIPQAGTVMRRLISEWSVPQMTSKLSFVTVHLMASACDENADHQLDNLVQKTHLLSLSSLSYERQVSIE---------TELSPTGEE---NTMY--------------------THRLHLVDLRASWTTLNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDAQMQA---KKLKRGSMRSFPP-PKKVTAPIVTGRTE-----------------RSPSGGAKY--------------------MLQKLIEETD--KFVVFTEEES---GVSEQLCGKAPCQDQDILNHNWLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPSWYGDTLKQKTSWTCQLDSMQYFATTESNPAEVEDSQCWLEVKNIEEHRHRN--LDSVQELMESGQAVGGMVSTTTDWTQPSEVQ--------------------QNLQMQRIISRCNCHMYYISYSHDIDPELAMQIKPPPTPVHPEKEDLLKGQEAAADTFTLKHQHLEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVLQIRQWEKQMYAIMKLLHDESKNESLNEQLQKLQSQLFQEKMDLQQKSEELNILIRCFKDFQLQRANK-MELR-----------KQPEDVS---------------------------------VARRTEFYFAQARWRLTEQDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVALRPQMPGQSGRQLA---LRIFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGR 1981          

HSP 2 Score: 58.9214 bits (141), Expect = 1.402e-7
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2048 DDLDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2114          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Match: KIAA0100 (KIAA0100 [Source:NCBI gene;Acc:100494392])

HSP 1 Score: 555.829 bits (1431), Expect = 3.373e-161
Identity = 400/1377 (29.05%), Postives = 664/1377 (48.22%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXXXXXX--XXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ---WLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVV-------VEEQIN-RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVL--MMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            NRAW +    V + FP++Y F+      I ++K++K +H+              V   +PPD ++  K+F     DD FE +L DNY L++DE++E  KR+  +  ++  L K  G        + LY   L+K++  I    S R         +L  WT+S L +++++D   +G EN +++MR ID+ SP P E ++    WCRM+  +  ++  ++R+Y + L+ ++D ++ GRL+ AEQS    ++R   + +  PW +  +ERNMP +KFFHDF +++   TI +GP W+     +    +L+ + S DPS PLPWWDKSRL LHG      +  + +   + DPYN TE  HW+W+ ++  W   ++V +G+L +  R+ASKYD DC  +  P+L +  ++ W+C+G+P++H  V    P  +    +   HD+Y  FRS N+NL I+ +  +  +     PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S++       +    +E +D +  +   ++     +   +  +   E           LS    +   NT Y                     H L LVDL+  WT  NR++ + + D Y+   +L++NLS +ALK +++  Q  +    K+   S R+    P K    +V  R+                  R  +  A Y                    MLQ+L++E D  K   F EEES    V ++L G A C+    ++  W +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S   +L+ MQY+AT E   + +     WL   ++E+       L    E++  G+AVGG+V+T      P E                        +Q+QR+IS+C+C +YY+SY    DP    Q   PP P+   +ED +      A T TL H +L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    ++E++++ ++         E +N +++ L+  +   K D+++K+  L+  I  ++  ++Q   + + LR           +Q   VS                                 V RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K  L   M   S   +    LRI    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG+
Sbjct:  766 NRAWVLSFSSVSMEFPHRYDFSCILDHAIGVQKWLKGLHN----------FSKTVNAPLPPDLVLTVKQFSFAFLDDVFEVKLRDNYELMKDESKESAKRLRLLDDKVAALRKQHGELLPARKIEELYS-SLEKKNIEIYIQRSRRLYSNTPMRKSLLTWTMSDLEVVAVADESLHGPENVLKNMREIDSVSPLPTEGLSLVIQWCRMMKCSLKTFYVRIRDYPRYLFEIRDWHLSGRLLGAEQSGQASARRKQVLHLGIPWGDATVERNMPPLKFFHDFHSEIQLYTIVWGPCWDPAWTLVGQYVDLLTKPSVDPSTPLPWWDKSRLLLHGHFSMDIEQANLHQLATEDPYNTTENMHWEWSHLKFAWNPGQFVFKGDLDVNVRTASKYD-DCCFLHLPDLCMIFDLQWLCHGNPHDHHNVALRSPDFLSEFSSIQQHDSYRAFRSENINLSIKMDLTQPHSGRFSQPRILLYSSTLRWMQNFWATWSSVTRPICRGKLFNNLKPGKKKLGQHYKQMSYTALFPQLQIHYWASFAQQRGIQVECDQGEIFTRGVQRLIPQAGTVMRRLISEWSVPQMTSKLSFVTVHLMASACDENADHQLDNLVQKTHLLSLSSLSYERQVSIE---------TELSPTGEE---NTMY--------------------THRLHLVDLRASWTTLNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDAQMQA---KKLKRGSMRSFPP-PKKVTAPIVTGRTE-----------------RSPSGGAKY--------------------MLQKLIEETD--KFVVFTEEES---GVSEQLCGKAPCQDQDILNHNWLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPSWYGDTLKQKTSWTCQLDSMQYFATTESNPAEVEDSQCWLEVKNIEEHRHRN--LDSVQELMESGQAVGGMVSTTTDWTQPSEVQ--------------------QNLQMQRIISRCNCHMYYISYSHDIDPELAMQIKPPPTPVHPEKEDLLKGQEAAADTFTLKHQHLEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVLQIRQWEKQMYAIMKLLHDESKNESLNEQLQKLQSQLFQEKMDLQQKSEELNILIRCFKDFQLQRANK-MELR-----------KQPEDVS---------------------------------VARRTEFYFAQARWRLTEQDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVALRPQMPGQSGRQLA---LRIFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGR 1981          

HSP 2 Score: 59.3066 bits (142), Expect = 1.300e-7
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2048 DDLDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2114          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Match: KIAA0100 (KIAA0100 [Source:NCBI gene;Acc:100494392])

HSP 1 Score: 555.829 bits (1431), Expect = 6.574e-161
Identity = 398/1376 (28.92%), Postives = 658/1376 (47.82%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ---WLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVV-------VEEQIN-RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVL--MMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            NRAW +    V + FP++Y F+      I ++K++K +H+              V   +PPD ++  K+F     DD FE +L DNY L++DE++E  KR+  +  ++  L K  G        + LY   L+K++  I    S R         +L  WT+S L +++++D   +G EN +++MR ID+ SP P E ++    WCRM+  +  ++  ++R+Y + L+ ++D ++ GRL+ AEQS    ++R   + +  PW +  +ERNMP +KFFHDF +++   TI +GP W+     +    +L+ + S DPS PLPWWDKSRL LHG      +  + +   + DPYN TE  HW+W+ ++  W   ++V +G+L +  R+ASKYD DC  +  P+L +  ++ W+C+G+P++H  V    P  +    +   HD+Y  FRS N+NL I+   +   S    PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S++       +    +E +D +               D   +K     +     +   LS    +   NT Y                     H L LVDL+  WT  NR++ + + D Y+   +L++NLS +ALK +++  Q       +   L   + + FP  +                   T  +     +R+ S                       MLQ+L++E D  K   F EEES    V ++L G A C+    ++  W +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S   +L+ MQY+AT E   + +     WL   ++E+       L    E++  G+AVGG+V+T      P E                        +Q+QR+IS+C+C +YY+SY    DP    Q   PP P+   +ED +      A T TL H +L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    ++E++++ ++         E +N +++ L+  +   K D+++K+  L+  I  ++  ++Q   + + LR           +Q   VS                                 V RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K  L   M   S   +    LRI    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG+
Sbjct:  839 NRAWVLSFSSVSMEFPHRYDFSCILDHAIGVQKWLKGLHN----------FSKTVNAPLPPDLVLTVKQFSFAFLDDVFEVKLRDNYELMKDESKESAKRLRLLDDKVAALRKQHGELLPARKIEELYS-SLEKKNIEIYIQRSRRLYSNTPMRKSLLTWTMSDLEVVAVADESLHGPENVLKNMREIDSVSPLPTEGLSLVIQWCRMMKCSLKTFYVRIRDYPRYLFEIRDWHLSGRLLGAEQSGQASARRKQVLHLGIPWGDATVERNMPPLKFFHDFHSEIQLYTIVWGPCWDPAWTLVGQYVDLLTKPSVDPSTPLPWWDKSRLLLHGHFSMDIEQANLHQLATEDPYNTTENMHWEWSHLKFAWNPGQFVFKGDLDVNVRTASKYD-DCCFLHLPDLCMIFDLQWLCHGNPHDHHNVALRSPDFLSEFSSIQQHDSYRAFRSENINLSIKMDLTQPHSEVSQPRILLYSSTLRWMQNFWATWSSVTRPICRGKLFNNLKPGKKKLGQHYKQMSYTALFPQLQIHYWASFAQQRGIQVECDQGEIFTRGVQRLIPQAGTVMRRLISEWSVPQMTSKLSFVTVHLMASACDENADHQL--------------DNLVQKTHLLSLSSLSYERQELSPTGEE---NTMY--------------------THRLHLVDLRASWTTLNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDAQ------MQAKKLKRGSMRSFPPPK-----------------KVTAPIVTGRTERSPSGG-------------------ADMLQKLIEETD--KFVVFTEEES---GVSEQLCGKAPCQDQDILNHNWLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPSWYGDTLKQKTSWTCQLDSMQYFATTESNPAEVEDSQCWLEVKNIEEHRHRN--LDSVQELMESGQAVGGMVSTTTDWTQPSEVQ--------------------QNLQMQRIISRCNCHMYYISYSHDIDPELAMQIKPPPTPVHPEKEDLLKGQEAAADTFTLKHQHLEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVLQIRQWEKQMYAIMKLLHDESKNESLNEQLQKLQSQLFQEKMDLQQKSEELNILIRCFKDFQLQRANK-MELR-----------KQPEDVS---------------------------------VARRTEFYFAQARWRLTEQDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVALRPQMPGQSGRQLA---LRIFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGR 2047          

HSP 2 Score: 59.3066 bits (142), Expect = 1.103e-7
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2114 DDLDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2180          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Match: KIAA0100 (KIAA0100 [Source:NCBI gene;Acc:100494392])

HSP 1 Score: 555.444 bits (1430), Expect = 9.915e-161
Identity = 398/1376 (28.92%), Postives = 658/1376 (47.82%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ---WLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVV-------VEEQIN-RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVL--MMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            NRAW +    V + FP++Y F+      I ++K++K +H+              V   +PPD ++  K+F     DD FE +L DNY L++DE++E  KR+  +  ++  L K  G        + LY   L+K++  I    S R         +L  WT+S L +++++D   +G EN +++MR ID+ SP P E ++    WCRM+  +  ++  ++R+Y + L+ ++D ++ GRL+ AEQS    ++R   + +  PW +  +ERNMP +KFFHDF +++   TI +GP W+     +    +L+ + S DPS PLPWWDKSRL LHG      +  + +   + DPYN TE  HW+W+ ++  W   ++V +G+L +  R+ASKYD DC  +  P+L +  ++ W+C+G+P++H  V    P  +    +   HD+Y  FRS N+NL I+   +   S    PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S++       +    +E +D +               D   +K     +     +   LS    +   NT Y                     H L LVDL+  WT  NR++ + + D Y+   +L++NLS +ALK +++  Q       +   L   + + FP  +                   T  +     +R+ S                       MLQ+L++E D  K   F EEES    V ++L G A C+    ++  W +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S   +L+ MQY+AT E   + +     WL   ++E+       L    E++  G+AVGG+V+T      P E                        +Q+QR+IS+C+C +YY+SY    DP    Q   PP P+   +ED +      A T TL H +L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    ++E++++ ++         E +N +++ L+  +   K D+++K+  L+  I  ++  ++Q   + + LR           +Q   VS                                 V RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K  L   M   S   +    LRI    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG+
Sbjct:  859 NRAWVLSFSSVSMEFPHRYDFSCILDHAIGVQKWLKGLHN----------FSKTVNAPLPPDLVLTVKQFSFAFLDDVFEVKLRDNYELMKDESKESAKRLRLLDDKVAALRKQHGELLPARKIEELYS-SLEKKNIEIYIQRSRRLYSNTPMRKSLLTWTMSDLEVVAVADESLHGPENVLKNMREIDSVSPLPTEGLSLVIQWCRMMKCSLKTFYVRIRDYPRYLFEIRDWHLSGRLLGAEQSGQASARRKQVLHLGIPWGDATVERNMPPLKFFHDFHSEIQLYTIVWGPCWDPAWTLVGQYVDLLTKPSVDPSTPLPWWDKSRLLLHGHFSMDIEQANLHQLATEDPYNTTENMHWEWSHLKFAWNPGQFVFKGDLDVNVRTASKYD-DCCFLHLPDLCMIFDLQWLCHGNPHDHHNVALRSPDFLSEFSSIQQHDSYRAFRSENINLSIKMDLTQPHSEVSQPRILLYSSTLRWMQNFWATWSSVTRPICRGKLFNNLKPGKKKLGQHYKQMSYTALFPQLQIHYWASFAQQRGIQVECDQGEIFTRGVQRLIPQAGTVMRRLISEWSVPQMTSKLSFVTVHLMASACDENADHQL--------------DNLVQKTHLLSLSSLSYERQELSPTGEE---NTMY--------------------THRLHLVDLRASWTTLNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDAQ------MQAKKLKRGSMRSFPPPK-----------------KVTAPIVTGRTERSPSGG-------------------ADMLQKLIEETD--KFVVFTEEES---GVSEQLCGKAPCQDQDILNHNWLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPSWYGDTLKQKTSWTCQLDSMQYFATTESNPAEVEDSQCWLEVKNIEEHRHRN--LDSVQELMESGQAVGGMVSTTTDWTQPSEVQ--------------------QNLQMQRIISRCNCHMYYISYSHDIDPELAMQIKPPPTPVHPEKEDLLKGQEAAADTFTLKHQHLEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVLQIRQWEKQMYAIMKLLHDESKNESLNEQLQKLQSQLFQEKMDLQQKSEELNILIRCFKDFQLQRANK-MELR-----------KQPEDVS---------------------------------VARRTEFYFAQARWRLTEQDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVALRPQMPGQSGRQLA---LRIFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGR 2067          

HSP 2 Score: 59.3066 bits (142), Expect = 1.123e-7
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2134 DDLDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2200          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Mouse
Match: 2610507B11Rik (RIKEN cDNA 2610507B11 gene [Source:MGI Symbol;Acc:MGI:1919753])

HSP 1 Score: 545.428 bits (1404), Expect = 9.480e-158
Identity = 407/1373 (29.64%), Postives = 677/1373 (49.31%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQP---IHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLP---LEEDEISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            NR W +    V + FPY+Y F++   + + ++K++K +H        ++   S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ I  +R +D  SPFP E +   T WCRM+  N  ++  ++R+Y + L+ ++D  + GRL   EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V  G+L +  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      + RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R S                 N  T+  +S ++  P    H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q ++    K       + Q  P+                    +T S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    E  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP      E++++    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V      E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +S +    G  L + L    R PVGGI V E  E+ + PL +Q+S  F+  MM FFFPG+
Sbjct:  814 NRVWLLSLGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHRG------THAWASPSPAPLPPDLLLKVQHFSWVFLDDIFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVIEQVRELDPGSPFPAEGMDLVTQWCRMLKCNVKTFLVRIRDYPRYLFEIRDWRLMGRLAGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFRGDLDVNVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILVYSSTLRWMQNFWATWTSITRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISEWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLITKTHLLSLSSLTYQRHS-----------------NRTTEEELSARDGDPAFHTHQLYLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQMSA---KKPKRGIPPSAQVPPHV-------------------STPSFSGRPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RERSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVHENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRHLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAIYKVVLRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLSHRFFHRMMGFFFPGR 2033          

HSP 2 Score: 58.5362 bits (140), Expect = 1.677e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2100 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2166          
BLAST of Fmp27_GFWDK domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14667|K0100_HUMAN (Protein KIAA0100 OS=Homo sapiens OX=9606 GN=KIAA0100 PE=1 SV=3)

HSP 1 Score: 554.673 bits (1428), Expect = 6.218e-160
Identity = 411/1371 (29.98%), Postives = 681/1371 (49.67%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDE---ISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKA 6259
            NR W +    V + FPY+Y F++   + + ++K++K +H        +    S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ +  ++ +D  SPFP E +     WCRM+  N  S+  ++R+Y + L+ ++D  + GRLV  EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V +G+L I  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      V RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S+WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R    SN+T       S+   DPT  +         H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q                    P K+    V   +++   +   NT S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    +  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP  LE  E   +    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V    + E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +S +    G  L + L    R PVGGI V E  E+ + PL +Q++  F+  MM FFFPG++
Sbjct:  814 NRVWLLSFGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHQG------TRAWASPSPVPLPPDLLLKVEHFSWVFLDDVFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVVEQVQELDPGSPFPPEGLDLVIQWCRMLKCNVKSFLVRIRDYPRYLFEIRDWRLMGRLVGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFKGDLDINVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILLYSSTLRWMQNFWATWTSVTRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISDWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLVTKTHLLSLSSLTYQR---HSNRTAEEEL--SARDGDPTFHT---------HQLHLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQ-------------------MPAKKPKRGVPTSASAPPRV---NTPSFSGQPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RQRSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVLENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRQLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAVYKVVLRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLTHQFFHRMMGFFFPGRS 2034          

HSP 2 Score: 58.5362 bits (140), Expect = 1.087e-6
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2100 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2166          
BLAST of Fmp27_GFWDK domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SYL3|K0100_MOUSE (Protein KIAA0100 OS=Mus musculus OX=10090 GN=Kiaa0100 PE=1 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 6.631e-157
Identity = 407/1373 (29.64%), Postives = 677/1373 (49.31%), Query Frame = 2
Query: 2213 NRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLY-QLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD----HDTYYFFRSRNLNLDIXX-XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQP---IHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLP---LEEDEISHSSEGAT-TLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSA-LSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIE--RYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            NR W +    V + FPY+Y F++   + + ++K++K +H        ++   S     +PPD ++  + F     DD FE +L DNY L++DE++E  KR+  + +++  L K  G        + LY  L+ +    YI R  S R          L  W+++GL L++L+D+ F+G E+ I  +R +D  SPFP E +   T WCRM+  N  ++  ++R+Y + L+ ++D  + GRL   EQS    S+R   + +  PW NV +ERNMP +KF+HDF +++ + T+ +GP W+     I    +L+ + S DPSPPLPWWDKSRL  HG      +  + +   + DPYN TE  HW+W+ +  +W+  ++V  G+L +  R+ASKYD DC  +  P+L + +++ W+C+G+P++H +VT   P  +        HD+Y  FRS NLNL I+   +  + +   PR + Y++ L++ + F      + RPI RG+ +N  +  K  LG+H++ ++     PQL + YW S A++ G+ +      + T+    L      +  R  S WS+ QM S + + + V L+    E + D C               L     +   + LS L Y R S                 N  T+  +S ++  P    H L LVDL++ WT TNR++ + + D Y+   +L++NLS +ALK +++  Q ++    K       + Q  P+                    +T S      K +S  +Y                    MLQ+L++E D  +   F EEES    + D+L G+A C+++   +R   +EL+N Q++L+  ++    IVSAA+ +L   +H P W    L  K+S    L+ MQY+AT E   +       WL   ++E+    E  L    E++  G+AVGG+V T                    ++  +  ++     Q+QR+IS+C+C +YY+SY       L   + PP      E++++    EGA  T TL+H  L   TN  QY MI++I+N+L+L+VEP+RK   +     R ++E S   EEQ +++IL  QE +R  V      E++++                I+K+L+ D + +N   L+Q +    Q+++  ++ +L L S          ++   +     +    + N  ++ K          +    V+RR E  F  A WR+TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +S +    G  L + L    R PVGGI V E  E+ + PL +Q+S  F+  MM FFFPG+
Sbjct:  814 NRVWLLSLGSVSVEFPYQYDFSRTLDEAVGVQKWLKGLHRG------THAWASPSPAPLPPDLLLKVQHFSWVFLDDIFEVKLHDNYELMKDESKESAKRLQLLDAKVAALRKQHGELLPARKIEELYASLERKNIEIYIQR--SRRLYGNTPMRRALLTWSLAGLELVALADASFHGPEHVIEQVRELDPGSPFPAEGMDLVTQWCRMLKCNVKTFLVRIRDYPRYLFEIRDWRLMGRLAGTEQSGQPCSRRRQILHLGLPWGNVAVERNMPPLKFYHDFHSEIFQYTVVWGPCWDPAWTLIGQCVDLLTKPSADPSPPLPWWDKSRLLFHGDWHMDIEQANLHQLATEDPYNTTENMHWEWSHLSFHWKPGQFVFRGDLDVNVRTASKYD-DCCFLHLPDLCMTLDLQWLCHGNPHDHHSVTLRAPEFLPEVPLGQLHDSYRAFRSENLNLSIKMDLTRHSGTISQPRILVYSSTLRWMQNFWATWTSITRPICRGKLFNNLKPSKKKLGQHYKQLSYTALFPQLQVHYWASFAQQRGIQIECSQGHVFTRGTQRLIPQAGTVMRRLISEWSVTQMVSDLSQ-VTVHLMASPTEENADHC---------------LDPLITKTHLLSLSSLTYQRHS-----------------NRTTEEELSARDGDPAFHTHQLYLVDLRISWTTTNRDIAFGLYDGYKKAAVLKRNLSTEALKGLKIDPQMSA---KKPKRGIPPSAQVPPHV-------------------STPSFSGRPDKGSSGGAY--------------------MLQKLIEETD--RFVVFTEEES---GMSDQLCGIAACQTDDIYNRNCLIELVNCQMVLRGAETEGCVIVSAAKAQLLQCQHHPAWYGDTLKQKTSWTCLLDGMQYFATTESSPTEQDGRQLWLEVKNIEEH--RERSLDSVQELMESGQAVGGMVTT--------------------TTDWNQPAEAQQAQQVQRIISRCNCRMYYISYSHDIDPELATQIKPPEVHENQEKEDLLKKQEGAVDTFTLIHHELEISTNPAQYAMILDIVNNLLLHVEPKRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRHLEKQMYS---------------IMKSLQDDSKNENLLDLNQKL----QLQLNQEKANLQLES----------EELNILIRCFKDFQLQRANKMELRK---------QQEDVSVVRRTEFYFAQARWRLTEEDGQLGIAELELQRFLYSKVNKSDDTAEHLLELGWFTMNNLLPNAIYKVVLRPQSSCQ---SGRQLALRLFSKVRPPVGGISVKEHFEVNVVPLTIQLSHRFFHRMMGFFFPGR 2033          

HSP 2 Score: 58.5362 bits (140), Expect = 1.173e-6
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2100 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-NSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKR 2166          
BLAST of Fmp27_GFWDK domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IMT1|SAB_ARATH (Protein SABRE OS=Arabidopsis thaliana OX=3702 GN=SAB PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 5.555e-7
Identity = 59/251 (23.51%), Postives = 99/251 (39.44%), Query Frame = 2
Query: 2804 ITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNM----PTIKFFHDFSADMNENTICYGPNWESCLQWINISWELI----NRSSRDP--------SPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHW--------QWNG-VRVNWENMKWVLEGELGIFCRSASKY---DGDCQLIAWPNLQLKINIFWIC-NGDPNNHF 3469
            I FS L+   + LN  S   Q+R Y   L +       GR+V+A+Q+     +    V V   W  V + R+     P +K + D      +  + +G  +E     I+ ++ +     N S R+P           LPWWD  R  +HG +        W    + DPY + +            Q +G V V+ ++ K  L     +  R + K          I  P+  L++ + W C +G+  NH+
Sbjct: 1131 IPFSRLYGSNVYLNTGSLVVQLRNYTLPLLSGTSGKCEGRIVLAQQATCFQPQISQDVFVGR-WRKVKMFRSASGTTPPLKTYSDLRIHFEQGEVSFGVGYEPAFADISYAFTVALRRANLSHRNPDMVQVIKKERSLPWWDDMRNYVHGNITLSFSESKWSVLATTDPYESLDQLQIVSGPIELKQSDGRVFVSAKDFKIKLSSLESLISRHSLKVPVRASGAAFIEAPDFNLEVTMDWDCESGNSLNHY 1380          
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Match: A0A5K3EVW9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 572/1645 (34.77%), Postives = 878/1645 (53.37%), Query Frame = 2
Query: 1739 PYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTM-------KSHIIIELGNGVELKFCISKEHDIIL-RSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNK---------IDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLV-KNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP--ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVA-EQSASEISKRHVTVEVDHPWHN--VIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPS-PPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD---HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIED---------------NLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEE-------ASDDKCP------SEKYRSFTEHDNKDLFHEKCRYEFIILSHLKY-------------DRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDN-----------------------------PMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNIS-QWLNTCDVED--QID---NEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQ-HLIPPLPLEEDE--ISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVE------------------------------EQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEE 6265
            P F+  CN+   +ME F           D VD  ++  +H+C+ E F+ L +++       K ++V  EP+         +H  +   +G  +   +    D +L  S I    +    SK+V     + CD R I  + N   + + P++ +R  K   +LT   N   E   + V I+FPY Y F++C+ + +++++  K   S K         + +  S+G G   R  IP DY+I  K+F L++KDDPFEC+L D++++L DE+ E +KR+  + SQL++   +N G+ +EVE + CL QL+ Q+ ++YI+RI   R        ++LF W++   SL  L+D  +  +   I  ++ ID  SP+   +   F+ L CR I L+   +C+Q+R+Y K L    DL V G   VA  +S     +R   V    PW    V I R++  +KFF++  A+M E  ICYG NWE    W+N+  + + R S DPS PPL WWD+ RL  HGRL F  D M W YP SLDPYNNTEF  +QW     +W   +  + G+L +F ++ASKYDG C ++    L  +  + W+  G+  +H AV   +   ++  +   HD++  FR   L L + F   +      PRC  YTN+LK F++ K C+ R+ARPIRRG  +   R +KP+ G   + + + +  P+L + YW+S A + GVH   G ++L + F + ++   +               N H R    WS+  + +++    + WL+ + +        A D   P      +    +    +++ L     R+E  I S  +              +R+  D + + ++  + +     P+    S ++L+P+H + + + K+RW +TNRNLVY+M++IY H   L+KNLSAQALK I L         T ++S      +E  Y+ V N + E   +E ++   N G ++  T    ++AS     ++ ++   Q +E +N                             PML +L++E +TAK YA+CEEE K  +V+D+L G++LC S   +SR+WH+ELIN+QVMLK ++ + Y IVSAA+ RLDS EH P+W+D++LL KSS+VG++ECMQYYATV  ++++   QWL+T DV D  Q+     +D LSG PEVVG G AVGG+V+               +P    +S  +        IQLQRM+S+C+C   YV+Y   +P  LP   ++PPLP E+ +  I  + EGA T TLLH  LN  TNSLQY M+ +I+N+L+LYVEP++K R +RN+V  SLL E +L+ +IL  QE LR +V+ Q  YER+LW ++ E                               Q  +I   E  I  LK  I  KNS LSQ IA +Q++ +QSQR    + +S  R ++ + Q++T +    ++   +Q + +           + +    E++RR+EVCFEHA WRMTE DGQIGL DVELR F+YS+  R D SG+H F+L +++V+SL  N +FKEVL+ D SS    GGP++R+   +R PVGGI V E MEI + PLVLQ+SK FY  +MPFFFP +  E
Sbjct:  480 PSFQVCCNVGHKEMEVFFG---------DAVDLAFNPGVHLCVCE-FLLLLRVLRLRH--SKQEAVGLEPSAWNVEVHNTAHTRLTYASGRHVVTALFSSVDALLGNSPIRGLALRLTSSKLV-----VQCDNRDIAVLQNLVLRRLPPSSAHR--KVAFQLTTPENTCLEFHTEGVRITFPYNYKFSECFDEFVNVRRMHKLAASPKSAFFADIKQLLATSSSGEGPSSR--IPCDYVIRVKKFTLEIKDDPFECKLSDDFMVLMDESVEQQKRVAALTSQLERSRHQNRGVVSEVELQSCLKQLEFQRAAEYIARIR--RFYSGYTMADDLFTWSMDSASLHVLADEAYNSSAKVIAEIQRIDDVSPWNDLQASDFTQLCCRRIHLSVARFCWQLRDYSKPLIDAADLTVTGPFAVAIRKSVDRQGQRDREVTPGVPWDPPVVTITRHVSPVKFFYELVANMKELFICYGSNWEPAWTWLNLRLDGVRRVSMDPSLPPLGWWDRVRLNYHGRLAFTCDFMSWLYPTSLDPYNNTEFLTFQWTRSMFDWTPGRVFVNGDLDLFFQTASKYDGICHVLEIQGLNFEATLDWLSFGNQFDHHAVVTVNGKRLSANELATHDSFKAFRGNRLLLRLAFTLTDQQVLP-PRCFIYTNLLKLFDRLKMCLSRIARPIRRGPVFRCIRPRKPLFGHLLQCLELSVQLPRLEVTYWVSYAMRLGVHARMGAVTLRSLFRVHVEGERETMTVDQKTVYVLPTANQHRRISPQWSLQVVDARVL-NCRAWLLHQPDRTALHLISAGDGNAPNWHCQDANGLPTAFPPNSELLTFSSVRFERDIKSRTELPVQEVRVRIPGLEERVVVDEHTSSNSPDHATPGKRRPSRVQFSHEDLEPVHRVLVENPKMRWNETNRNLVYAMMNIYNHAQALKKNLSAQALKGISLSPD-----HTAIDS----GNKESSYQPVTNSISE---NEESMSLGNDGIVESQTPSGNAAAS-----KSADLKAVQSVEDENSLSPSSSVSRGDVLTANTAAAAACGWKNVPMLARLIEEAETAKFYAYCEEEPKQPDVLDQLQGLSLCTSCPVLSRQWHIELINTQVMLKPSECAGYVIVSAAKARLDSVEHPPVWRDARLLAKSSLVGQMECMQYYATVGGLDASTPDQWLSTADVRDWQQLGTDFGQDALSGRPEVVGSGHAVGGVVSA--------------APTNLTASTQN--------IQLQRMVSRCACQFVYVTYTPVEPDCLPSPRVVPPLPPEDGDSKILQNQEGADTFTLLHRTLNLCTNSLQYSMVFDIVNNLLLYVEPKQKERFERNRVGLSLLDERELRKSILTDQETLRAMVNMQRAYERDLWALLREFDQLLRNTQPTLKLCEFFDGPTRHLPTALSAQTEQILAFEERIGQLKASIVAKNSLLSQSIAHFQRVHVQSQRLQGQIAASVVREAVGSRQRETAIVGTCNSNADTQPSPQP---------TTGLLDEEEIVRRDEVCFEHARWRMTELDGQIGLADVELRGFLYSRTHRRDVSGSHRFQLGSMRVQSLAPNSYFKEVLLPDTSSYHYTGGPMIRVACTQRPPVGGISVKEVMEISVTPLVLQVSKQFYNKLMPFFFPERGNE 2051          

HSP 2 Score: 95.1301 bits (235), Expect = 2.564e-15
Identity = 46/90 (51.11%), Postives = 62/90 (68.89%), Query Frame = 2
Query: 6848 THKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIK 7114
            T   +V  + G S +    VS  P+ +M ERA++N++FLY+KI  FPIRLSY+G+KQK  A +  F LNI  +EYHN+LWTWLD  ME+K
Sbjct: 2226 TTTTVVLDSTGTS-TVEPAVSTLPIDVMRERARRNHVFLYIKIPSFPIRLSYKGDKQKNLADVTGFELNIPMLEYHNRLWTWLDFLMEVK 2314          
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Match: A0A5K3EU02 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 572/1645 (34.77%), Postives = 878/1645 (53.37%), Query Frame = 2
Query: 1739 PYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTM-------KSHIIIELGNGVELKFCISKEHDIIL-RSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNK---------IDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLV-KNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP--ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVA-EQSASEISKRHVTVEVDHPWHN--VIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPS-PPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD---HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIED---------------NLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEE-------ASDDKCP------SEKYRSFTEHDNKDLFHEKCRYEFIILSHLKY-------------DRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDN-----------------------------PMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNIS-QWLNTCDVED--QID---NEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQ-HLIPPLPLEEDE--ISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVE------------------------------EQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEE 6265
            P F+  CN+   +ME F           D VD  ++  +H+C+ E F+ L +++       K ++V  EP+         +H  +   +G  +   +    D +L  S I    +    SK+V     + CD R I  + N   + + P++ +R  K   +LT   N   E   + V I+FPY Y F++C+ + +++++  K   S K         + +  S+G G   R  IP DY+I  K+F L++KDDPFEC+L D++++L DE+ E +KR+  + SQL++   +N G+ +EVE + CL QL+ Q+ ++YI+RI   R        ++LF W++   SL  L+D  +  +   I  ++ ID  SP+   +   F+ L CR I L+   +C+Q+R+Y K L    DL V G   VA  +S     +R   V    PW    V I R++  +KFF++  A+M E  ICYG NWE    W+N+  + + R S DPS PPL WWD+ RL  HGRL F  D M W YP SLDPYNNTEF  +QW     +W   +  + G+L +F ++ASKYDG C ++    L  +  + W+  G+  +H AV   +   ++  +   HD++  FR   L L + F   +      PRC  YTN+LK F++ K C+ R+ARPIRRG  +   R +KP+ G   + + + +  P+L + YW+S A + GVH   G ++L + F + ++   +               N H R    WS+  + +++    + WL+ + +        A D   P      +    +    +++ L     R+E  I S  +              +R+  D + + ++  + +     P+    S ++L+P+H + + + K+RW +TNRNLVY+M++IY H   L+KNLSAQALK I L         T ++S      +E  Y+ V N + E   +E ++   N G ++  T    ++AS     ++ ++   Q +E +N                             PML +L++E +TAK YA+CEEE K  +V+D+L G++LC S   +SR+WH+ELIN+QVMLK ++ + Y IVSAA+ RLDS EH P+W+D++LL KSS+VG++ECMQYYATV  ++++   QWL+T DV D  Q+     +D LSG PEVVG G AVGG+V+               +P    +S  +        IQLQRM+S+C+C   YV+Y   +P  LP   ++PPLP E+ +  I  + EGA T TLLH  LN  TNSLQY M+ +I+N+L+LYVEP++K R +RN+V  SLL E +L+ +IL  QE LR +V+ Q  YER+LW ++ E                               Q  +I   E  I  LK  I  KNS LSQ IA +Q++ +QSQR    + +S  R ++ + Q++T +    ++   +Q + +           + +    E++RR+EVCFEHA WRMTE DGQIGL DVELR F+YS+  R D SG+H F+L +++V+SL  N +FKEVL+ D SS    GGP++R+   +R PVGGI V E MEI + PLVLQ+SK FY  +MPFFFP +  E
Sbjct:  727 PSFQVCCNVGHKEMEVFFG---------DAVDLAFNPGVHLCVCE-FLLLLRVLRLRH--SKQEAVGLEPSAWNVEVHNTAHTRLTYASGRHVVTALFSSVDALLGNSPIRGLALRLTSSKLV-----VQCDNRDIAVLQNLVLRRLPPSSAHR--KVAFQLTTPENTCLEFHTEGVRITFPYNYKFSECFDEFVNVRRMHKLAASPKSAFFADIKQLLATSSSGEGPSSR--IPCDYVIRVKKFTLEIKDDPFECKLSDDFMVLMDESVEQQKRVAALTSQLERSRHQNRGVVSEVELQSCLKQLEFQRAAEYIARIR--RFYSGYTMADDLFTWSMDSASLHVLADEAYNSSAKVIAEIQRIDDVSPWNDLQASDFTQLCCRRIHLSVARFCWQLRDYSKPLIDAADLTVTGPFAVAIRKSVDRQGQRDREVTPGVPWDPPVVTITRHVSPVKFFYELVANMKELFICYGSNWEPAWTWLNLRLDGVRRVSMDPSLPPLGWWDRVRLNYHGRLAFTCDFMSWLYPTSLDPYNNTEFLTFQWTRSMFDWTPGRVFVNGDLDLFFQTASKYDGICHVLEIQGLNFEATLDWLSFGNQFDHHAVVTVNGKRLSANELATHDSFKAFRGNRLLLRLAFTLTDQQVLP-PRCFIYTNLLKLFDRLKMCLSRIARPIRRGPVFRCIRPRKPLFGHLLQCLELSVQLPRLEVTYWVSYAMRLGVHARMGAVTLRSLFRVHVEGERETMTVDQKTVYVLPTANQHRRISPQWSLQVVDARVL-NCRAWLLHQPDRTALHLISAGDGNAPNWHCQDANGLPTAFPPNSELLTFSSVRFERDIKSRTELPVQEVRVRIPGLEERVVVDEHTSSNSPDHATPGKRRPSRVQFSHEDLEPVHRVLVENPKMRWNETNRNLVYAMMNIYNHAQALKKNLSAQALKGISLSPD-----HTAIDS----GNKESSYQPVTNSISE---NEESMSLGNDGIVESQTPSGNAAAS-----KSADLKAVQSVEDENSLSPSSSVSRGDVLTANTAAAAACGWKNVPMLARLIEEAETAKFYAYCEEEPKQPDVLDQLQGLSLCTSCPVLSRQWHIELINTQVMLKPSECAGYVIVSAAKARLDSVEHPPVWRDARLLAKSSLVGQMECMQYYATVGGLDASTPDQWLSTADVRDWQQLGTDFGQDALSGRPEVVGSGHAVGGVVSA--------------APTNLTASTQN--------IQLQRMVSRCACQFVYVTYTPVEPDCLPSPRVVPPLPPEDGDSKILQNQEGADTFTLLHRTLNLCTNSLQYSMVFDIVNNLLLYVEPKQKERFERNRVGLSLLDERELRKSILTDQETLRAMVNMQRAYERDLWALLREFDQLLRNTQPTLKLCEFFDGPTRHLPTALSAQTEQILAFEERIGQLKASIVAKNSLLSQSIAHFQRVHVQSQRLQGQIAASVVREAVGSRQRETAIVGTCNSNADTQPSPQP---------TTGLLDEEEIVRRDEVCFEHARWRMTELDGQIGLADVELRGFLYSRTHRRDVSGSHRFQLGSMRVQSLAPNSYFKEVLLPDTSSYHYTGGPMIRVACTQRPPVGGISVKEVMEISVTPLVLQVSKQFYNKLMPFFFPERGNE 2298          

HSP 2 Score: 95.1301 bits (235), Expect = 2.464e-15
Identity = 46/90 (51.11%), Postives = 62/90 (68.89%), Query Frame = 2
Query: 6848 THKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIK 7114
            T   +V  + G S +    VS  P+ +M ERA++N++FLY+KI  FPIRLSY+G+KQK  A +  F LNI  +EYHN+LWTWLD  ME+K
Sbjct: 2473 TTTTVVLDSTGTS-TVEPAVSTLPIDVMRERARRNHVFLYIKIPSFPIRLSYKGDKQKNLADVTGFELNIPMLEYHNRLWTWLDFLMEVK 2561          
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Match: A0A158QV06 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7057 PE=4 SV=1)

HSP 1 Score: 904.049 bits (2335), Expect = 0.000e+0
Identity = 548/1549 (35.38%), Postives = 838/1549 (54.10%), Query Frame = 2
Query: 2003 CISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNK---------IDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLV-KNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP--ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVA-EQSASEISKRHVTVEVDHPWHN--VIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPS-PPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTD---HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIED---------------NLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEE-------ASDDKCP------SEKYRSFTEHDNKDLFHEKCRYEFIILSHLKY-------------DRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDN-----------------------------PMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNIS-QWLNTCDVED--QID---NEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQ-HLIPPLPLEEDE--ISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVE------------------------------EQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEE 6265
             +S + D  L + +  F+     ++ +T   E    GR +    N   + + P++ +R  K   +LT   N   E   + V I+FPY Y F++C+ + +++++  K   S K         + +  S+G G   R  IP DY+I  K+F L++KDDPFEC+L D++++L DE+ E +KR+  + SQL++   +N G+ +EVE + CL QL+ Q+ ++YI+RI   R        ++LF W++   SL  L+D  +  +   I  ++ ID  SP+   +   F+ L CR I L+   +C+Q+R+Y K L    DL V G   VA  +S     +R   V    PW    V I R++  +KFF++  A+M E  ICYG NWE    W+N+  + + R S DPS PPL WWD+ RL  HGRL F  D M W YP SLDPYNNTEF  +QW     +W   +  + G+L +F ++ASKYDG C ++    L  +  + W+  G+  +H AV   +   ++  +   HD++  FR   L L + F   +      PRC  YTN+LK F++ K C+ R+ARPIRRG  +   R +KP+ G   + + + +  P+L + YW+S A + GVH   G ++L + F + ++   +               N H R    WS+  + +++    + WL+ + +        A D   P      +    +    +++ L     R+E  I S  +              +R+  D + + ++  + +     P+    S ++L+P+H + + + K+RW +TNRNLVY+M++IY H   L+KNLSAQALK I L         T ++S      +E  Y+ V N + E   +E ++   N G ++  T    ++AS     ++ ++   Q +E +N                             PML +L++E +TAK YA+CEEE K  +V+D+L G++LC S   +SR+WH+ELIN+QVMLK ++ + Y IVSAA+ RLDS EH P+W+D++LL KSS+VG++ECMQYYATV  ++++   QWL+T DV D  Q+     +D LSG PEVVG G AVGG+V+               +P    +S  +        IQLQRM+S+C+C   YV+Y   +P  LP   ++PPLP E+ +  I  + EGA T TLLH  LN  TNSLQY M+ +I+N+L+LYVEP++K R +RN+V  SLL E +L+ +IL  QE LR +V+ Q  YER+LW ++ E                               Q  +I   E  I  LK  I  KNS LSQ IA +Q++ +QSQR    + +S  R ++ + Q++T +    ++   +Q + +           + +    E++RR+EVCFEHA WRMTE DGQIGL DVELR F+YS+  R D SG+H F+L +++V+SL  N +FKEVL+ D SS    GGP++R+   +R PVGGI V E MEI + PLVLQ+SK FY  +MPFFFP +  E
Sbjct:  756 ALSLQPDSFLAAQVFRFNKLMMAAQPITAVPE----GRAVFEKPNLVLRRLPPSSAHR--KVAFQLTTPENTCLEFHTEGVRITFPYNYKFSECFDEFVNVRRMHKLAASPKSAFFADIKQLLATSSSGEGPSSR--IPCDYVIRVKKFTLEIKDDPFECKLSDDFMVLMDESVEQQKRVAALTSQLERSRHQNRGVVSEVELQSCLKQLEFQRAAEYIARIR--RFYSGYTMADDLFTWSMDSASLHVLADEAYNSSAKVIAEIQRIDDVSPWNDLQASDFTQLCCRRIHLSVARFCWQLRDYSKPLIDAADLTVTGPFAVAIRKSVDRQGQRDREVTPGVPWDPPVVTITRHVSPVKFFYELVANMKELFICYGSNWEPAWTWLNLRLDGVRRVSMDPSLPPLGWWDRVRLNYHGRLAFTCDFMSWLYPTSLDPYNNTEFLTFQWTRSMFDWTPGRVFVNGDLDLFFQTASKYDGICHVLEIQGLNFEATLDWLSFGNQFDHHAVVTVNGKRLSANELATHDSFKAFRGNRLLLRLAFTLTDQQVLP-PRCFIYTNLLKLFDRLKMCLSRIARPIRRGPVFRCIRPRKPLFGHLLQCLELSVQLPRLEVTYWVSYAMRLGVHARMGAVTLRSLFRVHVEGERETMTVDQKTVYVLPTANQHRRISPQWSLQVVDARVL-NCRAWLLHQPDRTALHLISAGDGNAPNWHCQDANGLPTAFPPNSELLTFSSVRFERDIKSRTELPVQEVRVRIPGLEERVVVDEHTSSNSPDHATPGKRRPSRVQFSHEDLEPVHRVLVENPKMRWNETNRNLVYAMMNIYNHAQALKKNLSAQALKGISLSPD-----HTAIDS----GNKESSYQPVTNSISE---NEESMSLGNDGIVESQTPSGNAAAS-----KSADLKAVQSVEDENSLSPSSSVSRGDVLTANTAAAAACGWKNVPMLARLIEEAETAKFYAYCEEEPKQPDVLDQLQGLSLCTSCPVLSRQWHIELINTQVMLKPSECAGYVIVSAAKARLDSVEHPPVWRDARLLAKSSLVGQMECMQYYATVGGLDASTPDQWLSTADVRDWQQLGTDFGQDALSGRPEVVGSGHAVGGVVSA--------------APTNLTASTQN--------IQLQRMVSRCACQFVYVTYTPVEPDCLPSPRVVPPLPPEDGDSKILQNQEGADTFTLLHRTLNLCTNSLQYSMVFDIVNNLLLYVEPKQKERFERNRVGLSLLDERELRKSILTDQETLRAMVNMQRAYERDLWALLREFDQLLRNTQPTLKLCEFFDGPTRHLPTALSAQTEQILAFEERIGQLKASIVAKNSLLSQSIAHFQRVHVQSQRLQGQIAASVVREAVGSRQRETAIVGTCNSNADTQPSPQP---------TTGLLDEEEIVRRDEVCFEHARWRMTELDGQIGLADVELRGFLYSRTHRRDVSGSHRFQLGSMRVQSLAPNSYFKEVLLPDTSSYHYTGGPMIRVACTQRPPVGGISVKEVMEISVTPLVLQVSKQFYNKLMPFFFPERGNE 2244          
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Match: A0A4S2L7U4 (Fmp27_GFWDK domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009166 PE=4 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 557/1496 (37.23%), Postives = 793/1496 (53.01%), Query Frame = 2
Query: 2489 ENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPERIT--FSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPS-PPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVT---TTDHDTYYFFRSRNLNLDIX-XXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHL---------------------------ELKQIE-DNLHHRPQSNWSIVQMK-----SQIR-------RGLKVWLIQK-AEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSS------DSNQTFH-----NTSYDSSTLND--------------PTDTSMSDQ---------ELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQ----IQSNSFLDTKVNSLSHR--TEQEFPYKRVHNLVDERSN-SEINLIENNTGSL-------------KMSTRKRASSA-----------------SYINKSRTHNIGESQIMESDN-----------PMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ-WLNTCDVEDQI-----DNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLP-QHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQI------------NRIKP---------------------------LERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHL--------------------------------RSSFSRPSLSTNQQQTPVSSN---ISNTNTSQ---------DNSKKILKXXXXXXXXXX--XXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKS 6310
            E  ++E+ +  +  QL++   +G   TE E   C  +L+ Q+  +Y +R +  +  Q   S N LF WT++ L L  L+D  F   E  +  +R +D+ SP+P+ +   F TLWCR+ISLN DSW FQ+R+Y K    M DL++WG L  AE+ A    +R V V   +PW    + R+   +KF++DF+AD+    +CYG NWE  L W++   E I     D S P L WWD+ R  LHGRL+ VS+ M W    SL+PYN TEFF WQW+   V WE   + L G++ I  R+ASKYDG C L   P +++ I + W+   DP +H AV PC+ A +     T+HD+Y  FR+  L++ I       TS    P C+FYT+ILKF ++ + C+ +VARPIRRG  + Y   +KP+ GR  +L+    N P L + YW+S A +TGVH+ TGP+ LS++  L                            ++ I+   L  RP ++WS++++      S+IR        G  V L+ K A+    D   ++   + +     D        +F+++  L YD++ S      D +   H      TS ++  L+               P++T  S Q          L P H L + DLK+RWT+  RNLVY ++D Y+H   L++NLSA+A ++IQL+    + S     T   +L  R  T          N  D+R++ + ++L  N++  L             +M     A S                  S  + SR H   +S+     N           PML QLL+EVDTA+ YA+CEEE K  NV+D+L G+ +C  ++  +R WH+EL+NSQ++LKT+  + Y +V+AA+ +LD+  H PIWKD+QLL KSS+VG LECMQYYATV +V+  I   WL+T DV D        +ED LSG PEVVGCG +VGG+V   V     +  G   +   D +     +  +   IQLQRMIS+C C ++YV Y+ AD   LP  HLIPPLP +E ++  + EGA T+TLLH  LN  TNSLQYHMIV I+N+L+LYVEP+RKA+ +RN+V F L+SE Q ++ ILR+QE LR LV  Q R ER+LW  V E               +RI P                           LE  + NLKT I + N+ LSQ +A YQQ++I++QRR +                                  R+S S P+ ST   ++  S +    S    +Q          NS+++       S S+      +E++RRNEVCFEHA WRMTE+DGQIGL DVELR F+Y+K  R+DDSG+H  EL  ++V+SL  + F+KEVL+ D       GGP+LRI   E  PVGG+ V EAMEI +AP+VLQISK FY  MMP+FFP KA+E  V     N++ V +
Sbjct:    3 EQVKYEQNVTALHDQLQQ---SGLRLTEAERMACFARLEEQRLIEYRTRHTQFK--QEFPSTNELFTWTLNNLHLKLLTDYTFTTPEQIVDKIRQLDSCSPWPDLLASDFCTLWCRVISLNVDSWRFQLRDYPKPWLEMTDLFLWGPLAGAERCADWQGQRTVQVIPGNPWPEYTVARSCWPLKFYYDFTADLKTIHMCYGSNWEPTLAWLSQRLEDIFPRPWDMSVPRLAWWDRVRHLLHGRLYIVSESMHWLCATSLNPYNATEFFTWQWSQSTVCWETGHFRLGGDVDILYRTASKYDGVCHLFHLPGMEMNIFLDWLSLHDPLDHHAVKPCNSARLAEMGITNHDSYRHFRANRLSMRITCSVHPPTSPASRPWCLFYTSILKFADRLRMCLTKVARPIRRGSVFGYQPLRKPLFGRLLQLMEFTFNLPHLEVAYWVSYANRTGVHLTTGPVHLSSETRLIVEGETKVPLIRGTSSGAMVQPFVMFAPMRPIQHSGLIRRPIASWSVIRLSASVHDSRIRLRHNPNLPGQVVQLLLKSAKPIRVDPLLNQTGLTASLETETDQAAADTAEDFLMVPLLHYDQVGSTSPPPPDQSVRVHIPGRRATSTNAGNLDASGDLLQSSPNSTAAPSETEYSTQIVGEKLTHENLTPTHRLVVNDLKLRWTEHTRNLVYILMDTYQHAQSLKRNLSARATRAIQLRQGIPVTSPRNWSTSALNLGFRGTTPSVASDLFAQNSSDQRADPTNMSLHTNDSEELVGGVDVIDTPRDLRMDIGTHAGSPIRTHSRTSNEGSNREELSTTSGSRMHWASQSETSVQSNHSGLSGGLEQIPMLAQLLEEVDTARFYAYCEEEPKQTNVIDQLHGLTICSESLVTARNWHVELLNSQLLLKTDNLAGYILVTAARAKLDALTHPPIWKDAQLLNKSSLVGHLECMQYYATVGQVDPGIPDLWLSTPDVADWAHVSVNADEDELSGRPEVVGCGHSVGGVVTARV-----VVGGTPRATAMDTTPASEARIHHAPYIQLQRMISRCCCEIFYVHYEPADSSNLPPAHLIPPLPFDETKVVRTQEGADTVTLLHHTLNICTNSLQYHMIVGIVNNLLLYVEPQRKAQLERNRVAFGLMSESQARSAILRNQEVLRCLVAEQRRLERDLWSFVRETMAVLELDRVAAVSQDRIIPGLPDLVQCRQPSENAAILALSIHYARHLEAQVTNLKTRIVDCNALLSQRLAQYQQLQIRAQRRHMRSAMSGTHSPHTTGASLTTSASASSLLKQHRKGDRASLSPPTSSTAPHKSDSSMSRLAASGGGPTQPGEYFAGDSSNSEQLPTQLQRESLSIKNDPYPAEIVRRNEVCFEHARWRMTEHDGQIGLADVELRGFLYAKTHRQDDSGSHWLELGWIRVDSLGPDSFYKEVLLPDVGGGHYAGGPILRIACSELAPVGGLSVKEAMEISVAPMVLQISKQFYRVMMPYFFPEKADE-SVPAAPGNLTPVTT 1487          

HSP 2 Score: 90.8929 bits (224), Expect = 4.777e-14
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 2
Query: 6887 DSSSNTVSK--DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIKKSI 7123
            D  SNT     +P+++M ERA+QN +FLY+KI GFPI LSY+GEKQK    +  F LNI  +E+HN +WTWLD  ME+K  I
Sbjct: 1719 DYRSNTTPGIVNPVEVMRERARQNNVFLYIKIPGFPICLSYKGEKQKNLTDVTRFQLNIPTMEHHNCVWTWLDFAMEVKTRI 1800          
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Match: A0A4S2L8Q9 (Fmp27_GFWDK domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009166 PE=4 SV=1)

HSP 1 Score: 861.292 bits (2224), Expect = 0.000e+0
Identity = 557/1496 (37.23%), Postives = 794/1496 (53.07%), Query Frame = 2
Query: 2489 ENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPERIT--FSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPS-PPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVT---TTDHDTYYFFRSRNLNLDIX-XXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHL---------------------------ELKQIE-DNLHHRPQSNWSIVQMK-----SQIR-------RGLKVWLIQK-AEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDS----NQTFH-------NTSYDSSTLND--------------PTDTSMSDQ---------ELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQ----IQSNSFLDTKVNSLSHR--TEQEFPYKRVHNLVDERSN-SEINLIENNTGSL-------------KMSTRKRASSA-----------------SYINKSRTHNIGESQIMESDN-----------PMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQ-WLNTCDVEDQI-----DNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLP-QHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQI------------NRIKP---------------------------LERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHL--------------------------------RSSFSRPSLSTNQQQTPVSSN---ISNTNTSQ---------DNSKKILKXXXXXXXXXX--XXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKS 6310
            E  ++E+ +  +  QL++   +G   TE E   C  +L+ Q+  +Y +R +  +  Q   S N LF WT++ L L  L+D  F   E  +  +R +D+ SP+P+ +   F TLWCR+ISLN DSW FQ+R+Y K    M DL++WG L  AE+ A    +R V V   +PW    + R+   +KF++DF+AD+    +CYG NWE  L W++   E I     D S P L WWD+ R  LHGRL+ VS+ M W    SL+PYN TEFF WQW+   V WE   + L G++ I  R+ASKYDG C L   P +++ I + W+   DP +H AV PC+ A +     T+HD+Y  FR+  L++ I       TS    P C+FYT+ILKF ++ + C+ +VARPIRRG  + Y   +KP+ GR  +L+    N P L + YW+S A +TGVH+ TGP+ LS++  L                            ++ I+   L  RP ++WS++++      S+IR        G  V L+ K A+    D   ++   + +     D        +F+++  L YD++ S S    +Q+          TS ++  L+               P++T  S Q          L P H L + DLK+RWT+  RNLVY ++D Y+H   L++NLSA+A ++IQL+    + S     T   +L  R  T          N  D+R++ + ++L  N++  L             +M     A S                  S  + SR H   +S+     N           PML QLL+EVDTA+ YA+CEEE K  NV+D+L G+ +C  ++  +R WH+EL+NSQ++LKT+  + Y +V+AA+ +LD+  H PIWKD+QLL KSS+VG LECMQYYATV +V+  I   WL+T DV D        +ED LSG PEVVGCG +VGG+V   V     +  G   +   D +     +  +   IQLQRMIS+C C ++YV Y+ AD   LP  HLIPPLP +E ++  + EGA T+TLLH  LN  TNSLQYHMIV I+N+L+LYVEP+RKA+ +RN+V F L+SE Q ++ ILR+QE LR LV  Q R ER+LW  V E               +RI P                           LE  + NLKT I + N+ LSQ +A YQQ++I++QRR +                                  R+S S P+ ST   ++  S +    S    +Q          NS+++       S S+      +E++RRNEVCFEHA WRMTE+DGQIGL DVELR F+Y+K  R+DDSG+H  EL  ++V+SL  + F+KEVL+ D       GGP+LRI   E  PVGG+ V EAMEI +AP+VLQISK FY  MMP+FFP KA+E  V     N++ V +
Sbjct:    3 EQVKYEQNVTALHDQLQQ---SGLRLTEAERMACFARLEEQRLIEYRTRHTQFK--QEFPSTNELFTWTLNNLHLKLLTDYTFTTPEQIVDKIRQLDSCSPWPDLLASDFCTLWCRVISLNVDSWRFQLRDYPKPWLEMTDLFLWGPLAGAERCADWQGQRTVQVIPGNPWPEYTVARSCWPLKFYYDFTADLKTIHMCYGSNWEPTLAWLSQRLEDIFPRPWDMSVPRLAWWDRVRHLLHGRLYIVSESMHWLCATSLNPYNATEFFTWQWSQSTVCWETGHFRLGGDVDILYRTASKYDGVCHLFHLPGMEMNIFLDWLSLHDPLDHHAVKPCNSARLAEMGITNHDSYRHFRANRLSMRITCSVHPPTSPASRPWCLFYTSILKFADRLRMCLTKVARPIRRGSVFGYQPLRKPLFGRLLQLMEFTFNLPHLEVAYWVSYANRTGVHLTTGPVHLSSETRLIVEGETKVPLIRGTSSGAMVQPFVMFAPMRPIQHSGLIRRPIASWSVIRLSASVHDSRIRLRHNPNLPGQVVQLLLKSAKPIRVDPLLNQTGLTASLETETDQAAADTAEDFLMVPLLHYDQVGSTSPPPPDQSVRVHIPGRRATSTNAGNLDASGDLLQSSPNSTAAPSETEYSTQIVGEKLTHENLTPTHRLVVNDLKLRWTEHTRNLVYILMDTYQHAQSLKRNLSARATRAIQLRQGIPVTSPRNWSTSALNLGFRGTTPSVASDLFAQNSSDQRADPTNMSLHTNDSEELVGGVDVIDTPRDLRMDIGTHAGSPIRTHSRTSNEGSNREELSTTSGSRMHWASQSETSVQSNHSGLSGGLEQIPMLAQLLEEVDTARFYAYCEEEPKQTNVIDQLHGLTICSESLVTARNWHVELLNSQLLLKTDNLAGYILVTAARAKLDALTHPPIWKDAQLLNKSSLVGHLECMQYYATVGQVDPGIPDLWLSTPDVADWAHVSVNADEDELSGRPEVVGCGHSVGGVVTARV-----VVGGTPRATAMDTTPASEARIHHAPYIQLQRMISRCCCEIFYVHYEPADSSNLPPAHLIPPLPFDETKVVRTQEGADTVTLLHHTLNICTNSLQYHMIVGIVNNLLLYVEPQRKAQLERNRVAFGLMSESQARSAILRNQEVLRCLVAEQRRLERDLWSFVRETMAVLELDRVAAVSQDRIIPGLPDLVQCRQPSENAAILALSIHYARHLEAQVTNLKTRIVDCNALLSQRLAQYQQLQIRAQRRHMRSAMSGTHSPHTTGASLTTSASASSLLKQHRKGDRASLSPPTSSTAPHKSDSSMSRLAASGGGPTQPGEYFAGDSSNSEQLPTQLQRESLSIKNDPYPAEIVRRNEVCFEHARWRMTEHDGQIGLADVELRGFLYAKTHRQDDSGSHWLELGWIRVDSLGPDSFYKEVLLPDVGGGHYAGGPILRIACSELAPVGGLSVKEAMEISVAPMVLQISKQFYRVMMPYFFPEKADE-SVPAAPGNLTPVTT 1487          

HSP 2 Score: 90.8929 bits (224), Expect = 5.036e-14
Identity = 44/82 (53.66%), Postives = 57/82 (69.51%), Query Frame = 2
Query: 6887 DSSSNTVSK--DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIKKSI 7123
            D  SNT     +P+++M ERA+QN +FLY+KI GFPI LSY+GEKQK    +  F LNI  +E+HN +WTWLD  ME+K  I
Sbjct: 1719 DYRSNTTPGIVNPVEVMRERARQNNVFLYIKIPGFPICLSYKGEKQKNLTDVTRFQLNIPTMEHHNCVWTWLDFAMEVKTRI 1800          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-259g3.4 (si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8118])

HSP 1 Score: 579.326 bits (1492), Expect = 2.890e-170
Identity = 429/1537 (27.91%), Postives = 737/1537 (47.95%), Query Frame = 2
Query: 1754 VCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTK-------SVPSEPTMKSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEV----VPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQ-LDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXX--XXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLE----EDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNL----KTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + +++ + + +  +   L V   D +   W  S HM L +         ++V ++   K       S    P    ++ +EL N  +L   +  ++ II+ +D +      + + +    +  + DG  I T   FS  E+    VP ++ ++ + +   LT   NRAW      + + FPY+Y F+  +   IS++K++K +H    +  K+        + +PPD +    +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT++ L L+ L+D   +G E   + +R ID  SPFP E +     WCR +     ++  ++R+Y + L+ ++D  + GRL+  EQ      +R   V++  PW  V + RN+P +KF++D ++++   TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     D  + +   + DPYN TE  HW+WN +  +W   ++V +G++ +  R+ASKYD  C  +  PNL + +++ W+C+G+P++H  V  C   + A VT+   HD+Y  FRS NLNL I    N N  +    P+ + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++     P+L + YW S A++ G+ +      + T+    L      +  R  S W++ QM S++       +   ++E +D +  ++  ++     +   +  +                         N   +  T  D T++S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK ++        +DT++        Q    KR  +     +     +I                  + I   ++HN G S        MLQ+L++E D  K   F EE+S    V D+L G+A C+++   +R W +EL+N Q+ML+  ++    +VSAA+ +L   EH+P W +  L  K++    L+CMQY+AT+E   S   ++  WL   ++E+    +  L    E++  G+AVGG+V+T         T  +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP   +    ED +   +    T TL+H+ L   TN +QY MI++I+N+L+L+VEPRRK   +     R ++E S   EEQ +++IL  QE +R  V    R E++++  +    IN +  +   ++N     KTD++ K+  L+  I  ++  ++Q   + + LR                           +D S                    V+RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  425 ILSLSSLAVSYQNTSRTLEVQSKDSLALHWTPSDHMFLYQHVCESRSCWSSVSVVLNVKQKETHSDSTALSPLGAPNVCVELAN-TKLTAHVGDQNYIIIHADGLSVSKQNETTNVKAPRLVFNFDGNDIFT---FSDPELQMLDVPPSELQEHRARFPFLTTPNNRAWIFYFPSLTVEFPYQYNFSSTFDKAISVQKWLKSLHRGVAEPPKT--------ERLPPDLLFRVVQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDRKVAELRKQHGELLPARKIEELYSSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTLNQLELVVLADQSLHGVERVRQLLREIDGVSPFPREGLPLLVQWCRAVRFKVAAFLVRIRDYPRYLFEIRDWELSGRLIGTEQDGQLRGRRKEVVQLGQPWGEVTVHRNVPPLKFYYDLTSNVFLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWHMNIDQANLHQLATEDPYNTTENMHWEWNKLDFDWNPGQFVFKGDMDVNVRTASKYDDIC-FLHLPNLCMTLDLQWLCHGNPHDHHGVMLCCADNIADVTSGQPHDSYRAFRSENLNLSITMDLNQNADAGSCQPQILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRKKLGQHYKQMSYTAAFPKLQVHYWASFAQQRGIQLECSKGQIFTRGSQRLIPQAGTVMRRLISEWNVTQMVSELSLVTVHLMSSTSDETADHQINAQVKKTHLLSLSSLSYQRQS------------------------NRIEEEVTSKDETNSSYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLR--------IDTQL--------QAKKLKRTMSTYSSSAPPSTPVIH-----------------TVIRPEKSHNEGTS--------MLQKLIEETD--KFVVFSEEDS---GVSDQLCGIAACQTDDVYNRNWFIELVNCQMMLRGTETVGCVLVSAAKAQLLQCEHLPAWYNDTLKQKTTWTCSLDCMQYFATMEPNPSEKEDVQLWLEVKNIEEH--RQRNLDSVQELMESGQAVGGMVST---------TTDWNQPSLVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATQIKPPEVRDRHEKEDLLKKQAGAVDTFTLIHNELEISTNPVQYAMILDIVNNLLLHVEPRRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHVAQIRRLEKQIYSNIRVSLINELSDINLRLQNQLNQEKTDLQMKSEELNILIRCFKDFQLQRANK-MELR------------------------KPPEDVS--------------------VVRRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1800          

HSP 2 Score: 58.9214 bits (141), Expect = 8.821e-8
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+YVKI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1864 DDIDKMKERAAMNNSFIYVKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 1930          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-259g3.4 (si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-8118])

HSP 1 Score: 552.747 bits (1423), Expect = 1.364e-160
Identity = 423/1531 (27.63%), Postives = 730/1531 (47.68%), Query Frame = 2
Query: 1754 VCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTK-------SVPSEPTMKSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEV----VPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQ-LDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPC---DPAHVTTTD-HDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLI-YWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPL---EEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            + +++ + + +  +   L V   D +   W  S HM L +         ++V ++   K       S    P    ++ +EL N  +L   +  ++ II+ +D +      + + +    +  + DG  I T   FS  E+    VP ++ ++ + +   LT   NRAW      + + FPY+Y F+  +   IS++K++K +H    +  K+        + +PPD +    +F     DD FE +L DNY L++DE++E  KR+  +  ++ +L K  G        + LY  L+ +    YI R   L A        +L  WT++ L L+ L+D   +G E   + +R ID  SPFP E +     WCR +     ++  ++R+Y + L+ ++D  + GRL+  EQ      +R   V++  PW  V + RN+P +KF++D + ++   TI +GP W+     I  + +L+ + + DPSP L WWDKSRL LHGR     D  + +   + DPYN TE  HW+WN +  +W   ++V +G++ +  R+AS YD  C  +  PNL + +++ W+C+G+P++H  V  C   + A VT+   HD+Y  FRS NLNL I        +   P+ + Y++ L++ + F      V+RPI RG+ ++  R  +  LG+H++ ++     P+L  + YW S A++ G+ +      + T+    L   +  +  R  S W++ QM S++       +   ++E +D +  ++  ++     +   +  +                         N   +  T  D T++S +       H L LVDL+  WT TNRN+ + + D Y+   +L++NLS +ALK ++        +DT++        Q    KR                        MST    SS++  +    H +   +   ++  MLQ+L++E D  K   F EE+S    V D+L G+A C+++   +R W +EL+N Q+ML+  ++    +VSAA+ +L   EH+P W +  L  K++    L+CMQY+AT+E   S   ++  WL   +   Q +    L    E++  G+AVGG+V+T            +N P+    ++           Q+QR+IS+CSC +YY+ Y       L   + PP      E++++        T TL+H+ L   TN +QY MI++I+N+L+L+VEPRRK   +     R ++E S   EEQ +++IL  QE +R  V                 QI R++  ++I  N+++  EE        I +  Q ++  ++ DL ++S      +     Q   ++ +      +D S                    V+RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   +  +       LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct:  575 ILSLSSLAVSYQNTSRTLEVQSKDSLALHWTPSDHMFLYQHVCESRSCWSSVSVVLNVKQKETHSDSTALSPLGAPNVCVELAN-TKLTAHVGDQNYIIIHADGLSVSKQNETTNVKAPRLVFNFDGNDIFT---FSDPELQMLDVPPSELQEHRARFPFLTTPNNRAWIFYFPSLTVEFPYQYNFSSTFDKAISVQKWLKSLHRGVAEPPKT--------ERLPPDLLFRVVQFSFVFLDDVFEIKLRDNYELMKDESKESAKRLQLLDRKVAELRKQHGELLPARKIEELYSSLERKHIEIYIQRSRRLYANTPMR--KSLLTWTLNQLELVVLADQSLHGVERVRQLLREIDGVSPFPREGLPLLVQWCRAVRFKVAAFLVRIRDYPRYLFEIRDWELSGRLIGTEQDGQLRGRRKEVVQLGQPWGEVTVHRNVPPLKFYYDLT-NVFLYTIVWGPCWDPAWTLIGQAVDLLTKPTADPSPLLTWWDKSRLLLHGRWHMNIDQANLHQLATEDPYNTTENMHWEWNKLDFDWNPGQFVFKGDMDVNVRTAS-YDDIC-FLHLPNLCMTLDLQWLCHGNPHDHHGVMLCCADNIADVTSGQPHDSYRAFRSENLNLSI----TMDLNSCQPQILLYSSTLRWMQNFWATWTSVSRPICRGKLFHSLRPSRKKLGQHYKQMSYTAAFPKLQQVHYWASFAQQRGIQLECSKGQIFTRGSQRLIP-QGTVMRRLISEWNVTQMVSELSLVTVHLMSSTSDETADHQINAQVKKTHLLSLSSLSYQRQS------------------------NRIEEEVTSKDETNSSYT-------HKLCLVDLRASWTTTNRNIAFGLYDGYKKAAVLKRNLSTEALKGLR--------IDTQL--------QAKKLKRT-----------------------MST---YSSSAPPSTPVIHTVIRPEKSHNETSMLQKLIEETD--KFVVFSEEDS---GVSDQLCGIAACQTDDVYNRNWFIELVNCQMMLRGTETVGCVLVSAAKAQLLQCEHLPAWYNDTLKQKTTWTCSLDCMQYFATMEPNPSEKEDVQLWLENIEEHRQRN----LDSVQELMESGQAVGGMVSTTT----------WNQPSLVQETQ-----------QVQRIISRCSCRMYYIGYSHDIDPELATQIKPPEVRDRHEKEDLLKKQAAVDTFTLIHNELEISTNPVQYAMILDIVNNLLLHVEPRRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHV----------------AQIRRLE--KQIYSNIRSQPEEMRGDELSDINLRLQNQLNQEKTDLQMKSEELNILICFKDFQLQRANKMELRKPPEDVS--------------------VVRRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSPCQSG-RQLALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1940          

HSP 2 Score: 58.9214 bits (141), Expect = 8.899e-8
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+YVKI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 2003 DDIDKMKERAAMNNSFIYVKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 2069          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Nematostella
Match: EDO41905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Y0])

HSP 1 Score: 375.941 bits (964), Expect = 2.329e-111
Identity = 260/917 (28.35%), Postives = 455/917 (49.62%), Query Frame = 2
Query: 2678 NLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPER-ITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDW--YYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHV----TTTDHDTYYFFRSRNLNLDIXXXXX-----XXXXXXXPRCIFYTNILKFFEKFKTCI-XXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLK-VWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLV--DLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVD-KLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATV---EKVNSNISQWLNTCDVEDQIDNED--LLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDR-ADPIG--LPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNS 5353
            NL +W   GL L  L+D  ++G E A+R M  ++ +SP+P   + FSTLWCR +     S C+++R+Y + +++   + + G +V AEQ+A++ +KR   +E+D PW ++ ++R++   KF++D   D++   + +G + +     + ++++ I+++S DPS PLPW+DK RL +HGRL  V  V +W  Y+  + +PY+ TE     W    + W N + V++G+  +  R+ASKYD D +++  P  ++  ++ W+C+GDPN+H  V PC P  +        HD+Y  FRS+NL+L++   +             P    Y +  ++F+K++  + + V+RPI+RG Y+N  R  K  LGRH++ + + L  P L++ YW S  ++ GV +  G  SL TQ+ L L  ++D L  R  ++W+  ++   +      V+ +++ +         E+    +E  + DL  E  +Y F+    L+Y R  +  N                   +  DQ  Q I+  +LV   LK  W+QT+R +++ + + Y +  +L+KNLSA ALK                                  +V+++ NS+ +  E+             S  S   KSR+ +            +LQ+L+ E DT K  A+ EE S  V   +  L GVA+C ++  I+  WH++L+NSQ++LK  ++    +V+A  T + S  H P+W   +L  K +  G +E +QY+ATV   + V+ +   WL+T  +  +   +    ++   ++VG G+AVGG++   VG                     +T        QLQR++++C C  YYV++    DP+   +    +PP P          +   T T+ H  L   TNS
Sbjct:    4 NLLRWEFRGLDLKVLADQSYHGKERAVRAMSTLNQNSPYPSGGLEFSTLWCRTVLGTLTSHCYRLRDYPRPIFSSTCVKLSGTVVGAEQTAADRAKREAIIEIDKPWGHMTVQRSLTAFKFYYDLDFDVDTLEMAWGVDTDPATTMVTLAFDNISKASADPSKPLPWFDKVRLLMHGRLHLV--VKEWLMYFSATRNPYDITERLEVDWTNCDILWTNGRLVIDGDFDLQTRTASKYD-DRRVLHLPAFKVCADMKWLCSGDPNDHHTVMPCAPEKIPELAPNQAHDSYALFRSQNLSLNLSLETAIDPSENAGRLGPPTVYLYASTFRWFKKYQAVVFQSVSRPIKRGLYFNRPRMSKQSLGRHYKKVTLSLRFPALSVWYWGSFTQQRGVSLSCGQGSLHTQYRLHLHPLDDGLTRRQAADWTATKLHIDMSDVTSHVYGVEQPDG-------QEEGEEASEVSSIDL--EPTKYYFLTAERLEYSRQDTTKN----------------PKKNAEDQNEQQIYGHRLVCHGLKGAWSQTSRQILFGLFEAYTNAEILKKNLSADALKV--------------------------------TIVEQKKNSQDSPAES------------GSVHSRSGKSRSVS------------LLQKLVSERDT-KFTAYTEEGSDKVEQKEIPLQGVAMCNTDDVIAHSWHIKLVNSQILLKGIETRGCVLVTAGSTTVLSRLHQPVWDKGELFNKKTWAGTVENVQYFATVSTGDTVSLDSIPWLDTTVITGRQPQKTGFGIADLADIVGSGEAVGGVITAVVG--------------------GATAGAGQEVPQLQRIVARCGCDFYYVNFSTDLDPLAREMATSHVPPSPANSHLRVGRQQMINTFTIRHKLLEISTNS 815          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Nematostella
Match: EDO35088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMK5])

HSP 1 Score: 69.707 bits (169), Expect = 5.679e-12
Identity = 32/69 (46.38%), Postives = 45/69 (65.22%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFA-INNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D L+ M ERA +N  F+YVK+    + +SY+GEK+K    + +F L I  +EYHN+ WTW DL M +KK
Sbjct:   35 DDLEKMKERASKNNSFIYVKVTEVALCVSYKGEKEKNITDVRDFNLTIPTLEYHNRTWTWHDLLMAMKK 103          
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Medaka
Match: si:ch211-259g3.4 (KIAA0100 ortholog [Source:NCBI gene;Acc:101164175])

HSP 1 Score: 353.214 bits (905), Expect = 1.693e-97
Identity = 227/761 (29.83%), Postives = 394/761 (51.77%), Query Frame = 2
Query: 2108 DGRQIVTVMNFSWKEVVPTNKYRQDKEKLK-LTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQ-LDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFP-ERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVS-DVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAH----VTTTDHDTYYFFRSRNLNLDIXXXX--XXXXXXXXPRCIFYTNILKFFEKFKTCIXXXXXXXXXXXYYNYFRRKKPVLGRHFRLINVKLNTPQLNLIYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMKSQIRRGLKVWLIQKA-EEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQ 4357
            DG  IV+      +      + +  +E    LT   NR W      + I FPY+Y F++ +   IS++K++K +H       + N   +  R  +PPD +    +F     DD FE +L DNY L++DEN+E  KR+  +  ++ +L +  G        + LY  L+ +    YI R  S R         +L  WTIS L  ++L+D   +G E  +  +R++D  SPFP + ++    WCR +     ++  ++R+Y + L+ +++  + GRL+  EQ     + R+ T+ +  PW +V + RN+P +KF++DF + +   TI +GP W+     I  S +L+ + + DPSPPL WWDKSRL LHGR WF+  +  + +   + DPYN TE  HW+W+ +  +W   ++V +G L +  R+ASKYD  C  +  PNL + +++ W+C+G+P++H AV PC   +    ++   HD+Y  FRS NLNL I  +   +  +    PR + Y++ L++ + F      V+RPI RG+ +   +  +  LG+H++ ++     PQL + YW S+A++ G+ +     ++ T+    L      +  R  S W++ QM S++ + + V L+  A +E ++++  +++ ++                  + LS L Y R S            D     D T+ S +       H L+LVDL+  WT TNRN+ + + D Y+  ++L++NLS +ALK +++  Q
Sbjct:  552 DGNDIVSFNGLDVEAHAELTELQMHRETFSFLTTPHNRVWVFTCPSLSIEFPYQYNFSRTFDKAISVQKWLKSLH-------RPNRTSTAER--LPPDLVFKVAQFSFVFLDDVFEIKLRDNYELMKDENKESAKRLHLLDKKVAELRRQHGELLPARKIEELYSSLEKKHIEIYIQR--SRRLYVNTPMRKSLLTWTISDLEFVALADHSLHGPEKVMEQLRDLDGISPFPRDGLSLVIQWCRAVKFKLSAFLVRIRDYPRYLFEIRNWELSGRLLGTEQDGHPRAVRNETIPLGLPWGDVTVRRNVPPLKFYYDFRSTIQNYTIVWGPCWDPAWTLIGQSVDLLTKPTVDPSPPLTWWDKSRLLLHGR-WFMDIEQANLHQLATEDPYNTTENLHWEWSRLNFDWTPGQFVFKGNLNVNVRTASKYDEIC-FLKLPNLCMTLDLQWLCHGNPHDHHAVMPCCAENIADVISGLPHDSYRAFRSENLNLSITMDLNHHSGTGPLLPRILLYSSTLRWMQNFWATWTSVSRPICRGKLFQSLKPVRRKLGQHYKQMSYTAAFPQLEVFYWASVAQQRGIQVECSKGNVFTRGTQRLISQAGTVMRRLISEWNVTQMVSELSQ-VTVHLMASAWDETAENQVNAQRKKT----------------HLVSLSSLSYQRQSK---------RMDEEVSKDETNASYT-------HKLRLVDLRASWTTTNRNVAFGLYDGYKKASVLKRNLSTEALKGLKIDTQ 1266          

HSP 2 Score: 246.514 bits (628), Expect = 9.723e-65
Identity = 180/574 (31.36%), Postives = 296/574 (51.57%), Query Frame = 2
Query: 4598 MLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNS---NISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPL----PLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDD-----RNKVEFSLLSEEQLKTTILRSQEYLR-NLVHYQMRYERELWKVV---VEEQIN-RIKPLERIIKNL----KTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGK 6256
            MLQ+L++E D  +   F EE+S    V D+L G A C+++   +R W +EL+N Q+ML+  +++   +VSAA+ +L   EH P W +  L  K++    L+CMQY+AT+E   S   +   WL   ++E+    +  +    E++  G+AVGG+V+T         T  +N P + N S+           Q+QR+IS+CSC ++Y+SY       L   + PP       +ED ++  +    T TL+H +L   TN +QY MI++I+N+L+L+VEPRRK   +     R ++E S   EEQ +++IL  QE +R +LV  ++  E++++ +V   +E+Q N  +  L   ++N     K D++ K+  L+  I  ++  ++Q   + L LR                           +D S                    V+RR E+ F  A W +TE DGQ+G+ ++EL+ F+YSK+ + DD+  H  EL    + +L+ N  +K VL   ++ ++      LRI    R PVGGI V E  E+ + PL +Q+   F+  MM FFFPG+
Sbjct: 1288 MLQKLIEETD--RFVVFSEEDS---GVSDQLCGTAACQTDDVYNRNWFIELVNCQMMLRGTETAGCVLVSAAKAQLLQCEHHPAWYNDTLKQKTTWTCLLDCMQYFATMEPNPSEQMDKQLWLEVKNIEEH--RQRNMDSVMELMEGGQAVGGMVST---------TTDWNQPAQGNESQ-----------QVQRIISRCSCRMHYISYSHDINPELATQIKPPDLRNNHQKEDLLNKQAGAVDTFTLIHHDLEISTNPVQYAMILDIVNNLLLHVEPRRKEHSEKKQRVRFQLEISSNPEEQ-RSSILHLQEAVRQHLVQIRL-LEKQIYSIVKAQLEDQPNDDLTELHNTLQNQLNQEKNDMQMKSEELNILIRCFKDFQLQRANK-LELR------------------------KPPEDVS--------------------VVRRTEIYFAQARWCLTEEDGQLGIAELELQRFMYSKLNKSDDTAEHLLELGWFTMNNLLPNAAYKVVLRPQSTCQLGRQF-ALRIFSKVRPPVGGISVKEHFEVNVVPLTIQLMYQFFKRMMGFFFPGR 1786          

HSP 3 Score: 58.151 bits (139), Expect = 1.390e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query: 6914 DPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKK 7117
            D +  M ERA  N  F+Y+KI   P+ +SY+GEK  +    +  L +  +EYHN  WTWLD  M +K+
Sbjct: 1846 DDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEK-SSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKR 1912          
BLAST of Fmp27_GFWDK domain-containing protein vs. Planmine SMEST
Match: SMESG000004754.1 (SMESG000004754.1)

HSP 1 Score: 2198.71 bits (5696), Expect = 0.000e+0
Identity = 1136/1137 (99.91%), Postives = 1137/1137 (100.00%), Query Frame = 2
Query: 3923 MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFXXXXXXNLKVEDVINNQRTDKINRTPDVXXXXXXXXXXXXQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIXXXXXXXXXXXXXXIRKNPFSLVTSSSFNQIXXXXXXXXXXXXXLLGVHALPKEVSKKRPNLIKRVILKK 7333
            MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRT+NIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKSQSTSSDSMIRSSSEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFSSYSSSNLKVEDVINNQRTDKINRTPDVISSDYYIPIDSSQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIKKQLVLEVLKQKFKIRKNPFSLVTSSSFNQIMKEEDREKKKMEMLLGVHALPKEVSKKRPNLIKRVILKK
Sbjct:    1 MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTNNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKSQSTSSDSMIRSSSEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFSSYSSSNLKVEDVINNQRTDKINRTPDVISSDYYIPIDSSQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIKKQLVLEVLKQKFKIRKNPFSLVTSSSFNQIMKEEDREKKKMEMLLGVHALPKEVSKKRPNLIKRVILKK 1137          
BLAST of Fmp27_GFWDK domain-containing protein vs. Planmine SMEST
Match: SMESG000004754.1 (SMESG000004754.1)

HSP 1 Score: 2193.7 bits (5683), Expect = 0.000e+0
Identity = 1136/1139 (99.74%), Postives = 1137/1139 (99.82%), Query Frame = 2
Query: 3923 MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKXXXXXXXXXXXXXXEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFXXXXXXNLKVEDVINN--QRTDKINRTPDVXXXXXXXXXXXXQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIXXXXXXXXXXXXXXIRKNPFSLVTSSSFNQIXXXXXXXXXXXXXLLGVHALPKEVSKKRPNLIKRVILKK 7333
            MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRT+NIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKSQSTSSDSMIRSSSEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFSSYSSSNLKVEDVINN  QRTDKINRTPDVISSDYYIPIDSSQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIKKQLVLEVLKQKFKIRKNPFSLVTSSSFNQIMKEEDREKKKMEMLLGVHALPKEVSKKRPNLIKRVILKK
Sbjct:    1 MKSQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFIILSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVDLKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDTKVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASSASYINKSRTNNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNVVDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLDSYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVEDQIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSKHSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEEDEISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARDDRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQINRIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSRPSLSTNQQQTPVSSNISNTNTSQDNSKKILKSQSTSSDSMIRSSSEVIRRNEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTVKVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAMEICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELRRIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFTNLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTTEISNFEDINDTIDSKPKFSSYSSSNLKVEDVINNQYQRTDKINRTPDVISSDYYIPIDSSQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQLMAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNKLWTWLDLNMEIKKSIKKQLVLEVLKQKFKIRKNPFSLVTSSSFNQIMKEEDREKKKMEMLLGVHALPKEVSKKRPNLIKRVILKK 1139          
BLAST of Fmp27_GFWDK domain-containing protein vs. Planmine SMEST
Match: SMESG000004753.1 (SMESG000004753.1)

HSP 1 Score: 2005.72 bits (5195), Expect = 0.000e+0
Identity = 1028/1032 (99.61%), Postives = 1030/1032 (99.81%), Query Frame = 2
Query:  560 RNLNLTWNKCYASILQPSDAIEDMRFSESTDTLKMINLDLDMEKVQSMNDIPAEELLKFKTGCYGLNIXXXXXXXXXWRRLELSGQADLGSLSVKCRIDNPCLIINIDELAFWNELFIDANALFNQLFPKSKKNVIXXXXXXXXXXXXXXXLHYTLKLEVNCSHRGQTINSDSLALIQIINNSFEDGLELGLKTLVASYEADTSHNDADKLIQSIDLYSDINTAYCKLINDSSSNRIDYIDYFHRWESAIFMGNVFVWVHKNRAGCLMNQVQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQSGSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIEIDFKFCGTVYDMIDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVMNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTIXXXXXXXXXXXXFYGAENAIRHMRNIDADSPFPERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVTPCDPAHVTTTDHDTYYFFRSRNLNLDIXXXXXXXXXXXXPRCIFYTNILKFFEKFKTCI 3655
            RNLNLTWNKCYASILQPSDAIEDMRFSESTDTLKMINLDLDMEKVQSMNDIPAEELLKFKTGCYGLNISSSVSTTTSWRRLELSGQADLGSLSVKCRIDNPCLIINIDELAFWNELFIDANALFNQLFPKSKKNVISSQEKSQSSQFKFPSLHYTLKLEVNCSHRGQTINSDSLALIQIINNSFEDGLELGLKTLVASYEADTSHNDADKLIQSIDLYSDINTAYCKLINDSSSNRIDYIDYFHRWESAIFMGNVFVWVHKNRAGCLMNQVQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQSGSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIEIDFKFCGTVYD+IDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTV+NFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSN IGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTISGLSLMSLSDSDFYGAENAIRHMRNIDADSPFPERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQL INIFWICNGDPNNHFAVTPCDPAHVTTTDHDTYYFFRSRNLNLDIEFNSNETSSEEFPRCIFYTNILKFFEKFKTCI
Sbjct:  314 RNLNLTWNKCYASILQPSDAIEDMRFSESTDTLKMINLDLDMEKVQSMNDIPAEELLKFKTGCYGLNISSSVSTTTSWRRLELSGQADLGSLSVKCRIDNPCLIINIDELAFWNELFIDANALFNQLFPKSKKNVISSQEKSQSSQFKFPSLHYTLKLEVNCSHRGQTINSDSLALIQIINNSFEDGLELGLKTLVASYEADTSHNDADKLIQSIDLYSDINTAYCKLINDSSSNRIDYIDYFHRWESAIFMGNVFVWVHKNRAGCLMNQVQLEWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQSGSLMSAFAKMDLEMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIEIDFKFCGTVYDIIDENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDKVDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIELGNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVTVLNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFNQCYHDIISIKKFIKKVHSNKIDSDKSNAIGSEVRQAIPPDYIICFKEFQLQLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVEYRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTISGLSLMSLSDSDFYGAENAIRHMRNIDADSPFPERITFSTLWCRMISLNADSWCFQMREYLKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPTIKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWWDKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMKWVLEGELGIFCRSASKYDGDCQLIAWPNLQLNINIFWICNGDPNNHFAVTPCDPAHVTTTDHDTYYFFRSRNLNLDIEFNSNETSSEEFPRCIFYTNILKFFEKFKTCI 1345          

HSP 2 Score: 365.155 bits (936), Expect = 3.798e-103
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = 1
Query:    1 KKSKKYFTIVCDKIIFNSNFNDFYGISKILXXXXXFSTITEKNNSSKQINWFIKATKLYMLEIKQIVFLIKLSPTEKSPVIYLSGDDVQLCAIPETNRINSQLSVGTATGKIICPSLSNGQWNLLANFRSQINFDFIFIKKQKLLLHKFLMTIGSTKLLLLEEIFHELAQVTKYNYVEQPIVIDKVKKS 567
            KKSKKYFTIVCDKIIFNSNFNDFYGISKILKKKKKFSTITEKNNSSKQINWFIKATKLYMLEIKQIVFLIKLSPTEKSPVIYLSGDDVQLCAIPETNRINSQLSVGTATGKIICPSLSNGQWNLLANFRSQINFDFIFIKKQKLLLHKFLMTIGSTKLLLLEEIFHELAQVTKYNYVEQPIVIDKVK+S
Sbjct:   91 KKSKKYFTIVCDKIIFNSNFNDFYGISKILKKKKKFSTITEKNNSSKQINWFIKATKLYMLEIKQIVFLIKLSPTEKSPVIYLSGDDVQLCAIPETNRINSQLSVGTATGKIICPSLSNGQWNLLANFRSQINFDFIFIKKQKLLLHKFLMTIGSTKLLLLEEIFHELAQVTKYNYVEQPIVIDKVKES 279          
The following BLAST results are available for this feature:
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KIAA01002.118e-16129.98KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960][more]
KIAA01002.323e-16129.91KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960][more]
KIAA01001.295e-16029.98KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960][more]
KIAA01001.462e-3031.01KIAA0100 [Source:HGNC Symbol;Acc:HGNC:28960][more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F31C3.39.360e-14026.13pep chromosome:WBcel235:I:15041433:15050700:-1 gen... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hob7.127e-1230.43gene:FBgn0035420 transcript:FBtr0346807[more]
hob7.127e-1230.43gene:FBgn0035420 transcript:FBtr0302302[more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-259g3.49.672e-16628.06si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
AL954372.13.397e-16328.45pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:... [more]
AL954372.17.125e-16327.27pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:... [more]
AL954372.11.461e-16228.45pep chromosome:GRCz11:CHR_ALT_CTG15_1_11:16118756:... [more]
si:ch211-259g3.42.799e-16228.66si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA01008.784e-16427.20KIAA0100 [Source:NCBI gene;Acc:100494392][more]
KIAA01001.742e-16327.20KIAA0100 [Source:NCBI gene;Acc:100494392][more]
KIAA01003.373e-16129.05KIAA0100 [Source:NCBI gene;Acc:100494392][more]
KIAA01006.574e-16128.92KIAA0100 [Source:NCBI gene;Acc:100494392][more]
KIAA01009.915e-16128.92KIAA0100 [Source:NCBI gene;Acc:100494392][more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
2610507B11Rik9.480e-15829.64RIKEN cDNA 2610507B11 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q14667|K0100_HUMAN6.218e-16029.98Protein KIAA0100 OS=Homo sapiens OX=9606 GN=KIAA01... [more]
sp|Q5SYL3|K0100_MOUSE6.631e-15729.64Protein KIAA0100 OS=Mus musculus OX=10090 GN=Kiaa0... [more]
sp|Q6IMT1|SAB_ARATH5.555e-723.51Protein SABRE OS=Arabidopsis thaliana OX=3702 GN=S... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EVW92.564e-1534.77Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EU022.464e-1534.77Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QV060.000e+035.38Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2L7U44.777e-1437.23Fmp27_GFWDK domain-containing protein OS=Opisthorc... [more]
A0A4S2L8Q95.036e-1437.23Fmp27_GFWDK domain-containing protein OS=Opisthorc... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-259g3.42.890e-17027.91si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
si:ch211-259g3.41.364e-16027.63si:ch211-259g3.4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO419052.329e-11128.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350885.679e-1246.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-259g3.41.693e-9729.83KIAA0100 ortholog [Source:NCBI gene;Acc:101164175][more]
back to top
BLAST of Fmp27_GFWDK domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000004754.10.000e+099.91SMESG000004754.1[more]
SMESG000004754.10.000e+099.74SMESG000004754.1[more]
SMESG000004753.13.798e-10399.61SMESG000004753.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033936 ID=SMED30033936|Name=Fmp27_GFWDK domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=7561bp
AAAAAATCAAAAAAATATTTTACGATTGTATGTGATAAAATAATTTTCAA
CTCAAACTTCAATGACTTTTATGGAATTTCTAAAATTTTGAAAAAGAAAA
AGAAATTTTCAACCATAACCGAGAAGAATAATTCATCAAAGCAAATTAAC
TGGTTTATTAAAGCAACTAAATTATACATGCTTGAAATCAAACAAATCGT
GTTCCTCATCAAATTATCTCCAACTGAAAAGTCACCAGTGATTTATTTGT
CTGGCGATGACGTGCAGTTATGCGCTATTCCTGAGACCAATAGAATCAAT
TCGCAATTATCTGTTGGAACGGCAACCGGTAAAATAATTTGCCCATCACT
CTCCAATGGTCAATGGAATTTATTGGCAAATTTTCGCTCGCAAATTAATT
TTGATTTTATTTTCATTAAAAAACAAAAACTTCTTTTGCATAAATTTCTA
ATGACAATTGGATCGACGAAATTATTATTGTTAGAAGAAATCTTCCACGA
ATTAGCACAAGTTACGAAATATAATTATGTAGAGCAACCAATTGTCATAG
ACAAAGTAAAGAAATCTTAATTTGACCTGGAATAAATGTTACGCTTCTAT
TTTACAACCGAGTGATGCTATTGAAGACATGAGATTCTCGGAATCCACCG
ATACACTGAAAATGATTAATTTGGATCTTGACATGGAAAAAGTCCAGTCA
ATGAACGATATTCCAGCTGAAGAATTATTGAAGTTCAAAACTGGATGTTA
CGGTTTAAATATATCAAGCTCCGTGTCCACAACGACAAGTTGGCGACGCC
TAGAATTATCTGGACAGGCTGACTTAGGAAGTCTTTCAGTAAAATGCCGA
ATCGATAACCCATGCTTAATTATTAATATCGACGAATTAGCTTTCTGGAA
TGAACTTTTTATTGATGCAAATGCTCTTTTCAATCAACTTTTCCCGAAAT
CCAAAAAGAATGTGATAAGTTCACAGGAAAAGTCTCAATCTAGTCAATTT
AAATTTCCAAGTTTACATTACACTCTAAAATTAGAAGTCAATTGTAGTCA
CCGTGGACAAACTATCAATTCAGACTCTTTAGCTTTAATTCAAATTATTA
ACAATAGCTTTGAAGATGGTCTTGAGTTGGGTCTGAAAACTTTGGTGGCC
TCCTATGAAGCCGATACATCTCACAACGATGCAGATAAACTGATCCAATC
AATCGATTTATATTCGGACATCAATACGGCTTATTGTAAATTAATTAACG
ATTCAAGCTCAAATAGAATTGATTACATTGATTATTTCCATCGATGGGAA
AGTGCGATTTTCATGGGAAACGTTTTTGTCTGGGTGCATAAAAATCGAGC
GGGTTGCTTAATGAATCAAGTTCAACTTGAATGGTCAGATAGTCTTGCTG
GGGTCACACGAAAGATTTTTAACACTATTAGATCGGTGAAAAATATCGAC
TCAAATTCAGTGGGAAAAGAAAGTAATTTACGAAGTCAGTCCGGTTCATT
GATGTCAGCATTTGCTAAAATGGATCTCGAAATGAAATTAGAACATGTAG
ATCTTTTTGCTATCAGTTCGAAAAGAACATTCATCAGGCAAAAAGTCAAT
GTCATTCAATTGAATAAAACCAGCCGAGAATTAATAGAAATCGATTTTAA
ATTTTGTGGAACGGTCTATGATATGATAGATGAAAATCAAGAATTCTATT
CGACAACAACCGATTTCAATGACACTAGCACTCAGTCTCCGTACTTCAAA
CGCGTTTGTAATATTAATCAAATTAAAATGGAATTTTTCCCATCTAAATT
AGCTCTTTCAGTTCATTGTCTTGATAAAGTTGACTGTTTCTGGGATACAT
CTATTCACATGTGCCTTCGAGAGGCATTCGTTAATCTTCATAAAATTATC
ACCAATGTTAAATTATTACAGAAAACAAAATCGGTTCCATCCGAACCAAC
CATGAAAAGTCATATAATAATAGAGCTGGGAAATGGAGTCGAATTAAAAT
TTTGTATATCCAAAGAACACGATATAATTTTGAGAAGTGACATTATTCAT
TTTCATGTTAGCCAACAGCGTTCGAAAATTGTCACTCATAATGTTGAGAT
ACATTGTGATGGTCGTCAAATTGTTACAGTCATGAATTTTTCGTGGAAAG
AAGTCGTACCAACAAATAAATATCGGCAGGACAAAGAGAAGCTAAAACTA
ACGGATGCCACTAATCGGGCCTGGGAAATCCAAGCCGATAAAGTTCTCAT
ATCATTTCCATATAAATATATTTTCAATCAATGCTATCACGATATTATCT
CCATAAAAAAATTCATCAAAAAAGTTCATTCGAATAAAATTGACTCCGAT
AAATCAAATGGGATTGGATCAGAGGTCCGACAAGCCATTCCTCCGGATTA
TATTATTTGTTTCAAAGAGTTTCAATTGCAACTCAAAGATGATCCGTTTG
AATGTCAATTGCTGGATAATTACTTATTGTTGAGAGATGAAAATGAAGAG
CATGAAAAAAGAATTTTACGAATGAAAAGTCAACTGAAAAAGCTGGTGAA
GAATGGTGGAATTTATACAGAAGTTGAATATCGGAAATGCCTATATCAAT
TGGATCTCCAAAAACAGAGTCAGTATATATCAAGAATTTCATCTTTGCGT
GCTCGTCAAGCCAGAGAATCTGAAAACAATCTGTTTAAATGGACAATAAG
TGGTTTGTCGTTGATGTCACTGTCAGATTCCGATTTCTATGGTGCAGAAA
ATGCAATTCGGCACATGCGTAATATCGATGCTGATAGTCCTTTCCCTGAA
AGAATAACTTTTTCAACTCTGTGGTGTCGAATGATCAGTCTAAATGCCGA
CAGCTGGTGTTTTCAAATGCGTGAATATTTGAAATCTCTATGGACTATGA
AAGATTTATACGTCTGGGGAAGGCTTGTAGTTGCTGAACAATCGGCCAGC
GAAATATCTAAACGACATGTAACGGTTGAGGTCGATCATCCTTGGCACAA
TGTTATTATAGAACGTAATATGCCAACAATCAAATTTTTTCATGATTTTT
CTGCTGACATGAACGAAAATACAATTTGCTATGGACCGAATTGGGAATCT
TGCCTTCAATGGATCAATATTAGCTGGGAGCTAATTAACCGATCTTCCAG
AGATCCTTCGCCTCCTTTGCCATGGTGGGATAAAAGTAGATTGAGATTGC
ACGGACGATTATGGTTTGTATCTGATGTAATGGACTGGTATTATCCAGTA
AGTTTGGACCCATACAACAACACTGAGTTCTTTCATTGGCAATGGAACGG
CGTTCGTGTTAATTGGGAAAACATGAAATGGGTTCTTGAAGGAGAACTTG
GGATTTTCTGTCGATCAGCATCTAAATATGACGGTGACTGTCAATTGATT
GCATGGCCGAATTTGCAATTAAAGATAAACATATTCTGGATTTGCAACGG
TGATCCGAATAATCATTTTGCTGTTACTCCTTGTGACCCTGCTCATGTCA
CTACAACCGATCATGATACTTATTATTTTTTTCGATCACGAAATTTGAAC
TTGGATATTGAATTTAACAGCAACGAAACTTCAAGTGAAGAATTTCCTCG
TTGTATTTTTTATACCAATATCTTAAAATTTTTTGAAAAATTTAAGACAT
GCATTAGAAGAGTGGCCAGGCCTATTCGACGAGGGCGCTACTATAATTAT
TTTCGAAGAAAGAAGCCAGTATTAGGCCGACATTTCAGATTGATAAATGT
CAAACTCAATACTCCACAACTTAATTTGATTTATTGGCTATCTTTGGCCA
AAAAGACTGGAGTTCACATGATAACAGGTCCGATTTCCCTCTCTACTCAA
TTCCATTTGGAATTGAAGCAAATAGAAGATAATTTACATCATCGTCCGCA
GTCGAATTGGTCAATTGTTCAAATGAAGTCCCAAATACGACGAGGTCTTA
AAGTATGGTTAATTCAAAAAGCTGAAGAAGCATCGGATGACAAATGCCCA
TCAGAAAAATACAGATCATTTACAGAACACGATAATAAAGATTTATTTCA
CGAAAAATGTCGATACGAATTTATCATTTTATCTCATTTGAAATATGATC
GGTTGTCGTCTGACTCTAATCAAACCTTTCACAATACTTCTTACGATTCT
TCAACTTTAAATGATCCCACAGATACTTCAATGAGCGATCAAGAACTACA
ACCAATCCACAATTTGAAATTAGTAGACCTGAAAGTAAGATGGACCCAAA
CAAATAGAAATCTGGTCTATTCCATGATAGATATTTATCGGCACAAAACT
TTATTAAGAAAAAATCTATCAGCACAAGCATTGAAATCCATTCAGCTACA
AATACAATCAAATTCGTTTCTAGATACCAAAGTCAATTCGCTGTCTCATC
GGACTGAACAGGAATTTCCATACAAAAGAGTTCATAATTTGGTCGATGAA
CGCAGCAACAGTGAAATAAACCTGATTGAGAACAACACCGGTTCTTTAAA
AATGTCCACTCGTAAACGGGCAAGTTCAGCGAGTTATATCAATAAAAGCC
GAACGCACAACATCGGCGAATCTCAGATTATGGAAAGCGATAATCCGATG
TTACAACAATTATTACAAGAAGTTGACACTGCTAAACTCTATGCATTTTG
TGAAGAGGAATCTAAAGATGTTAATGTTGTCGACAAATTGACTGGAGTTG
CACTATGTAAAAGTAATGTAAAAATATCAAGAAAATGGCACCTTGAGTTG
ATTAACAGCCAGGTGATGTTAAAAACAAATCAATCATCTGTATATGCAAT
TGTATCTGCTGCTCAAACCCGGTTGGATTCGTACGAGCACATGCCCATTT
GGAAGGATTCGCAGTTACTTACTAAATCTAGTATAGTTGGAAAGTTGGAG
TGTATGCAATATTATGCAACTGTTGAAAAAGTCAATTCTAATATAAGCCA
ATGGCTAAATACATGTGACGTTGAGGATCAGATTGACAACGAAGATCTTC
TTTCAGGAACTCCTGAAGTAGTGGGTTGCGGTAAGGCAGTCGGAGGGATT
GTGAATACCTGCGTTGGACATATTGATCCAATAGAAACCGGAATTTTTAA
TAGTCCAAACCGGGATAATTCATCTAAACATAGCACTAAGTCGGATAATA
TTGGACGCATACAACTTCAGAGAATGATATCTAAATGTTCATGTATGGTT
TATTACGTGAGTTACGATAGGGCTGATCCTATCGGATTGCCACAGCATCT
TATTCCACCATTGCCTCTTGAAGAAGATGAAATCTCTCATTCGTCCGAAG
GAGCTACAACGTTGACACTTCTTCACAGCAATTTGAATGGTGTTACCAAT
TCGTTACAATATCATATGATTGTTGAAATTATCAACGATTTGATACTTTA
CGTAGAACCAAGAAGAAAAGCCAGAGATGATCGAAACAAAGTTGAATTTT
CTCTCCTATCAGAAGAACAATTGAAAACGACAATTTTGCGTAGTCAAGAA
TATTTACGGAACTTAGTCCATTATCAGATGCGATACGAACGTGAGCTGTG
GAAAGTAGTCGTTGAAGAGCAAATCAATCGAATCAAACCTCTTGAACGAA
TTATCAAAAACCTGAAAACAGATATTGAAGAAAAAAATTCTGCCCTGTCT
CAATGCATAGCAATTTATCAACAGATGCGCATTCAGTCACAGCGGCGAGA
TTTACATTTGAGATCTTCATTTTCCAGGCCAAGTTTATCCACTAATCAGC
AACAAACTCCTGTATCATCTAATATTAGCAATACCAATACATCACAAGAT
AACAGTAAGAAAATTTTGAAATCTCAATCGACGTCCAGTGACAGTATGAT
TCGTTCATCGTCTGAAGTGATTCGTAGAAATGAAGTTTGCTTCGAGCATG
CAACATGGCGAATGACGGAAAACGATGGTCAAATAGGATTGTGCGATGTT
GAATTAAGAGATTTTATTTATTCAAAAATCACTCGAGAAGATGATTCCGG
AGCACACAGCTTTGAATTGAATACTGTCAAAGTTGAGAGTCTTGTAAATA
ATTGCTTTTTCAAGGAAGTACTGATGATGGACGCTTCGAGTGAAATGAAT
ATTGGTGGTCCTGTGTTAAGAATTAATCTCATTGAGCGCTATCCAGTTGG
TGGAATCAAAGTCAATGAAGCCATGGAGATATGTATAGCACCATTGGTTC
TCCAAATAAGTAAATTGTTCTATATGACAATGATGCCGTTTTTCTTTCCC
GGAAAAGCAGAAGAAGTTGACGTGGAAAAAGGTTCTGATAACATGAGTTT
TGTAAAAAGTGAATCATTGGAATTAAGAAGAATTGTTGATAATACAGAAG
GTGTTCTTTTGGGACAAAATATTGAAATGACAGACTTAGATCAGTTTTTG
GGAGATAGCCATAGTGCAGCTGAAAGTTCTTCTATTCCTGGACTTAGTAC
AACACTGAAAAAACTGGCATCTTTCACAAATTTAAAAGCACGAAAAAAAG
ATAAATTAGCATTTAGCAGTGATGATAATTTGTCTCCTTGCTCATCTGTT
GAACCTACAGCTTATTTAAACCCGACTCCGATTTCTGAAGGTATTTCTAC
AGATTTACCCCGTGGCAGTATGACAACAGAAATTTCGAATTTCGAAGATA
TCAATGATACGATTGATTCAAAACCAAAGTTCAGTTCATATTCTTCTTCA
AATCTGAAAGTGGAAGATGTTATAAATAATCAAAGAACAGATAAAATTAA
TCGAACTCCTGATGTAATCTCCAGCGATTATTATATACCCATTGATTCAT
CCCAACATAATTCGACTGATAAATCCATTAAAAAACCTTCAACAGAAACC
CATAAGATTATTGTCAGTCACAATAATGGAAAATCAGATAGTTCATCGAA
TACAGTTTCTAAAGATCCTTTGCAATTGATGGCTGAAAGAGCTAAACAAA
ATTATATGTTTTTGTATGTAAAAATTCACGGATTTCCGATTCGGCTTAGT
TATCGGGGAGAAAAACAAAAAGCGTTTGCCATTAACAACTTTGCATTAAA
CATCACTCCTATCGAATATCACAACAAGTTATGGACATGGCTAGATCTGA
ACATGGAGATAAAGAAAAGTATTAAGAAACAACTAGTTTTAGAAGTTTTG
AAACAGAAATTTAAAATCCGAAAGAATCCATTCTCACTAGTTACGAGCTC
GAGTTTCAATCAGATAATGAAAGAAGAAGATCGTGAAAAGAAGAAAATGG
AAATGCTGCTTGGTGTGCACGCTTTGCCAAAAGAAGTATCAAAGAAACGA
CCGAACTTGATAAAACGAGTTATTTTGAAGAAATGACTTTCAAATTATTT
CGAAACTCTTGATAAATTTTGATTCTTTTTCACTGTTATTTCATATATAG
CTTTTTATAAATAATTCATTCAAAATGATTTATTTTTATCTATTCTTTCT
TTATTATTTGTTTTTTACCGGCTGATTTCAAAGCTGTATTTATCTGGGAA
TTGAAATTATCAATATATTTTGTTTTAATTTATAATTAATGTTCACCGGT
TACTTGCTAAC
back to top

protein sequence of SMED30033936-orf-1

>SMED30033936-orf-1 ID=SMED30033936-orf-1|Name=SMED30033936-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2236bp
MRFSESTDTLKMINLDLDMEKVQSMNDIPAEELLKFKTGCYGLNISSSVS
TTTSWRRLELSGQADLGSLSVKCRIDNPCLIINIDELAFWNELFIDANAL
FNQLFPKSKKNVISSQEKSQSSQFKFPSLHYTLKLEVNCSHRGQTINSDS
LALIQIINNSFEDGLELGLKTLVASYEADTSHNDADKLIQSIDLYSDINT
AYCKLINDSSSNRIDYIDYFHRWESAIFMGNVFVWVHKNRAGCLMNQVQL
EWSDSLAGVTRKIFNTIRSVKNIDSNSVGKESNLRSQSGSLMSAFAKMDL
EMKLEHVDLFAISSKRTFIRQKVNVIQLNKTSRELIEIDFKFCGTVYDMI
DENQEFYSTTTDFNDTSTQSPYFKRVCNINQIKMEFFPSKLALSVHCLDK
VDCFWDTSIHMCLREAFVNLHKIITNVKLLQKTKSVPSEPTMKSHIIIEL
GNGVELKFCISKEHDIILRSDIIHFHVSQQRSKIVTHNVEIHCDGRQIVT
VMNFSWKEVVPTNKYRQDKEKLKLTDATNRAWEIQADKVLISFPYKYIFN
QCYHDIISIKKFIKKVHSNKIDSDKSNGIGSEVRQAIPPDYIICFKEFQL
QLKDDPFECQLLDNYLLLRDENEEHEKRILRMKSQLKKLVKNGGIYTEVE
YRKCLYQLDLQKQSQYISRISSLRARQARESENNLFKWTISGLSLMSLSD
SDFYGAENAIRHMRNIDADSPFPERITFSTLWCRMISLNADSWCFQMREY
LKSLWTMKDLYVWGRLVVAEQSASEISKRHVTVEVDHPWHNVIIERNMPT
IKFFHDFSADMNENTICYGPNWESCLQWINISWELINRSSRDPSPPLPWW
DKSRLRLHGRLWFVSDVMDWYYPVSLDPYNNTEFFHWQWNGVRVNWENMK
WVLEGELGIFCRSASKYDGDCQLIAWPNLQLKINIFWICNGDPNNHFAVT
PCDPAHVTTTDHDTYYFFRSRNLNLDIEFNSNETSSEEFPRCIFYTNILK
FFEKFKTCIRRVARPIRRGRYYNYFRRKKPVLGRHFRLINVKLNTPQLNL
IYWLSLAKKTGVHMITGPISLSTQFHLELKQIEDNLHHRPQSNWSIVQMK
SQIRRGLKVWLIQKAEEASDDKCPSEKYRSFTEHDNKDLFHEKCRYEFII
LSHLKYDRLSSDSNQTFHNTSYDSSTLNDPTDTSMSDQELQPIHNLKLVD
LKVRWTQTNRNLVYSMIDIYRHKTLLRKNLSAQALKSIQLQIQSNSFLDT
KVNSLSHRTEQEFPYKRVHNLVDERSNSEINLIENNTGSLKMSTRKRASS
ASYINKSRTHNIGESQIMESDNPMLQQLLQEVDTAKLYAFCEEESKDVNV
VDKLTGVALCKSNVKISRKWHLELINSQVMLKTNQSSVYAIVSAAQTRLD
SYEHMPIWKDSQLLTKSSIVGKLECMQYYATVEKVNSNISQWLNTCDVED
QIDNEDLLSGTPEVVGCGKAVGGIVNTCVGHIDPIETGIFNSPNRDNSSK
HSTKSDNIGRIQLQRMISKCSCMVYYVSYDRADPIGLPQHLIPPLPLEED
EISHSSEGATTLTLLHSNLNGVTNSLQYHMIVEIINDLILYVEPRRKARD
DRNKVEFSLLSEEQLKTTILRSQEYLRNLVHYQMRYERELWKVVVEEQIN
RIKPLERIIKNLKTDIEEKNSALSQCIAIYQQMRIQSQRRDLHLRSSFSR
PSLSTNQQQTPVSSNISNTNTSQDNSKKILKSQSTSSDSMIRSSSEVIRR
NEVCFEHATWRMTENDGQIGLCDVELRDFIYSKITREDDSGAHSFELNTV
KVESLVNNCFFKEVLMMDASSEMNIGGPVLRINLIERYPVGGIKVNEAME
ICIAPLVLQISKLFYMTMMPFFFPGKAEEVDVEKGSDNMSFVKSESLELR
RIVDNTEGVLLGQNIEMTDLDQFLGDSHSAAESSSIPGLSTTLKKLASFT
NLKARKKDKLAFSSDDNLSPCSSVEPTAYLNPTPISEGISTDLPRGSMTT
EISNFEDINDTIDSKPKFSSYSSSNLKVEDVINNQRTDKINRTPDVISSD
YYIPIDSSQHNSTDKSIKKPSTETHKIIVSHNNGKSDSSSNTVSKDPLQL
MAERAKQNYMFLYVKIHGFPIRLSYRGEKQKAFAINNFALNITPIEYHNK
LWTWLDLNMEIKKSIKKQLVLEVLKQKFKIRKNPFSLVTSSSFNQIMKEE
DREKKKMEMLLGVHALPKEVSKKRPNLIKRVILKK*
back to top

protein sequence of SMED30033936-orf-2

>SMED30033936-orf-2 ID=SMED30033936-orf-2|Name=SMED30033936-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
KKSKKYFTIVCDKIIFNSNFNDFYGISKILKKKKKFSTITEKNNSSKQIN
WFIKATKLYMLEIKQIVFLIKLSPTEKSPVIYLSGDDVQLCAIPETNRIN
SQLSVGTATGKIICPSLSNGQWNLLANFRSQINFDFIFIKKQKLLLHKFL
MTIGSTKLLLLEEIFHELAQVTKYNYVEQPIVIDKVKKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019441FMP27_GFWDK_dom
IPR019443FMP27_C
IPR019409FMP27_DUF2405
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019443FMP27, C-terminalPFAMPF10351Apt1coord: 454..1107
e-value: 9.9E-64
score: 215.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 635..680
NoneNo IPR availablePANTHERPTHR15678ANTIGEN MLAA-22-RELATEDcoord: 7..1121
NoneNo IPR availablePANTHERPTHR15678:SF6PROTEIN KIAA0100coord: 7..1121