Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30033932
Length (bp)1055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30033932) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30033932) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30033932) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30033932) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033932

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033932SMESG000067734.1 dd_Smed_v6_15224_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033932SMESG000067734.1 dd_Smed_v4_15224_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30033932SMESG000067734.1 dd_Smed_v4_15224_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30033932SMESG000067734.1 dd_Smed_v4_15224_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: zig-8 (Zwei Ig domain protein zig-8 [Source:UniProtKB/Swiss-Prot;Acc:G5ED00])

HSP 1 Score: 47.7506 bits (112), Expect = 4.877e-6
Identity = 59/246 (23.98%), Postives = 106/246 (43.09%), Query Frame = 1
Query:  109 VIVIIASFIFIMGKSYSYH-YSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDF---SKISISWWKEGDLTELTLGEMVI--NNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            + VI+ SF++  G   S    +C   ER      S   N S  I N V  N    H      ++  I+W +  D   LT G      + R+++++K  N W L +      DSG Y+C+IN K     V+ +Y++        + P P      PSSL   S  L   + ++ DE   L C ++   K     + + W ++   I  +++ K  +++    +    ++  + I++AT+   G ++C
Sbjct:    7 ICVILFSFLYATGHGASEEVMACLRQER------SRVENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLCEINDKH--NTVYAVYLKVL------EPPLPS-----PSSLQKKSTKLM--ANMSGDEVV-LNCTVTSTDKDEEV-LDVVWTRDGNTINFNDTEKYILKVK---RDAGVVIETMRIRKATMEDDGNYAC 226          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr21 (gene:FBgn0260995 transcript:FBtr0334939)

HSP 1 Score: 63.5438 bits (153), Expect = 3.920e-11
Identity = 59/219 (26.94%), Postives = 92/219 (42.01%), Query Frame = 1
Query:  184 ERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYK---INRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSM-VTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            +R P FDTS   N +S +G T  LNC I   +    ++SW +  DL  LT+ E    +  +   I  K    WSL+I      DSG+Y CQ++                          P  Y  + S +   + +L GP + + +    +L C I  +P      +S++W  N + I   + R     IT   +      SY+ IQRA+I   G ++C
Sbjct:   48 DRGPYFDTSATKNVTSLVGITGHLNCRIK--NLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTP-----------------------PVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDP---PISVQWNHNNQEINYDSPRGGVSVIT---EKGDITTSYLLIQRASIADSGQYTC 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr10 (gene:FBgn0052057 transcript:FBtr0076308)

HSP 1 Score: 60.077 bits (144), Expect = 1.006e-9
Identity = 67/257 (26.07%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  163 HYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLG--EMVINNRYKIN-RKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI------ETRTITQ-------------------NDDFP---RPKQYIAMPSSLPLTSVVLRGPSM-VTIDEPFHLIC--QISPIPKTRYGDVSIEW-KQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            HY        P FD + P N +S +G +  L C + H+     +++W +  DL  LT+G      + R++ +  +  + W+L+I      D+GVY CQI+ + V     +L I      ET  I Q                   ND+F     P Q +A+P     T+ +L GP + V      +L C  + SP P T      I W  Q+K L + ++  +   +     +  S L+ Y     A + H G +SC
Sbjct:   43 HYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHL--GNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVP-----TATILGGPDLYVDKGSTINLTCIIKFSPEPPTH-----IFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIY----DADLLHSGKYSC 283          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr10 (gene:FBgn0052057 transcript:FBtr0076310)

HSP 1 Score: 60.077 bits (144), Expect = 1.006e-9
Identity = 67/257 (26.07%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  163 HYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLG--EMVINNRYKIN-RKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI------ETRTITQ-------------------NDDFP---RPKQYIAMPSSLPLTSVVLRGPSM-VTIDEPFHLIC--QISPIPKTRYGDVSIEW-KQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            HY        P FD + P N +S +G +  L C + H+     +++W +  DL  LT+G      + R++ +  +  + W+L+I      D+GVY CQI+ + V     +L I      ET  I Q                   ND+F     P Q +A+P     T+ +L GP + V      +L C  + SP P T      I W  Q+K L + ++  +   +     +  S L+ Y     A + H G +SC
Sbjct:   43 HYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHL--GNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVP-----TATILGGPDLYVDKGSTINLTCIIKFSPEPPTH-----IFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIY----DADLLHSGKYSC 283          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr10 (gene:FBgn0052057 transcript:FBtr0076309)

HSP 1 Score: 60.077 bits (144), Expect = 1.006e-9
Identity = 67/257 (26.07%), Postives = 108/257 (42.02%), Query Frame = 1
Query:  163 HYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLG--EMVINNRYKIN-RKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI------ETRTITQ-------------------NDDFP---RPKQYIAMPSSLPLTSVVLRGPSM-VTIDEPFHLIC--QISPIPKTRYGDVSIEW-KQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            HY        P FD + P N +S +G +  L C + H+     +++W +  DL  LT+G      + R++ +  +  + W+L+I      D+GVY CQI+ + V     +L I      ET  I Q                   ND+F     P Q +A+P     T+ +L GP + V      +L C  + SP P T      I W  Q+K L + ++  +   +     +  S L+ Y     A + H G +SC
Sbjct:   43 HYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHL--GNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVP-----TATILGGPDLYVDKGSTINLTCIIKFSPEPPTH-----IFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIY----DADLLHSGKYSC 283          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: dpr2 (gene:FBgn0261871 transcript:FBtr0340553)

HSP 1 Score: 59.6918 bits (143), Expect = 1.278e-9
Identity = 55/219 (25.11%), Postives = 93/219 (42.47%), Query Frame = 1
Query:  199 FDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVI--NNRYKINRKL-YNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVS-IEWKQNKKLIQPSNSRKNNI-----QITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            FD   P N +++ G+T  +NC +   +    S+SW ++ DL  LT G +    + R+K+ R      W+L +      DSG+Y CQ+N +  +   F L +    +T     P  K  IA P+ L            V +     L C +   P T   D+  I W +   ++ P  +  N+      +I+M+      L S + I  A +   G ++C
Sbjct:  108 FDFGMPRNITTRTGHTAAINCRVD--NLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNV---IVTP----PDAKAIIAGPTDL-----------YVKVGSSVTLTCHVKQ-PATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLLDTGNYTC 305          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16324792 (tr|A0A183A771|A0A183A771_9TREM Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2806 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.435e-28
Identity = 75/234 (32.05%), Postives = 118/234 (50.43%), Query Frame = 1
Query:  187 RRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI-ETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQ---------ISPIPKTR---------YGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCN 831
            RRPCF  + PT  +   G+ ++L C++Y+V+FS + ISWWKEG   EL+LG    N RY++ R  Y  W+L+I+N    DSGVY+CQINL++++E  F + + E R   QN+ +        + ++L L  +V   P   T      LI           +SP   +R         + D  I   +    I    + + NI+IT   + N T+ S +   + T+ H G+W C+
Sbjct:  105 RRPCFLGTVPTRITVDEGDRILLQCIVYNVNFSTVVISWWKEGWFRELSLGLETYNERYRLPRVSYQDWTLQINNAQPDDSGVYVCQINLEQIVEKFFEVQVREMRIEGQNEGY--------VGTTLRLFCIVQSVPGSTTT----ALIWSHGSGSQRYFLSPTASSRTDMEYLLRSFVDTDISEMRGSGQIDIRIADEENIKITTAKQGNHTIRSELVFAQLTLDHAGVWRCS 326          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|24428931 (tr|A0A3P6NT65|A0A3P6NT65_DIBLA Ig-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS78 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 5.849e-27
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:  193 PCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI 492
            PCF+ SYPT FS +   +V L C I++VDF  + ISWWKEG++ E+++GE  IN+RY I R   N W+L I N+T  D+GVYICQINLK + E  F L +
Sbjct:   47 PCFNASYPTEFSIEEQESVTLPCYIHNVDFDSVVISWWKEGEIREISVGESTINSRYSIYRSSPNAWALRITNVTMNDTGVYICQINLKVLREKFFKLMV 146          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|167256766 (tr|A0A158QI02|A0A158QI02_RODNA Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8419 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 5.018e-24
Identity = 46/107 (42.99%), Postives = 72/107 (67.29%), Query Frame = 1
Query:  193 PCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQ 513
            PCF+ S+PT+ + + G  VIL CV+++VDF+   +SWWKE  L E+ +G+ + + R+ I++ +   WSL I N++ LDSGVYICQIN K++ E   +L +  + I Q
Sbjct:    9 PCFNASFPTSLTVEEGKNVILPCVVHNVDFNNTVMSWWKERALREIAVGDNISDRRFSIDKSIRGGWSLRITNVSLLDSGVYICQINSKQLREKFIYLSVTGKNIHQ 115          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19140203 (tr|A0A4E0RRI2|A0A4E0RRI2_FASHE Defective proboscis extension response (Dpr) OS=Fasciola hepatica OX=6192 GN=D915_000519 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.562e-23
Identity = 70/255 (27.45%), Postives = 122/255 (47.84%), Query Frame = 1
Query:  184 ERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPR-PKQYIAMPSSLP---LTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWK----QNKKLIQPS-------------------NSRKNNIQ------------ITMQWKPNSTLVSYIYIQRATIRHQGIWSCN 831
            +R+PCF  + PT      G  ++L C++Y+V+FS + ISWW+EG   ELTLG    N RY++ R  Y  WSL+I++    DSG+Y+CQINL++++E  F + ++ +   ++ + P+ P+       + P   +  + + G +        HL C +   P T   D ++ W     Q++  + P+                    SR+++ Q            IT   + N T+ S +     T+ H G+W C+
Sbjct:  137 QRKPCFLGTVPTRIVVDQGERIVLQCIVYNVNFSTVVISWWREGWFRELTLGLETYNTRYRLPRASYQDWSLQINDARPDDSGIYVCQINLEQIVEKFFEVKVKVK--PKSTERPKTPEHEFVKDEASPQGIIPHMRIEGQNEGFQGSTIHLSCIVQNGPMT--ADTTLIWSHGNGQHRYFLIPTADDRSFQEYLLRSLKNTGIESRQSSAQLDIRVANREHALITTSREGNHTIRSELIFTHLTLDHAGVWRCS 387          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19114328 (tr|A0A068WGY7|A0A068WGY7_ECHGR Defective proboscis extension response OS=Echinococcus granulosus OX=6210 GN=EgrG_000430200 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.045e-23
Identity = 50/120 (41.67%), Postives = 77/120 (64.17%), Query Frame = 1
Query:  178 TSERR---PCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFP 528
            TS+RR   PCF+ S+PT+ + + G+ VIL CV+++VDF+ I +SWWKE  + EL +G+   + R+ I++ +   WSL I N++  DSGVYICQIN K++ E    L +   + T+    P
Sbjct:   64 TSQRRLNAPCFNASFPTSLTVEEGSDVILPCVVHNVDFNSIVMSWWKERAVRELAVGDNTSDKRFSIDKSIRGGWSLRIANVSLSDSGVYICQINSKQLRERFISLAVSAYSQTKRPAIP 183          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067734.1 (SMESG000067734.1)

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 1
Query:   88 MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF 1044
            MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF
Sbjct:    1 MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF 319          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067734.1 (SMESG000067734.1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 310/319 (97.18%), Postives = 311/319 (97.49%), Query Frame = 1
Query:   88 MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF 1044
            MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMP        +LRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF
Sbjct:    1 MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMP--------ILRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVFPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSVILVIFTYIIPYIINYFSFF 311          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000046049.1 (SMESG000046049.1)

HSP 1 Score: 127.487 bits (319), Expect = 4.762e-34
Identity = 74/199 (37.19%), Postives = 109/199 (54.77%), Query Frame = 1
Query:  232 QIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            Q G    L C I++ +FSKI I+WWKEG + ELTLG  V N+RY + R     W+L I N T  D+G YICQINL  + E  F + I+ R I  +  F    QY+       +  V +       +++ F L C +S        D S+ W  N    +  +S+K++++I MQW  N+TL+S ++I + T+ H+GIWSC
Sbjct:   37 QSGPCFKLQCFIFNANFSKILITWWKEGFMRELTLGSTVSNSRYLLPRLFNEDWTLIIRNATPSDAGTYICQINLLTLKEKFFKVEIKNR-IKSSKPFIASYQYVKDEGMKLIQVVKIEAKKSPILNQEFSLRC-VSTFSSVT-SDSSVLWMHNDS--EKFSSQKDDVEIKMQWLSNNTLLSILFIPKLTVEHKGIWSC 230          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000046049.1 (SMESG000046049.1)

HSP 1 Score: 127.102 bits (318), Expect = 5.454e-34
Identity = 74/199 (37.19%), Postives = 109/199 (54.77%), Query Frame = 1
Query:  232 QIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSC 828
            Q G    L C I++ +FSKI I+WWKEG + ELTLG  V N+RY + R     W+L I N T  D+G YICQINL  + E  F + I+ R I  +  F    QY+       +  V +       +++ F L C +S        D S+ W  N    +  +S+K++++I MQW  N+TL+S ++I + T+ H+GIWSC
Sbjct:   31 QSGPCFKLQCFIFNANFSKILITWWKEGFMRELTLGSTVSNSRYLLPRLFNEDWTLIIRNATPSDAGTYICQINLLTLKEKFFKVEIKNR-IKSSKPFIASYQYVKDEGMKLIQVVKIEAKKSPILNQEFSLRC-VSTFSSVT-SDSSVLWMHNDS--EKFSSQKDDVEIKMQWLSNNTLLSILFIPKLTVEHKGIWSC 224          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000057236.1 (SMESG000057236.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.099e-22
Identity = 76/262 (29.01%), Postives = 125/262 (47.71%), Query Frame = 1
Query:  157 SYHYSCSTSER-RPCFDTSYPTNFSSQIGNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYNHWSLEIDNITSLDSGVYICQINLKKVLENVFHLYI------ETRTITQNDDFPRPKQYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDV--SIEWKQNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIVF-----PDYVQFWELEMAKTSIKSLK 900
            S  + C T+E   PCF  +     S + G    L C++ +VD +K +ISWWKE ++TE++LG++++N RYK++    + WSL I      D+G YICQINL  ++E    L +      + R  +  ++  +P Q    P +     V L G S   I     L C++  +    Y ++   I W    + +  S   K+ I I  +W  N TL S + +      H G WSC+ +      P  V   +L++ + + K +K
Sbjct:   27 SKSFDCKTAEPFTPCFMWTGTNLVSVKNGEPATLPCLVKNVDTTKTAISWWKENEMTEISLGKVILNARYKLSEMTEHDWSLIIKQSRMSDAGHYICQINLSTLMEWHVTLVVLKSKNADVRMDSNTEEDIQPPQ----PKN---KYVFLYGHSKAFIYSKLILTCEVRYV----YDNINAGIIWSHRNQFLNDSEKWKDTISI--RWMGNLTLRSDLLLDPVLPTHSGKWSCHKIHTSRSDPSEVATMDLKVIEKNSKDIK 275          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zig-84.877e-623.98Zwei Ig domain protein zig-8 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpr213.920e-1126.94gene:FBgn0260995 transcript:FBtr0334939[more]
dpr101.006e-926.07gene:FBgn0052057 transcript:FBtr0076308[more]
dpr101.006e-926.07gene:FBgn0052057 transcript:FBtr0076310[more]
dpr101.006e-926.07gene:FBgn0052057 transcript:FBtr0076309[more]
dpr21.278e-925.11gene:FBgn0261871 transcript:FBtr0340553[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|163247922.435e-2832.05tr|A0A183A771|A0A183A771_9TREM Ig-like domain-cont... [more]
gnl|BL_ORD_ID|244289315.849e-2752.00tr|A0A3P6NT65|A0A3P6NT65_DIBLA Ig-like domain-cont... [more]
gnl|BL_ORD_ID|1672567665.018e-2442.99tr|A0A158QI02|A0A158QI02_RODNA Ig-like domain-cont... [more]
gnl|BL_ORD_ID|191402031.562e-2327.45tr|A0A4E0RRI2|A0A4E0RRI2_FASHE Defective proboscis... [more]
gnl|BL_ORD_ID|191143284.045e-2341.67tr|A0A068WGY7|A0A068WGY7_ECHGR Defective proboscis... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067734.10.000e+0100.00SMESG000067734.1[more]
SMESG000067734.10.000e+097.18SMESG000067734.1[more]
SMESG000046049.14.762e-3437.19SMESG000046049.1[more]
SMESG000046049.15.454e-3437.19SMESG000046049.1[more]
SMESG000057236.11.099e-2229.01SMESG000057236.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033932 ID=SMED30033932|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1055bp
AAAAGAACCAGTGAAATTATTGATATTTGACATTATTAAAACAATATTCA
GATTTATTGTAAATATTTTCAGAAGTAGATTCAGTGAATGACTGAGAAAA
ACCGTTTGGTGATTGTGATAATTGCTTCATTCATTTTCATTATGGGCAAG
TCATATAGTTATCATTATTCATGCTCGACATCTGAAAGAAGACCTTGCTT
CGACACTTCCTATCCTACAAATTTTTCCTCACAAATAGGCAATACGGTCA
TTTTGAATTGCGTCATTTACCATGTCGACTTCTCAAAAATATCAATATCT
TGGTGGAAAGAAGGAGATCTGACCGAACTGACCCTCGGTGAAATGGTCAT
TAATAATCGGTACAAAATAAACAGAAAATTATACAATCATTGGTCTCTAG
AAATTGACAATATTACTTCTCTTGATTCGGGAGTTTATATTTGTCAAATT
AATTTGAAAAAAGTATTAGAGAATGTTTTTCATTTGTATATAGAAACACG
AACCATAACTCAAAACGATGATTTCCCCCGTCCGAAGCAGTATATTGCAA
TGCCAAGTTCTCTTCCTTTAACTTCTGTAGTATTAAGAGGCCCATCTATG
GTGACCATTGATGAACCTTTCCATTTAATATGCCAAATTTCACCAATTCC
CAAAACAAGATATGGCGACGTATCAATTGAATGGAAACAAAATAAAAAGC
TCATTCAACCTTCAAATAGTAGAAAGAACAACATTCAAATAACCATGCAA
TGGAAACCCAACAGTACCCTTGTTAGTTATATTTATATCCAGAGGGCCAC
AATTCGGCATCAAGGAATTTGGTCTTGCAACATCGTTTTTCCTGATTATG
TTCAGTTCTGGGAATTGGAAATGGCCAAGACGAGTATAAAGTCGTTAAAA
ATTCAAATAGCAGATAAACAAACAGATAGATCGAGAAAGAAACTAATAAA
ATACAGTTATGCTCAAATGAACCGAGTCTCATCTGTGATATTAGTCATAT
TCACATATATTATTCCATATATTATCAATTATTTCTCTTTTTTCTAATAT
CAAAT
back to top

protein sequence of SMED30033932-orf-1

>SMED30033932-orf-1 ID=SMED30033932-orf-1|Name=SMED30033932-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MTEKNRLVIVIIASFIFIMGKSYSYHYSCSTSERRPCFDTSYPTNFSSQI
GNTVILNCVIYHVDFSKISISWWKEGDLTELTLGEMVINNRYKINRKLYN
HWSLEIDNITSLDSGVYICQINLKKVLENVFHLYIETRTITQNDDFPRPK
QYIAMPSSLPLTSVVLRGPSMVTIDEPFHLICQISPIPKTRYGDVSIEWK
QNKKLIQPSNSRKNNIQITMQWKPNSTLVSYIYIQRATIRHQGIWSCNIV
FPDYVQFWELEMAKTSIKSLKIQIADKQTDRSRKKLIKYSYAQMNRVSSV
ILVIFTYIIPYIINYFSFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037448Zig-8
IPR036179Ig-like_dom_sf
IPR013106Ig_V-set
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013106Immunoglobulin V-set domainSMARTSM00406igv1_8coord: 53..121
e-value: 0.006
score: 25.8
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 167..263
e-value: 42.0
score: 6.0
coord: 43..136
e-value: 1.1E-4
score: 31.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 32..137
e-value: 4.3E-15
score: 57.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 164..252
e-value: 1.8E-5
score: 26.8
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 43..122
e-value: 3.5E-7
score: 30.2
IPR037448Zwei Ig domain protein zig-8PANTHERPTHR23279DEFECTIVE PROBOSCIS EXTENSION RESPONSE DPR -RELATEDcoord: 30..248
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 160..249
score: 7.976
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 36..141
score: 10.117
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 36..128
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 163..249
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 296..318