Cystathionine beta-synthase

Overview
NameCystathionine beta-synthase
Smed IDSMED30033930
Length (bp)1772
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cystathionine beta-synthase (SMED30033930) t-SNE clustered cells

Violin plots show distribution of expression levels for Cystathionine beta-synthase (SMED30033930) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cystathionine beta-synthase (SMED30033930) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cystathionine beta-synthase (SMED30033930) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033930

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30033930SMESG000054075.1 SMESG000034294.1 Contig1264GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30033930SMESG000054075.1 SMESG000034294.1 Contig1264GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033930SMESG000065264.1 SMESG000065255.1 Contig1264GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30033930SMESG000065264.1 SMESG000065255.1 Contig1264GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v4_1585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v4_1585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v4_1585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v4_1585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065258.1 SMESG000065255.1 SMESG000050056.1 Contig20880newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065258.1 SMESG000065255.1 SMESG000050056.1 Contig20880uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000076166.1 SMESG000065264.1 SMESG000065255.1 SMESG000060017.1 SMESG000020308.1 SMESG000055970.1 SMESG000051957.1 SMESG000048853.1 SMESG000018735.1 SMESG000014585.1 SMESG000013689.1 Contig34301newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000076166.1 SMESG000065264.1 SMESG000065255.1 SMESG000060017.1 SMESG000020308.1 SMESG000055970.1 SMESG000051957.1 SMESG000048853.1 SMESG000018735.1 SMESG000014585.1 SMESG000013689.1 Contig34301uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 Contig44441newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 Contig44441uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065255.1 Contig4752newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065255.1 Contig4752uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065255.1 Contig51194newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000065264.1 SMESG000065255.1 Contig51194uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000037798.1 Contig4752newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033930SMESG000037798.1 Contig4752uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
goblet cellSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v6_1585_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033930SMESG000065264.1 SMESG000065255.1 dd_Smed_v4_1585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Match: CBSL (cystathionine beta-synthase like [Source:HGNC Symbol;Acc:HGNC:51829])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Match: CBSL (cystathionine beta-synthase like [Source:HGNC Symbol;Acc:HGNC:51829])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Match: CBSL (cystathionine beta-synthase like [Source:HGNC Symbol;Acc:HGNC:51829])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Match: CBSL (cystathionine beta-synthase like [Source:HGNC Symbol;Acc:HGNC:51829])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Match: CBS (cystathionine beta-synthase [Source:HGNC Symbol;Acc:HGNC:1550])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Match: cbs-1 (Cystathionine Beta-Synthase [Source:UniProtKB/TrEMBL;Acc:G5EFH8])

HSP 1 Score: 375.555 bits (963), Expect = 1.549e-121
Identity = 201/361 (55.68%), Postives = 256/361 (70.91%), Query Frame = 3
Query:  135 SKCTFKLDSDPATSPHSKKEIH------DKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGK---IKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSC-DNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMD 1187
            +K   +   DP T   S  E+       ++P ++D +L  IG TPLVKL  I K   + C + VKCEY+N GGS KDRI+ RM+E AE +GK   + PG TLIEPTSGNTGIGL+LA+AV+GYKCII MP+KMS EK   + +LG+ I+RTP  A +DSP S+I VA RLK EI ++ +L+QY NP NPLAHY+ TAEEI+    D  ID+VV++AGTGGT+ G++RKI ++ P   VVGVDP GSILA P    ++ + FYEVEGIGYDF+P  LD S +D W K  DK+SF MAR LIR EG+LCGGSSG AV+ A++  K  NLP  A VVV+LPD +RNY+TKFL DDWM +R+F+D
Sbjct:  346 TKLAGEWTQDPETKSWSHSEVEFNKFNPERPLVLDTVLDAIGKTPLVKLQHIPKAHGVKCNVYVKCEYMNAGGSTKDRIAKRMVEIAEKTGKPGKLVPGVTLIEPTSGNTGIGLSLASAVRGYKCIITMPKKMSKEKSIAMASLGSTIIRTPNEAGFDSPHSHIGVALRLKSEIQDAVVLDQYCNPGNPLAHYEETAEEIIYDMGDKHIDLVVLTAGTGGTVTGISRKIHERIPTAKVVGVDPHGSILAGPA---ETDIDFYEVEGIGYDFLPGTLDTSAIDYWAKSHDKESFLMARELIRSEGILCGGSSGCAVHYALEECKSLNLPAEANVVVLLPDGIRNYITKFLDDDWMNERHFLD 703          

HSP 2 Score: 97.4413 bits (241), Expect = 6.176e-21
Identity = 104/313 (33.23%), Postives = 155/313 (49.52%), Query Frame = 3
Query:  246 TPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVD-VLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDN----IIDMVVISAGTGGTLAGVARKIKQKCPKCL-VVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWM 1166
            TPLV L K+    ++  +I VK EYLN  GS++DR + +  + AE  G ++ GD +     G+  I  A  AAVKG K  I  P K   + VD VL  LG + V  P        E+ +      +Q+   S  LN++T  +  +A+   TA EI  + +N     +  VVI   TG   AG+A   K      + VVGV           +  K ++       +G D    +L    V+K  +V + ++++  R LI  EG++ G SSGAAV  A++ AK+  LP  + +VVVL D +RNY+  FL DDW+
Sbjct:   30 TPLVPLKKLKVEHQLQSDIYVKLEYLNIAGSLEDRTADKAFQFAEEIGVVR-GDEVFVTAGGSAAISYATVAAVKGIKLTIYAP-KGEFDLVDTVLHTLGVKTVELPFGT---FAEARVQTDEAAQQKGVFS--LNKFTTNAAFVANLQKTALEIEKAVNNKSIGKVGAVVIPLNTGAAAAGIAAYYKGIGEHGVRVVGV-----------TCKKDTIP-----EMGLDLKNDLLQEYNVEK-REVEEDEAYSFTRHLIGTEGIMAGPSSGAAVLEAIKLAKE--LPAGSTIVVVLMDGIRNYLRHFLDDDWI 316          
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Match: cbs-2 (Cystathionine Beta-Synthase [Source:UniProtKB/TrEMBL;Acc:Q9N4K2])

HSP 1 Score: 359.377 bits (921), Expect = 8.038e-116
Identity = 198/353 (56.09%), Postives = 248/353 (70.25%), Query Frame = 3
Query:  153 LDSDP----ATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGK---IKPG-DTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSC-DNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM 1184
            LD DP         S K   ++P ++D++L  IG TPLVKL  + K   + C + VKCE+LN GGS KDRI+ +M+E AE +GK   + PG  TLIEPTSGNTGIGL+L AAV+GYKC+I MPEKMS EK   L  LG+ IVRTP  A+++SP S+I VA RLK EIP + IL+QY NP NPLAHY+ TAEEIL    D  ID+VV+ AGTGGT+ G++RKI ++ P  +VVGVDP GSIL  P +    +  FYEVEGIGYDF+P  LD   VD W K  DK+SF MAR +IR EG+LCGGSSG AV+ A++  +  +LP+ A VVV+LPD +RNY+TKFL DDWM  R F+
Sbjct:  312 LDYDPTKMVGEWKSSSKFRPERPLVLDSVLDAIGKTPLVKLQHVPKAHGVRCNVYVKCEFLNAGGSTKDRIAKKMVEIAEKTGKPGALTPGATTLIEPTSGNTGIGLSLVAAVRGYKCLITMPEKMSKEKSTTLSVLGSTIVRTPNEAAFNSPSSHIGVALRLKHEIPGAVILDQYCNPGNPLAHYEETAEEILWDMGDRKIDLVVLGAGTGGTITGISRKIHERRPNAIVVGVDPNGSILTGPTT--GPAPDFYEVEGIGYDFIPGTLDEKSVDSWLKSDDKESFLMAREIIRTEGILCGGSSGCAVHYALEQCRKLDLPEDANVVVLLPDGIRNYLTKFLDDDWMKARGFL 662          

HSP 2 Score: 55.8398 bits (133), Expect = 7.129e-8
Identity = 50/163 (30.67%), Postives = 75/163 (46.01%), Query Frame = 3
Query:  228 LLDIG---LTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEI 707
            +LD G    T LV L K+    ++  +I VK EYLN  GS++DR + R     E S  I+ GD +     G++ +  A  AAVKG +     P     +   +L  LG +IV  P S   ++      +A R        + L+     +  LA+ +GTA EI
Sbjct:   12 ILDAGSHRATQLVPLKKLKAEFQLKSDIYVKLEYLNISGSLEDRAAHRAF---EMSNGIQRGDEVYVTAGGSSAVSYATVAAVKGVRLTAHAPPGAFDQVRTILSTLGTKIVELPVSNFREARLQADLLAKRR-----GVYNLDGICEKAAFLANLEGTAPEI 166          
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Match: cysl-2 (Bifunctional L-3-cyanoalanine synthase/cysteine synthase [Source:UniProtKB/Swiss-Prot;Acc:O45679])

HSP 1 Score: 207.223 bits (526), Expect = 1.702e-61
Identity = 119/270 (44.07%), Postives = 163/270 (60.37%), Query Frame = 3
Query:  237 IGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDT-LIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRT-PTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSG 1040
            IG TPL+KLNKIGK   +   I VK EY+NP  SVKDRI+  MI+ AE +G I PG T LIEPTSGN GI LA    ++GYK I+ MP  MSIE+  +L+A GAE++ T P +A     +  +  A  L+  IPN++ILNQ+ NP+NP AHY  T  EI       +D+V    G+GGT  GV R +K+K P   V  V+PF S +     IN    + ++++G+G   +P +LD +   +  +V   D+  MA++L  EE +L G SSG
Sbjct:   14 IGNTPLLKLNKIGK--DLGASIAVKVEYMNPACSVKDRIAFNMIDTAEKAGLITPGKTVLIEPTSGNMGIALAYCGKLRGYKVILTMPASMSIERRCLLKAYGAEVILTDPATAV----KGAVQRAEELRDVIPNAYILNQFGNPANPEAHYKTTGPEIWRQTQGKVDIVCFGVGSGGTCTGVGRFLKEKNPSVQVFPVEPFESSV-----INGLPHSPHKIQGMGTGMIPDILDLTLFSEALRVHSDDAIAMAKKLADEESILGGISSG 272          
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Match: cysl-2 (Bifunctional L-3-cyanoalanine synthase/cysteine synthase [Source:UniProtKB/Swiss-Prot;Acc:O45679])

HSP 1 Score: 207.223 bits (526), Expect = 1.702e-61
Identity = 119/270 (44.07%), Postives = 163/270 (60.37%), Query Frame = 3
Query:  237 IGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDT-LIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRT-PTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSG 1040
            IG TPL+KLNKIGK   +   I VK EY+NP  SVKDRI+  MI+ AE +G I PG T LIEPTSGN GI LA    ++GYK I+ MP  MSIE+  +L+A GAE++ T P +A     +  +  A  L+  IPN++ILNQ+ NP+NP AHY  T  EI       +D+V    G+GGT  GV R +K+K P   V  V+PF S +     IN    + ++++G+G   +P +LD +   +  +V   D+  MA++L  EE +L G SSG
Sbjct:   14 IGNTPLLKLNKIGK--DLGASIAVKVEYMNPACSVKDRIAFNMIDTAEKAGLITPGKTVLIEPTSGNMGIALAYCGKLRGYKVILTMPASMSIERRCLLKAYGAEVILTDPATAV----KGAVQRAEELRDVIPNAYILNQFGNPANPEAHYKTTGPEIWRQTQGKVDIVCFGVGSGGTCTGVGRFLKEKNPSVQVFPVEPFESSV-----INGLPHSPHKIQGMGTGMIPDILDLTLFSEALRVHSDDAIAMAKKLADEESILGGISSG 272          
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Match: cysl-1 (Cysteine synthase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q93244])

HSP 1 Score: 192.586 bits (488), Expect = 6.844e-56
Identity = 135/325 (41.54%), Postives = 184/325 (56.62%), Query Frame = 3
Query:  195 IHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPG-DTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSAR--VVVVLPDSVRNYMTKFLSDD 1160
            + D+  I +N    IG TP+V +NK+ K   +   + VK EY+NP GSVKDRI   M+  AE  G + PG  TLIEPTSGNTGI LA  AA KGY+CI+ MP  MS E+  +L+A G+E+V T  +      +  I +A++LK+ IP S IL Q+ NP+NPL HY  T  EI       +D VV   GTGGT+ GV R ++++ P   V  V+P  S +     ++      ++++GIG  F P VLD    +   ++   ++  MA+RL  EEGLL G SSGA V AA+Q A     P+ A   +V  LP     YMT  L  D
Sbjct:    1 MADRNSIGENAAALIGNTPMVYINKLTK--GLPGTVAVKIEYMNPAGSVKDRIGAAMLAAAEKDGTVIPGVTTLIEPTSGNTGIALAFVAAAKGYRCIVTMPASMSGERRTLLKAYGSEVVLTDPAKGM---KGAIDMANQLKENIPGSIILAQFDNPNNPLVHYQTTGPEIWRQTKGTVDAVVFGVGTGGTITGVGRYLQEQNPGVRVFAVEPEESAI-----LSGRPAGPHKIQGIGAGFAPAVLDTKIYEDVIRIHSDEAIVMAQRLSYEEGLLGGISSGANVAAALQLAAR---PEMAGKLIVTCLPSCGERYMTSPLYTD 312          
BLAST of Cystathionine beta-synthase vs. Ensembl Fly
Match: Cbs (gene:FBgn0031148 transcript:FBtr0077244)

HSP 1 Score: 469.929 bits (1208), Expect = 1.227e-160
Identity = 261/519 (50.29%), Postives = 353/519 (68.02%), Query Frame = 3
Query:   81 PIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNA-PMTVQPSVTVEQTLELLKKEGFDQVPVV-ESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P P      + F +PG  SKC + L +    SPH  + I  + +I  NIL  IG TPLVKLN I   + I CE+  KCE+LNPGGSVKDRI  RM++DAE  G +KPG T+IEPTSGNTGIGLA+A AVKGYKCIIVMPEKMS EKV  LR LGA+I+RTPT A+YDSPE  I VA +L++E PNS +L+QY N  NPLAHYDGTA EIL   DN +DM+V+SAGT GT++G+ RKIK++ P C +VGVDP+GSILA+P  +NK+ V FYEVEGIGYDF PTV D + VD W K+GD D F M+RRL  EEGLLCGGSSG A++AA++ A+   L +  R VV+LPD +RNYMTKF+SD+WM  RNF + P+    N+  +  +   I+ L L A P+ ++   TV + + L+KK   DQ+PVV +  G ++G+     +++ ++      +DP  KA+ K   ++N +  + +L+R+L++D  VL++ +     P G  ELK     + T++D+ +++
Sbjct:    2 PQPKPYERPADFIDPGKPSKCKWHLGT-AEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHAR--KLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKE-PV----NEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGK----NPAGKVELK----ALATKLDVTTFI 504          
BLAST of Cystathionine beta-synthase vs. Ensembl Fly
Match: Cbs (gene:FBgn0031148 transcript:FBtr0077245)

HSP 1 Score: 469.929 bits (1208), Expect = 1.227e-160
Identity = 261/519 (50.29%), Postives = 353/519 (68.02%), Query Frame = 3
Query:   81 PIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNA-PMTVQPSVTVEQTLELLKKEGFDQVPVV-ESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P P      + F +PG  SKC + L +    SPH  + I  + +I  NIL  IG TPLVKLN I   + I CE+  KCE+LNPGGSVKDRI  RM++DAE  G +KPG T+IEPTSGNTGIGLA+A AVKGYKCIIVMPEKMS EKV  LR LGA+I+RTPT A+YDSPE  I VA +L++E PNS +L+QY N  NPLAHYDGTA EIL   DN +DM+V+SAGT GT++G+ RKIK++ P C +VGVDP+GSILA+P  +NK+ V FYEVEGIGYDF PTV D + VD W K+GD D F M+RRL  EEGLLCGGSSG A++AA++ A+   L +  R VV+LPD +RNYMTKF+SD+WM  RNF + P+    N+  +  +   I+ L L A P+ ++   TV + + L+KK   DQ+PVV +  G ++G+     +++ ++      +DP  KA+ K   ++N +  + +L+R+L++D  VL++ +     P G  ELK     + T++D+ +++
Sbjct:    2 PQPKPYERPADFIDPGKPSKCKWHLGT-AEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHAR--KLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKE-PV----NEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGK----NPAGKVELK----ALATKLDVTTFI 504          
BLAST of Cystathionine beta-synthase vs. Ensembl Fly
Match: Cbs (gene:FBgn0031148 transcript:FBtr0340437)

HSP 1 Score: 469.929 bits (1208), Expect = 1.227e-160
Identity = 261/519 (50.29%), Postives = 353/519 (68.02%), Query Frame = 3
Query:   81 PIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNA-PMTVQPSVTVEQTLELLKKEGFDQVPVV-ESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P P      + F +PG  SKC + L +    SPH  + I  + +I  NIL  IG TPLVKLN I   + I CE+  KCE+LNPGGSVKDRI  RM++DAE  G +KPG T+IEPTSGNTGIGLA+A AVKGYKCIIVMPEKMS EKV  LR LGA+I+RTPT A+YDSPE  I VA +L++E PNS +L+QY N  NPLAHYDGTA EIL   DN +DM+V+SAGT GT++G+ RKIK++ P C +VGVDP+GSILA+P  +NK+ V FYEVEGIGYDF PTV D + VD W K+GD D F M+RRL  EEGLLCGGSSG A++AA++ A+   L +  R VV+LPD +RNYMTKF+SD+WM  RNF + P+    N+  +  +   I+ L L A P+ ++   TV + + L+KK   DQ+PVV +  G ++G+     +++ ++      +DP  KA+ K   ++N +  + +L+R+L++D  VL++ +     P G  ELK     + T++D+ +++
Sbjct:    2 PQPKPYERPADFIDPGKPSKCKWHLGT-AEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHAR--KLKKGQRCVVILPDGIRNYMTKFVSDNWMEARNFKE-PV----NEHGHWWWSLAIAELELPAPPVILKSDATVGEAIALMKKHRVDQLPVVDQDDGSVLGVVGQETLITQIVSMNRQQSDPAIKALNKRVIRLNESEILGKLARVLEVDPSVLILGK----NPAGKVELK----ALATKLDVTTFI 504          
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Match: cbsa (cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB-GENE-050417-367])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 385/514 (74.90%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM--DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTK 1646
            ++  P + S+CT+K       SPH+         I+ NIL  IG TPLV +NKI KI  + CE+L KCE+ N GGSVKDRISLRM+EDAE  G + PGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+P+ +N++    YEVEGIGYDF+PTVLDRS VDKWYK  D++SF MAR LIR+EGLLCGGSSG A+ AAV+ AK+  L +  R VV+LPDS+RNYM+KFLSD WM+ + F+  +  M N+        +  K+ SLNL+AP+TV P+VT ++T+++LK +GFDQ PVV  +G I+GM T+G +++ ++   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH+Q Q    G+   K+M++G+VT IDL++++    K
Sbjct:   53 KWIRPDLPSRCTWKPGMSHENSPHTYFPRTKAECILPNILGKIGDTPLVNINKISKIFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAEREGILNPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDTTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNIKIVAVDPEGSILAEPDELNRTDKNQYEVEGIGYDFIPTVLDRSLVDKWYKSKDEESFAMARMLIRDEGLLCGGSSGTAMAAAVKFAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFQKGFLRVEDIMVNKP-----WWWNLKLQSLNLSAPLTVLPTVTCQKTIKILKDKGFDQAPVVNEAGLILGMVTLGNMLASVLAGKVKPSDPVSKVLYKQFKQIRLTDNMGKLSRILETDHFALVVHEQIQYLTDGSSSQKQMVFGVVTAIDLLNFVTAREK 559          
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Match: cbsb (cystathionine beta-synthase b [Source:ZFIN;Acc:ZDB-GENE-021030-3])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 295/514 (57.39%), Postives = 386/514 (75.10%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM-------DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            ++  P + S+CT+KL      SPH+  +      I+ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPN+HIL+QY NPSNPLAHYD TAEEIL  C   IDM+V  AGTGGT+ G+ARK+K+KCP   ++GVDP GSILA+P+ +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SF M+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM+KFLSD WM+++ FM       +KP            +   +  L L+AP+TV P V++++T+++LK++ FDQ PVV+ +G I+GM T+G +++ ++   +  +DP+SK +YK FK+V L   + +LSR+L+ DHF LVVH+Q Q    G+ ++++M++G+VT IDL++Y+
Sbjct:   77 KWIRPDLPSRCTWKLGDLNMESPHNHYQRTKTSGILPNILSKIGETPMVRMNKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNAHILDQYRNPSNPLAHYDTTAEEILEQCGGKIDMLVAGAGTGGTITGIARKLKEKCPDIKIIGVDPEGSILAEPDELNKTDKTQYEVEGIGYDFIPTVLDRSVVDNWYKSNDEESFAMSRMLIREEGLLCGGSSGTAMSAAVNVAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFEKGFMSEEDLVVNKPWW----------WNLTLQELRLSAPLTVLPLVSIKKTIQILKEKAFDQAPVVDEAGHILGMVTLGNMLASVLAGKVRPSDPISKVLYKQFKQVRLTDNLGKLSRILETDHFALVVHEQIQYMSDGSPKMRQMVFGVVTAIDLLNYV 578          
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Match: cbsb (cystathionine beta-synthase b [Source:ZFIN;Acc:ZDB-GENE-021030-3])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 295/514 (57.39%), Postives = 386/514 (75.10%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM-------DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            ++  P + S+CT+KL      SPH+  +      I+ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPN+HIL+QY NPSNPLAHYD TAEEIL  C   IDM+V  AGTGGT+ G+ARK+K+KCP   ++GVDP GSILA+P+ +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SF M+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM+KFLSD WM+++ FM       +KP            +   +  L L+AP+TV P V++++T+++LK++ FDQ PVV+ +G I+GM T+G +++ ++   +  +DP+SK +YK FK+V L   + +LSR+L+ DHF LVVH+Q Q    G+ ++++M++G+VT IDL++Y+
Sbjct:   77 KWIRPDLPSRCTWKLGDLNMESPHNHYQRTKTSGILPNILSKIGETPMVRMNKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNAHILDQYRNPSNPLAHYDTTAEEILEQCGGKIDMLVAGAGTGGTITGIARKLKEKCPDIKIIGVDPEGSILAEPDELNKTDKTQYEVEGIGYDFIPTVLDRSVVDNWYKSNDEESFAMSRMLIREEGLLCGGSSGTAMSAAVNVAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFEKGFMSEEDLVVNKPWW----------WNLTLQELRLSAPLTVLPLVSIKKTIQILKEKAFDQAPVVDEAGHILGMVTLGNMLASVLAGKVRPSDPISKVLYKQFKQVRLTDNLGKLSRILETDHFALVVHEQIQYMSDGSPKMRQMVFGVVTAIDLLNYV 578          
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Match: cbsa (cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB-GENE-050417-367])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 385/514 (74.90%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM--DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTK 1646
            ++  P + S+CT+K       SPH+         I+ NIL  IG TPLV +NKI KI  + CE+L KCE+ N GGSVKDRISLRM+EDAE  G + PGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+P+ +N++    YEVEGIGYDF+PTVLDRS VDKWYK  D++SF MAR LIR+EGLLCGGSSG A+ AAV+ AK+  L +  R VV+LPDS+RNYM+KFLSD WM+ + F+  +  M N+        +  K+ SLNL+AP+TV P+VT ++T+++LK +GFDQ PVV  +G I+GM T+G +++ ++   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH+Q Q    G+   K+M++G+VT IDL++++    K
Sbjct:   53 KWIRPDLPSRCTWKPGMSHENSPHTYFPRTKAECILPNILGKIGDTPLVHINKISKIFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAEREGILNPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDTTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNIKIVAVDPEGSILAEPDELNRTDKNQYEVEGIGYDFIPTVLDRSLVDKWYKSKDEESFAMARMLIRDEGLLCGGSSGTAMAAAVKFAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFQKGFLRVEDIMVNKP-----WWWNLKLQSLNLSAPLTVLPTVTCQKTIKILKDKGFDQAPVVNEAGLILGMVTLGNMLASVLAGKVKPSDPVSKVLYKQFKQIRLTDNMGKLSRILETDHFALVVHEQIQYLTDGSSSQKQMVFGVVTAIDLLNFVTAREK 559          
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Match: cbsa (cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB-GENE-050417-367])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 385/514 (74.90%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM--DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTK 1646
            ++  P + S+CT+K       SPH+         I+ NIL  IG TPLV +NKI KI  + CE+L KCE+ N GGSVKDRISLRM+EDAE  G + PGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+P+ +N++    YEVEGIGYDF+PTVLDRS VDKWYK  D++SF MAR LIR+EGLLCGGSSG A+ AAV+ AK+  L +  R VV+LPDS+RNYM+KFLSD WM+ + F+  +  M N+        +  K+ SLNL+AP+TV P+VT ++T+++LK +GFDQ PVV  +G I+GM T+G +++ ++   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH+Q Q    G+   K+M++G+VT IDL++++    K
Sbjct:   53 KWIRPDLPSRCTWKPGMSHENSPHTYFPRTKAECILPNILGKIGDTPLVHINKISKIFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAEREGILNPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDTTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNIKIVAVDPEGSILAEPDELNRTDKNQYEVEGIGYDFIPTVLDRSLVDKWYKSKDEESFAMARMLIRDEGLLCGGSSGTAMAAAVKFAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFQKGFLRVEDIMVNKP-----WWWNLKLQSLNLSAPLTVLPTVTCQKTIKILKDKGFDQAPVVNEAGLILGMVTLGNMLASVLAGKVKPSDPVSKVLYKQFKQIRLTDNMGKLSRILETDHFALVVHEQIQYLTDGSSSQKQMVFGVVTAIDLLNFVTAREK 559          
BLAST of Cystathionine beta-synthase vs. Ensembl Xenopus
Match: nipal3 (NIPA-like domain containing 3 [Source:Xenbase;Acc:XB-GENE-946030])

HSP 1 Score: 51.6026 bits (122), Expect = 3.090e-6
Identity = 50/183 (27.32%), Postives = 81/183 (44.26%), Query Frame = 3
Query:  297 EILVKCEYLNPGGSVKDRISLRMI----EDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVR-TPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVD 830
            E+ +K EYL   GSVK+R  L ++    +D +  G       +I  T  N  + +A  A+       ++M    S+ +V + R  GA ++   PT+    S       A RL QE  N ++  +  + +  LA       EI     N+  ++  + G  G LAG A  +K   PK  V+GV+
Sbjct:  161 ELYLKKEYLQYTGSVKERGVLYLLTSLPQDQQRKG-------VIVATDSNFALAVAFHASELQIPVFVIMSAGTSLGRVRMCRDYGAMVILFGPTARDAQSH------ARRLAQE--NGYLYIEEEDSAGYLAGLGTVGLEIYEQVPNLDAVIFPAGGHCGLLAGSAAALKHLNPKITVIGVE 328          
BLAST of Cystathionine beta-synthase vs. Ensembl Xenopus
Match: nipal3 (NIPA-like domain containing 3 [Source:Xenbase;Acc:XB-GENE-946030])

HSP 1 Score: 51.6026 bits (122), Expect = 3.490e-6
Identity = 50/183 (27.32%), Postives = 81/183 (44.26%), Query Frame = 3
Query:  297 EILVKCEYLNPGGSVKDRISLRMI----EDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVR-TPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVD 830
            E+ +K EYL   GSVK+R  L ++    +D +  G       +I  T  N  + +A  A+       ++M    S+ +V + R  GA ++   PT+    S       A RL QE  N ++  +  + +  LA       EI     N+  ++  + G  G LAG A  +K   PK  V+GV+
Sbjct:  170 ELYLKKEYLQYTGSVKERGVLYLLTSLPQDQQRKG-------VIVATDSNFALAVAFHASELQIPVFVIMSAGTSLGRVRMCRDYGAMVILFGPTARDAQSH------ARRLAQE--NGYLYIEEEDSAGYLAGLGTVGLEIYEQVPNLDAVIFPAGGHCGLLAGSAAALKHLNPKITVIGVE 337          
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Match: Cbs (cystathionine beta-synthase [Source:MGI Symbol;Acc:MGI:88285])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 295/503 (58.65%), Postives = 383/503 (76.14%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P   S+CT++L    A SPH    +   PKI+ +IL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q    G    ++M++G+VT IDL++++
Sbjct:   43 PDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARE--LQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQYCSNGMSSKQQMVFGVVTAIDLLNFV 539          
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Match: Cbs (cystathionine beta-synthase [Source:MGI Symbol;Acc:MGI:88285])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 295/503 (58.65%), Postives = 383/503 (76.14%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P   S+CT++L    A SPH    +   PKI+ +IL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q    G    ++M++G+VT IDL++++
Sbjct:   43 PDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARE--LQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQYCSNGMSSKQQMVFGVVTAIDLLNFV 539          
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Match: Cbs (cystathionine beta-synthase [Source:MGI Symbol;Acc:MGI:88285])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 297/517 (57.45%), Postives = 385/517 (74.47%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQIT----------PT----GTEELKEMIYGIVTRIDLISYM 1631
            P   S+CT++L    A SPH    +   PKI+ +IL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q            PT    G    ++M++G+VT IDL++++
Sbjct:   43 PDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARE--LQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFV 553          
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Match: Cbs (cystathionine beta-synthase [Source:MGI Symbol;Acc:MGI:88285])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 297/517 (57.45%), Postives = 385/517 (74.47%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQIT----------PT----GTEELKEMIYGIVTRIDLISYM 1631
            P   S+CT++L    A SPH    +   PKI+ +IL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q            PT    G    ++M++G+VT IDL++++
Sbjct:   43 PDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARE--LQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFV 553          
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Match: Cbs (cystathionine beta-synthase [Source:MGI Symbol;Acc:MGI:88285])

HSP 1 Score: 377.096 bits (967), Expect = 4.234e-128
Identity = 175/234 (74.79%), Postives = 203/234 (86.75%), Query Frame = 3
Query:  303 LVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLI 1004
            + KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI
Sbjct:   18 VAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLI 251          
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Match: sp|P35520|CBS_HUMAN (Cystathionine beta-synthase OS=Homo sapiens OX=9606 GN=CBS PE=1 SV=2)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Match: sp|P0DN79|CBSL_HUMAN (Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 292/512 (57.03%), Postives = 384/512 (75.00%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP+V++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE  G +KPGDT+IEPTSGNTGIGLALAAAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ V  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L L+AP+TV P++T   T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IYK FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Match: sp|Q58H57|CBS_MACFA (Cystathionine beta-synthase OS=Macaca fascicularis OX=9541 GN=CBS PE=2 SV=3)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 289/512 (56.45%), Postives = 385/512 (75.20%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            K PL  +  P   S+CT++L    + SPH        PKI+ +IL  IG TP++++NKIGK   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLAL AAV+GY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TA+EIL  CD  +DM+V S GTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+++F  AR LI +EGLLCGGS+G+ +  AV+AA++  L +  R VV+LPDSVRNYMTKFLSD WM  + F+ +       ++    +  ++  L+L+AP+TV P+V+ E T+E+L+++GFDQ PVV+ +G I+GM T+G ++S L+   +  +D V K IY  FK++ L  T+ +LS +L++DHF LVVH+Q Q   TG    ++M++G+VT IDL++++
Sbjct:   39 KEPL--WIRPDAPSRCTWQLGRPASESPHHHTVPEKSPKILPDILKKIGDTPMIRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTIIEPTSGNTGIGLALTAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILRQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTMAVAVKAAQE--LQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKE---EDLMEKKPWWWHLRVQELSLSAPLTVLPTVSCEHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYTQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFV 543          
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Match: sp|Q91WT9|CBS_MOUSE (Cystathionine beta-synthase OS=Mus musculus OX=10090 GN=Cbs PE=1 SV=3)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 297/517 (57.45%), Postives = 385/517 (74.47%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQIT----------PT----GTEELKEMIYGIVTRIDLISYM 1631
            P   S+CT++L    A SPH    +   PKI+ +IL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VDKW+K  D+DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q            PT    G    ++M++G+VT IDL++++
Sbjct:   43 PDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARE--LQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFV 553          
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Match: sp|P32232|CBS_RAT (Cystathionine beta-synthase OS=Rattus norvegicus OX=10116 GN=Cbs PE=1 SV=3)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 295/518 (56.95%), Postives = 383/518 (73.94%), Query Frame = 3
Query:  120 NPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQIT----------PT----GTEELKEMIYGIVTRIDLISYM 1631
            +P   S+CT++L    A SPH        PKI+ +IL  IG TP+V++N+I K   + CE+L KCE+ N GGSVKDRISLRMIEDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPT+A +DSPES++ VA RLK EIPNSHIL+QY N SNPLAHYD TAEEIL  CD  +DM+V SAGTGGT+ G+ARK+K+KCP C ++GVDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VD+W+K  D DSF  AR LI +EGLLCGGSSG+A+  AV+AA++  L +  R VV+LPDSVRNYM+KFLSD WM  + FM + ++     +    +  ++  L+L+AP+TV P+VT E T+ +L+++GFDQ PVV  SG I+GM T+G ++S L+   +  +D V K +YK FK ++L  T+  LS +L++DHF LVVH+Q Q            PT    G    + M++G+VT IDL++++
Sbjct:   42 SPDTPSRCTWQLGRPMADSPHYHTVPTKSPKILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKVDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQE--LKEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSV----KRPWWWHLRVQELSLSAPLTVLPTVTCEHTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGMLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDRNNGVSSKQLMVFGVVTAIDLLNFV 553          
BLAST of Cystathionine beta-synthase vs. TrEMBL
Match: A0A0B7B823 (Cystathionine beta-synthase OS=Arion vulgaris OX=1028688 GN=ORF168729 PE=3 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 322/514 (62.65%), Postives = 405/514 (78.79%), Query Frame = 3
Query:   90 SIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            +I     Q+  P + SKCTF+L++    SPH       +PKI+ +IL +IG TPLV++NKI   E I CEIL KCE+ N GGSVKDRI  RM+EDAE +G+IKPGD LIEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA++DSPES+I VAHRL  E+PNSHIL+QY N SNP+AH+DGTA+EIL +CD  +DM+V +AGTGGT+AG++RKIK  CP C ++GVDP GSILA+PES+NK+ V+FYEVEGIGYDFVPTVL R +VDKWYK  DK SF M+RRLIREEGLLCGGSSG+A++ AVQA KDF L +  R VV+LPDSVRNYM+KFLSDDWM  R+F++  +           +   +S+LNL AP+TV P+V ++ TL+LL KEGFDQVPVV+ +GCI+GM TVG +M+ ++KK +  +D VS  +YK FK++ +++++ QLSR+LD DHFVLVVH QRQ    G  E K+MI+GI TRIDL++++
Sbjct:   12 AIDGQFRQWKRPDLASKCTFQLNTPIEQSPHRHVTKSSRPKILPSILHNIGDTPLVRINKITVKEGIECEILAKCEFFNAGGSVKDRIGYRMVEDAEIAGQIKPGDVLIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSAAFDSPESHIGVAHRLMGEVPNSHILDQYRNASNPVAHFDGTAQEILDACDGKVDMIVATAGTGGTIAGISRKIKMHCPDCKIIGVDPEGSILAEPESLNKNEVSFYEVEGIGYDFVPTVLSREYVDKWYKSMDKPSFLMSRRLIREEGLLCGGSSGSAMHCAVQAVKDFGLKKGQRCVVILPDSVRNYMSKFLSDDWMSQRDFLE--LERLMEPSKEWWWTLNVSALNLLAPLTVMPTVLIQDTLDLLNKEGFDQVPVVDETGCILGMVTVGNMMAKIIKKKVRRSDQVSTVMYKQFKQIRMDTSLGQLSRMLDTDHFVLVVHNQRQYGVDGKVENKQMIFGIATRIDLLNFI 523          
BLAST of Cystathionine beta-synthase vs. TrEMBL
Match: V4A5D0 (Cystathionine beta-synthase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_219173 PE=3 SV=1)

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 322/514 (62.65%), Postives = 408/514 (79.38%), Query Frame = 3
Query:   96 KSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIE 1637
            +SP   +  P + SKCT+  D     SPH   +   KP IM NIL +IG TPLV++N+I + E + CE+L KCE+ N GGSVKDRI LRMIEDAEA G +KPGD LIEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVD+LRALGAEIVRTPTSA++DSPES+I VA RL +EIPNSHIL+QY NPSNPLAHYD TAEEIL +CDN +DM+V++AGTGGTL G+ARKIK+KCP C ++GVDP GSI+A+PE +NKS  +FYEVEGIGYDF+PTV DRS VDKWYK  DKDSF MARRLI+EEGLLCGGS G+AVY A++A KDF L +  R  VVLPDS+RNYMTK LSDDW+  R+F++  +    +      +  K+S+L+L AP+TV P+VTV++TL++L KEGFDQVP+++ +G ++GM T+G +MS ++K  +  +DPV+K +YK FK+++L++T+ QLSRLLD DH+VLVVHQQRQ T       K+MI+GI TRIDL++++ +
Sbjct:    9 ESPYRIWKRPDLPSKCTYTPDKSIDQSPHRHIKQKQKPAIMPNILYNIGNTPLVRINRITEKEGVKCELLAKCEFFNSGGSVKDRIGLRMIEDAEAQGVLKPGDVLIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDILRALGAEIVRTPTSAAFDSPESHIGVAKRLMEEIPNSHILDQYRNPSNPLAHYDCTAEEILAACDNKLDMMVLTAGTGGTLTGIARKIKEKCPSCKIIGVDPAGSIIAEPEELNKSDTSFYEVEGIGYDFIPTVCDRSPVDKWYKSVDKDSFIMARRLIKEEGLLCGGSCGSAVYCAIKAIKDFGLKEGQRCAVVLPDSIRNYMTKHLSDDWLSQRHFLE--LKKDVDPSKAWWWNLKVSALSLRAPLTVTPTVTVQETLDILNKEGFDQVPIMDDNGDVLGMVTIGNLMSQIVKHKVKRSDPVNKVMYKQFKQISLDTTLSQLSRLLDTDHYVLVVHQQRQYTGPSVISKKQMIFGIATRIDLLNFITQ 520          
BLAST of Cystathionine beta-synthase vs. TrEMBL
Match: A0A1I8GKK3 (Cystathionine beta-synthase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 329/513 (64.13%), Postives = 406/513 (79.14%), Query Frame = 3
Query:  111 QFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSN-----DRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMI 1634
            Q PN    S+C FK+D   + SPH+  ++  +PKI+ NIL  IG TPLV+LN I K E ISCEIL KCE+ N GGSVKDRI LRMIEDAE SG++KPGD LIEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS EKVDVLRALGAEIVRTPT+AS+DS ES+I VA RL QE+PN+ IL+QYTNPSNPLAHYDGTAEE+L +C+N IDMVV  AGTGGT+AG+ARKIKQ+CP CL+VGVDP+GSILAQPES+N++SVT Y+VEGIGYDFVPTVLDRS VD W+K  D +SF+MARRLIR EGLLCGGSSG+AV++A+ A + + L    RVVV+LPDSVRNYMTKFLS+DW+ +R +   P  + +N     D +      ++ SL+L AP++V P V+V++ LELL +EGFDQ+PVV + G I+GMAT+G IMS ++K TL  TDPVS A+Y  F KV  +  +  +SR LD DHF+LVV+QQRQ      E +KE+I+GI+TRIDL++Y++
Sbjct: 2891 QLPN--HQSQCKFKIDLPISESPHNHVKLTPEPKILSNILQHIGNTPLVRLNSIPKAENISCEILAKCEFFNAGGSVKDRIGLRMIEDAEKSGRLKPGDVLIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSKEKVDVLRALGAEIVRTPTAASFDSAESHIGVAKRLLQEMPNALILDQYTNPSNPLAHYDGTAEELLEACNNQIDMVVAGAGTGGTIAGLARKIKQRCPNCLIVGVDPYGSILAQPESLNETSVTQYDVEGIGYDFVPTVLDRSLVDCWFKSSDAESFDMARRLIRHEGLLCGGSSGSAVHSALAAIRHYKLGPGKRVVVMLPDSVRNYMTKFLSEDWLIERGY--APTQDFANGVGESDSDTRWKSVRVGSLDLKAPLSVLPDVSVKEALELLNREGFDQLPVVHADGKIVGMATLGFIMSHIIKGTLKPTDPVSNAVYHKFTKVTPDCPLGVISRHLDSDHFILVVNQQRQYLGDRKESVKEVIFGILTRIDLLNYLL 3399          
BLAST of Cystathionine beta-synthase vs. TrEMBL
Match: A0A267F346 (Cystathionine beta-synthase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000058g2 PE=3 SV=1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 316/506 (62.45%), Postives = 388/506 (76.68%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVE-SSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIE 1637
            P   S+CTF++D     SPH  ++  ++PKI+ +IL  IG TPLV++N I K E I CEILVKCE+ N GGSVKDRI LRMIEDAE SG++KPGD LIEPTSGNTGIGLALAAAVKGY+C IVMPEKMS EKVDVLRALGA+IVRTPT+ASYDS ES+I VA +L   + NSHIL+QYTNPSNP+AH+DGTAEEIL +C   +DMVV+ AGTGGTL GVARK+KQ+CP CL++GVDP GSILAQP+ +N + VT Y+VEGIGYDFVPTVLDRS VD+WYK  D DS  MARRLIR EGLLCGGSSG+A   A++A +DF L    RVVV+LPDSVRNYMTKFLSDDWM +R  M  P  + S   ++     ++ SL+L AP+TV P V+V +TLEL  +E  DQVPVVE SSG I+GMAT+  I S +++ +L  TDPV  A +  F KV  ++ +  +SR LD DHFVLVV QQRQ    G E ++E +YGI+TRIDL++++++
Sbjct:   41 PNHDSRCTFRIDKPVCESPHLHQKRKERPKILPDILHHIGNTPLVRVNNITKEEGIECEILVKCEFFNAGGSVKDRIGLRMIEDAERSGRLKPGDVLIEPTSGNTGIGLALAAAVKGYRCTIVMPEKMSKEKVDVLRALGADIVRTPTAASYDSAESHIGVAKQLLNTVANSHILDQYTNPSNPMAHFDGTAEEILEACSGQLDMVVLGAGTGGTLCGVARKLKQRCPDCLIIGVDPLGSILAQPDELNATKVTGYDVEGIGYDFVPTVLDRSLVDRWYKSNDVDSLRMARRLIRREGLLCGGSSGSAFDCALRAVRDFGLGAGKRVVVLLPDSVRNYMTKFLSDDWMIERGHMPDPEDDPSLGPSHAWMSVRVGSLDLRAPLTVAPDVSVSETLELFNRESIDQVPVVERSSGAIVGMATLSNITSRIIRGSLAPTDPVGSAAFDKFTKVTPDAKLGAVSRRLDTDHFVLVVQQQRQFGSAG-EAVREFVYGILTRIDLLNFILK 545          
BLAST of Cystathionine beta-synthase vs. TrEMBL
Match: A0A267G0J9 (Cystathionine beta-synthase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000058g3 PE=3 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 316/506 (62.45%), Postives = 388/506 (76.68%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVE-SSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIE 1637
            P   S+CTF++D     SPH  ++  ++PKI+ +IL  IG TPLV++N I K E I CEILVKCE+ N GGSVKDRI LRMIEDAE SG++KPGD LIEPTSGNTGIGLALAAAVKGY+C IVMPEKMS EKVDVLRALGA+IVRTPT+ASYDS ES+I VA +L   + NSHIL+QYTNPSNP+AH+DGTAEEIL +C   +DMVV+ AGTGGTL GVARK+KQ+CP CL++GVDP GSILAQP+ +N + VT Y+VEGIGYDFVPTVLDRS VD+WYK  D DS  MARRLIR EGLLCGGSSG+A   A++A +DF L    RVVV+LPDSVRNYMTKFLSDDWM +R  M  P  + S   ++     ++ SL+L AP+TV P V+V +TLEL  +E  DQVPVVE SSG I+GMAT+  I S +++ +L  TDPV  A +  F KV  ++ +  +SR LD DHFVLVV QQRQ    G E ++E +YGI+TRIDL++++++
Sbjct:   41 PNHDSRCTFRIDKPVCESPHLHQKRKERPKILPDILHHIGNTPLVRVNNITKEEGIECEILVKCEFFNAGGSVKDRIGLRMIEDAERSGRLKPGDVLIEPTSGNTGIGLALAAAVKGYRCTIVMPEKMSKEKVDVLRALGADIVRTPTAASYDSAESHIGVAKQLLNTVANSHILDQYTNPSNPMAHFDGTAEEILEACSGQLDMVVLGAGTGGTLCGVARKLKQRCPDCLIIGVDPLGSILAQPDELNATKVTGYDVEGIGYDFVPTVLDRSLVDRWYKSNDVDSLRMARRLIRREGLLCGGSSGSAFDCALRAVRDFGLGAGKRVVVLLPDSVRNYMTKFLSDDWMIERGHMPDPEDDPSLGPSHTWMSVRVGSLDLRAPLTVAPDVSVSETLELFNRESIDQVPVVERSSGAIVGMATLSNITSRIIRGSLAPTDPVGSAAFDKFTKVTPDAKLGAVSRRLDTDHFVLVVQQQRQFGSAG-EAVREFVYGILTRIDLLNFILK 545          
BLAST of Cystathionine beta-synthase vs. Ensembl Cavefish
Match: cbsb (cystathionine beta-synthase [Source:NCBI gene;Acc:103030674])

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 304/505 (60.20%), Postives = 384/505 (76.04%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKP--MTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P + S+CT+KLD     SPH+       P I+ NIL  IG TP+V +NKI K   + CEIL KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPN+HIL+QY NPSNPLAHYDGTAEEIL  CD  IDM+V  AGTGGT+ G+ARK+K+KCP   +VGVDP GS LA+PE +NK++ T YEVEGIGYDF+PTVLDRS VD WYK  D +SF M+R LIR+EGLLCGGSSG+A+ AAV  AK+  L +  R VV+LPDSVRNYM+KFLSD WM ++ F+ +   M N+        +   +  L L+AP+TV PSV ++ T+++LK++ FDQ PVV+ +G I+GM T+G ++S ++   +  +DPV K +YK FK+V L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++GIVT IDL++Y+
Sbjct:   90 PDLASRCTWKLDGPNVDSPHNHSIRTKAPHILPNILRKIGDTPMVHINKIPKTFGLKCEILAKCEFFNAGGSVKDRISLRMVEDAEEAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNAHILDQYRNPSNPLAHYDGTAEEILEQCDGKIDMLVAGAGTGGTITGIARKLKEKCPNIKIVGVDPEGSTLAEPEDLNKTNKTAYEVEGIGYDFIPTVLDRSVVDSWYKSNDDESFAMSRMLIRDEGLLCGGSSGSAMAAAVTVAKE--LKEGQRCVVILPDSVRNYMSKFLSDKWMCEKGFLGEEDLMVNKP-----WWWNLTLQELRLSAPLTVLPSVNIKNTIKILKEKAFDQAPVVDEAGVILGMVTLGNMLSSVLAGKVSPSDPVIKVLYKQFKQVRLTDNLGKLSRILETDHFALVVHEQIQYMTDGSSTLKQMVFGIVTAIDLLNYV 587          
BLAST of Cystathionine beta-synthase vs. Ensembl Cavefish
Match: cbsa (cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB-GENE-050417-367])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 307/527 (58.25%), Postives = 397/527 (75.33%), Query Frame = 3
Query:   51 IPLNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            I LNR K+A+    I+        P + SKCT++L +    SPH+         I+ NIL  IG TPLV++NKI K   + CE+L KCEY N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   ++ VDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VD WYK  D++SF MAR LIR+EGLLCGGSSG A+ AAV+AAK+  L +  R VV+LPDS+RNYM+KFLSD WM+ + F+ +     S       +  ++ SLNL+AP+TV P+VT ++T+++LK++GFDQ PVV  SG I+GM T+G +++ ++   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++G+VT IDL++++
Sbjct:   41 IQLNRDKVASERKWIR--------PDLSSKCTWRLGAPQTDSPHTHPPRIHASSILPNILQGIGDTPLVRINKITKTFGLKCEMLAKCEYFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSLEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDTTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNIKIIAVDPEGSILAEPEELNQTDKTQYEVEGIGYDFIPTVLDRTVVDSWYKTNDEESFAMARMLIRDEGLLCGGSSGTAMAAAVKAAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFQKGFLTEEDIMVSKPW---WWNLRLQSLNLSAPLTVLPTVTCQKTIKILKEKGFDQAPVVNESGVILGMVTLGNMLASVLAGKVKPSDPVSKVLYKQFKQIRLTDNMGKLSRILETDHFALVVHEQIQYLTDGSTTLKQMVFGVVTAIDLLNFV 554          
BLAST of Cystathionine beta-synthase vs. Ensembl Cavefish
Match: cbsa (cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB-GENE-050417-367])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 308/532 (57.89%), Postives = 398/532 (74.81%), Query Frame = 3
Query:   51 IPLNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTK 1646
            I LNR K+A+    I+        P + SKCT++L +    SPH+         I+ NIL  IG TPLV++NKI K   + CE+L KCEY N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   ++ VDP GSILA+PE +N++  T YEVEGIGYDF+PTVLDR+ VD WYK  D++SF MAR LIR+EGLLCGGSSG A+ AAV+AAK+  L +  R VV+LPDS+RNYM+KFLSD WM+ + F+ +     S       +  ++ SLNL+AP+TV P+VT ++T+++LK++GFDQ PVV  SG I+GM T+G +++ ++   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++G+VT IDL++++    K
Sbjct:   41 IQLNRDKVASERKWIR--------PDLSSKCTWRLGAPQTDSPHTHPPRIHASSILPNILQGIGDTPLVRINKITKTFGLKCEMLAKCEYFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSLEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDTTAEEILEQCD--VDMLVAGAGTGGTITGIARKLKEKCPNIKIIAVDPEGSILAEPEELNQTDKTQYEVEGIGYDFIPTVLDRTVVDSWYKTNDEESFAMARMLIRDEGLLCGGSSGTAMAAAVKAAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFQKGFLTEEDIMVSKP---WWWNLRLQSLNLSAPLTVLPTVTCQKTIKILKEKGFDQAPVVNESGVILGMVTLGNMLASVLAGKVKPSDPVSKVLYKQFKQIRLTDNMGKLSRILETDHFALVVHEQIQYLTDGSTTLKQMVFGVVTAIDLLNFVTAREK 557          
BLAST of Cystathionine beta-synthase vs. Ensembl Cavefish
Match: cbsb (cystathionine beta-synthase [Source:NCBI gene;Acc:103030674])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 294/509 (57.76%), Postives = 369/509 (72.50%), Query Frame = 3
Query:  123 PGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKP--MTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGM----ATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P + S+CT+KLD     SPH+       P I+ NIL  IG TP+V +NKI K   + CEIL KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPN+HIL+QY NPSNPLAHYDGTAEEIL  CD  IDM+V  AGTGGT+ G+ARK+K+KCP   +VGVDP GS LA+PE +NK++ T YEVEGIGYDF+PTVLDRS VD WYK  D +SF M+R LIR+EGLLCGGSSG+A+ AAV  AK+  L +  R VV+LPDSVRNYM+KFLSD WM ++ F+ +   M N+        +   +  L L+AP+TV PSV ++ T+++LK++ FDQ PVV+ +G +I +      +    S        L  P    ++     V L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++GIVT IDL++Y+
Sbjct:   90 PDLASRCTWKLDGPNVDSPHNHSIRTKAPHILPNILRKIGDTPMVHINKIPKTFGLKCEILAKCEFFNAGGSVKDRISLRMVEDAEEAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNAHILDQYRNPSNPLAHYDGTAEEILEQCDGKIDMLVAGAGTGGTITGIARKLKEKCPNIKIVGVDPEGSTLAEPEDLNKTNKTAYEVEGIGYDFIPTVLDRSVVDSWYKSNDDESFAMSRMLIRDEGLLCGGSSGSAMAAAVTVAKE--LKEGQRCVVILPDSVRNYMSKFLSDKWMCEKGFLGEEDLMVNKP-----WWWNLTLQELRLSAPLTVLPSVNIKNTIKILKEKAFDQAPVVDEAGYVININHTENQIRFYQSNEHAPPFTLLLPPKSKVF----DVRLTDNLGKLSRILETDHFALVVHEQIQYMTDGSSTLKQMVFGIVTAIDLLNYV 587          
BLAST of Cystathionine beta-synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006465.1 (pep scaffold:Pmarinus_7.0:GL485116:3950:11309:-1 gene:ENSPMAG00000005834.1 transcript:ENSPMAT00000006465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 3.360e-51
Identity = 95/217 (43.78%), Postives = 144/217 (66.36%), Query Frame = 3
Query: 1017 LLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFM-------DKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTK 1646
            ++ GGSSG+A+ AAV+AAK  +L +  R VV+LPDS+RNYMTKFLSD WM  + F+       +KP            ++ K+  L L+AP+TV P+V+ ++T+ LL+++G+DQVPVV S+G ++GM T+G ++S  +   +  +DPVSK +YK FK++ L   + +LSR+L+ DHF LVVH Q Q    G  + + M++GIVT IDL++Y+    K
Sbjct:    1 MVAGGSSGSAMVAAVEAAK--SLREGQRCVVLLPDSIRNYMTKFLSDHWMAQKGFLPEEDYLPNKPWW----------WDMKVQDLCLSAPLTVLPTVSCQETMALLREKGYDQVPVVNSAGLVLGMVTLGNMLSCTLAGKVKPSDPVSKILYKQFKQITLKDNLGKLSRILETDHFALVVHDQIQYRGQGHSQKQNMVFGIVTAIDLLNYVTTREK 205          
BLAST of Cystathionine beta-synthase vs. Ensembl Yeast
Match: CYS4 (Cystathionine beta-synthase; catalyzes synthesis of cystathionine from serine and homocysteine, the first committed step in cysteine biosynthesis; responsible for hydrogen sulfide generation; advances passage through START by promoting cell growth which requires catalytic activity, and reducing critical cell size independent of catalytic activity; mutations in human ortholog CBS cause homocystinuria; human CBS can complement yeast null mutant [Source:SGD;Acc:S000003387])

HSP 1 Score: 384.415 bits (986), Expect = 2.451e-128
Identity = 221/505 (43.76%), Postives = 313/505 (61.98%), Query Frame = 3
Query:  222 NILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPG-DTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCD--NIID---MVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDF-NLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMD---------KPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLV---LTDPVSKAIYKNFKKVNLNSTIQQL----------------SRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            N++  +G TPL+ L K+ K   I  +I  K E  NPGGS+KDRI+  M+E+AEASG+I P   TLIEPTSGNTGIGLAL  A+KGY+ II +PEKMS EKV VL+ALGAEI+RTPT+A++DSPES+I VA +L++EIP + IL+QY N  NP AHY GT  EI    +  N+ D    VV  AGTGGT++G+++ +K++  K  +VG DPFGSILAQPE++NK+ +T Y+VEGIGYDFVP VLDR  +D WYK  DK SF  AR+LI  EG+L GGSSG+A  A V+  +D   L +   +V + PDS+R+Y+TKF+ D+W+   N  D           +   +    +V     +  L+L   ++V+ +  V   +++LK  GFDQ+PV+   G + G+ T    +S L++K  +     D   K  Y +FKK+N  + +                   S+L D++ F      ++  +   T+ LK +   IVT++DL+SY+
Sbjct:   13 NVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVLARFDSSKLEASTTKYADVFGNATVKDLHLKPVVSVKETAKVTDVIKILKDNGFDQLPVLTEDGKLSGLVT----LSELLRKLSINNSNNDNTIKGKYLDFKKLNNFNDVSSYNENKSGKKKFIKFDENSKLSDLNRFF-----EKNSSAVITDGLKPI--HIVTKMDLLSYL 506          
BLAST of Cystathionine beta-synthase vs. Ensembl Yeast
Match: MCY1 (Putative cysteine synthase; localized to the mitochondrial outer membrane [Source:SGD;Acc:S000003244])

HSP 1 Score: 120.168 bits (300), Expect = 4.928e-30
Identity = 105/342 (30.70%), Postives = 168/342 (49.12%), Query Frame = 3
Query:  201 DKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGD--TLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSH------ILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCP-KCLVVGVDPFGSIL------------AQPESINKSSVTFYEVEGIGYDFVPT--VLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSD 1157
            D P+  + +   IG TPLVK+  + K   ++  I  K E  NP GS KDR++L +I+ AE  G++  G+   + E TSG+TGI +A+     GY+  I +P+  S+EK+ +L +LGA + +   ++  D P   ++ A +   E+  S         +Q+ N +N   HY  T  EI       ID  +   GTGGT+ GVA+ +K++    C VV  DP GS               + E   +       VEGIG + +     +   F+D+  +V D  +  MA+ L   +GL  G S+     AA+Q AK   LP  + +V++  DS   +++KF  +
Sbjct:   41 DIPRPKEGVEELIGNTPLVKIRSLTKATGVN--IYAKLELCNPAGSAKDRVALNIIKTAEELGELVRGEPGWVFEGTSGSTGISIAVVCNALGYRAHISLPDDTSLEKLALLESLGATVNKVKPASIVD-PNQYVNAAKKACNELKKSGNGIRAVFADQFENEANWKVHYQTTGPEIAHQTKGNIDAFIAGCGTGGTITGVAKFLKERAKIPCHVVLADPQGSGFYNRVNYGVMYDYVEKEGTRRRHQVDTIVEGIGLNRITHNFHMGEKFIDESIRVNDNQAIRMAKYLSVNDGLFVGSSTAINAVAAIQVAK--TLPHGSNIVIIACDSGSRHLSKFWKE 377          
BLAST of Cystathionine beta-synthase vs. Ensembl Nematostella
Match: EDO43469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYI9])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 394/518 (76.06%), Query Frame = 3
Query:   93 IKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIH-DKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQR-QITPTGTEELKEMIYGIVTRIDLISYMIES 1640
            +K    ++  P + SKCT+ L ++ A SPH  ++      KIM NIL  IG TPLV++N IGK   + CE+L KCE+ N GGSVKDRI LRMIE+AE  G++KPGDTLIEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS EKVDVLRALGAEIVRTPT A +DSPES+I VA RL  EI NSHIL+QY NP NPLAHYD TA+EIL  CD  +DMVV+ AGTGGT+ G+ARK+K+KCP   +VGVDP GSILA+PES+N+S V+ Y VEGIGYDFVPTVLDRS VDKWYK  DK SF M+RRLIREEGLLCGGSSG+A+ AAV+AAK  N  +  R VV+LPDSVRNYMTKFLSDDWM ++ F++ P TN   D     ++K++ +LN   P++V PS++ +  ++++ +EG+DQ+PVV  +G ++GM T+G IMS ++   +  +D VSK IYKNFKKV L + +  LSR+LD DH+ LVVH QR  I P    E KEM++GIVTR+DL++Y+  S
Sbjct:   17 LKGKERKWIRPDLKSKCTWHLGANLADSPHHHEKARVPSSKIMPNILQKIGDTPLVRINNIGKTYGLKCELLAKCEFFNAGGSVKDRIGLRMIEEAEREGRLKPGDTLIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSNEKVDVLRALGAEIVRTPTEAKFDSPESHIGVAQRLNAEIANSHILDQYRNPGNPLAHYDSTADEILQQCDGKVDMVVLGAGTGGTITGIARKLKEKCPGVTIVGVDPKGSILAEPESLNESDVSMYHVEGIGYDFVPTVLDRSVVDKWYKSEDKTSFTMSRRLIREEGLLCGGSSGSAMVAAVEAAKSLN--EGQRCVVILPDSVRNYMTKFLSDDWMTEKGFVE-PNTN-GFDSKLWWWKKQLHALNPPTPLSVLPSISCQHCIDIMSREGYDQLPVVNEAGGVLGMLTLGNIMSHIIAGRMKPSDSVSKCIYKNFKKVTLETNLGTLSRILDHDHYALVVHSQRVYIAPDKVTE-KEMVFGIVTRVDLLNYITRS 529          
BLAST of Cystathionine beta-synthase vs. Ensembl Nematostella
Match: EDO42437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1D2])

HSP 1 Score: 449.899 bits (1156), Expect = 4.239e-153
Identity = 246/493 (49.90%), Postives = 338/493 (68.56%), Query Frame = 3
Query:  168 ATSPHSKKEIHDKP-KIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTF--YEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIE 1637
            ATSPH  +   DK  KI+ N+L  IG TP++++N +GK   + CE++ KCE++NP GS+KDRI +RMIEDAE    IKPGDTLIEPTSGNTGI LALA+AVKGY+C+IVM EKMS +K D  +ALG   VR P  A +DSPES I +A +L++EIPNS++LNQY NPSNPLAHYDGTAEEIL  CD  +DM+VI  GTGGTL GVARKI++K P   +V VDP+GS+LA PE +NK+   F  Y VEGIG  +VP VLDR  VD+W K+GDK++F  A+RL +EEGLL GGSSG+ + AAV+AA+D  L ++ R VVV  DS+RNYM+KF+SD+W+ +RN     + +  ND  +    +K+SSL+L     V  ++TV+  L      G  +V V ++ G I+G+ T G +++      + ++  + K IYK F +V+ +++++++SR LD D+FVLV     Q             + +VTR  L++++IE
Sbjct:   47 ATSPHFHEPPPDKNNKILPNVLHSIGNTPMIRINNVGKRCGLKCEVVAKCEFMNPVGSLKDRIGVRMIEDAERDNHIKPGDTLIEPTSGNTGIALALASAVKGYRCVIVMSEKMSSDKADTQKALGGICVRAPAEAKFDSPESTIRLAQQLQKEIPNSYVLNQYRNPSNPLAHYDGTAEEILQQCDGKLDMLVIGTGTGGTLTGVARKIREKLPHVKIVAVDPYGSVLAVPEELNKTEPGFKGYNVEGIGKPYVPVVLDRDLVDEWQKIGDKEAFYFAKRLSKEEGLLVGGSSGSVMAAAVRAAQD--LDENQRCVVVFADSIRNYMSKFVSDEWLEERNLQHDDIND--NDPQHWWLSEKVSSLSLPFSAPVSSNLTVKDLLAFFSNGGNQEVAVQDNKGRILGIVTHGNLLASEAAGRVDMSSTLEKLIYKKFDQVSRDTSLEKVSRCLDNDYFVLVPGCDSQ------------EFSVVTRGHLLNFIIE 523          
BLAST of Cystathionine beta-synthase vs. Ensembl Nematostella
Match: EDO37028 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH12])

HSP 1 Score: 147.132 bits (370), Expect = 5.601e-41
Identity = 93/196 (47.45%), Postives = 121/196 (61.73%), Query Frame = 3
Query:  246 TPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDP 833
            TPL++LNK+   ++  C I VK E+LNPGGSVKDR +L +I++AE  G +KPG T++E T+GNTGIGLA     KGYKC+I MP   S EK+D+L+ALGAE+   P    +D   +    A R  + I N    NQ+ N +N  AH++ T  EI    D  ID VV   GTGGTLAGV   +K K P   V+  DP
Sbjct:   10 TPLIRLNKLS--DETGCNITVKGEHLNPGGSVKDRAALFLIKEAEEKGLLKPGGTVVEGTAGNTGIGLAHICLAKGYKCVIYMPNNQSQEKMDLLKALGAEVRPVPV-VPFDDQMNYNHQARRYAESIENGVWTNQFDNTANRRAHFETTGPEIWQQTDGQIDAVVFGTGTGGTLAGVGSFLKSKNPNVKVILADP 202          
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Match: ENSORLT00000044153.1 (cystathionine beta-synthase [Source:NCBI gene;Acc:101158999])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 391/510 (76.67%), Query Frame = 3
Query:  102 PLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P  ++  P + S+C + L +  A SPH    +   P ++ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+PE +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SFNM+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM+KFLSD WM+++ F+ + +      +    +  K+  LN++AP+TV P+V+ + T+++LK++GFDQ PVV+ +G I+GM T+G ++S ++   + L+DPVSK +YK F+++ L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++G+VT +DL++++
Sbjct:   28 PERKWIRPDLPSRCKWSLGASQADSPH----LAPTPTVLPNILHRIGDTPMVRINKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDSTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNVKIVAVDPEGSILAEPEHLNKTDKTQYEVEGIGYDFIPTVLDRSVVDTWYKSNDEESFNMSRMLIREEGLLCGGSSGTAMAAAVAVAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFEKGFLSEEVLMV---KKPWWWNLKLQGLNMSAPLTVLPTVSCQNTIKILKEKGFDQAPVVDDAGLILGMVTLGNMLSSILAGKIRLSDPVSKVLYKQFRQIRLTDNLGKLSRILETDHFALVVHEQIQYLTDGSAVLKQMVFGVVTAVDLLNFV 528          
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Match: ENSORLT00000043890.1 (cystathionine beta-synthase [Source:NCBI gene;Acc:101158999])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 299/520 (57.50%), Postives = 391/520 (75.19%), Query Frame = 3
Query:  102 PLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQI----TPT------GTEELKEMIYGIVTRIDLISYM 1631
            P  ++  P + S+C + L +  A SPH    +   P ++ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+PE +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SFNM+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM+KFLSD WM+++  + +        R    +  K+  LN++AP+TV P+V+ + T+++LK++GFDQ PVV+ +G I+GM T+G ++S ++   + L+DPVSK +YK F+++ L   + +LSR+L+ DHF LVVH+Q Q     TP       G+  LK+M++G+VT +DL++++
Sbjct:   62 PERKWIRPDLPSRCKWSLGASQADSPH----LAPTPTVLPNILHRIGDTPMVRINKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDSTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNVKIVAVDPEGSILAEPEHLNKTDKTQYEVEGIGYDFIPTVLDRSVVDTWYKSNDEESFNMSRMLIREEGLLCGGSSGTAMAAAVAVAKE--LKEGQRCVVILPDSIRNYMSKFLSDKWMFEKEALVRVT------RGWEWWNLKLQGLNMSAPLTVLPTVSCQNTIKILKEKGFDQAPVVDDAGLILGMVTLGNMLSSILAGKIRLSDPVSKVLYKQFRQIRLTDNLGKLSRILETDHFALVVHEQIQCKSADTPVRIYLTDGSAVLKQMVFGVVTAVDLLNFV 569          
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Match: ENSORLT00000034391.1 (pep primary_assembly:ASM223467v1:16:223684:225405:1 gene:ENSORLG00000023606.1 transcript:ENSORLT00000034391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 278/493 (56.39%), Postives = 372/493 (75.46%), Query Frame = 3
Query:  153 LDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            L +  A SPH +      P ++ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRM+ED E +G +KPGDT+IEPT+GNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIV TPTSA +DSPES++ VA  LK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  A TGGT+  +ARK+K KCP   +VGVDP GSILA+PE +NK+    YEVEGIGYDF+PTVLDRS VD WYK   ++SFNM+R LIRE+GLLCGGSSG A+ AAV   K+  L +  R VV+LP+S+RNYM+KFL+D WM+++ F+ + +      +    +  K+  LN++AP+TV P+V+ + T+++LK++GFDQ PVV+ +G I+GM T+G ++S ++   + L++P+SK  YK F+++ L   + +LSR+ + DHF LVVH+Q Q    G+  LK+M++G++T +DL++++
Sbjct:   41 LGASQADSPHLQIPRAPTPTVLPNILHRIGDTPMVRINKIPKDFGLKCELLAKCEFFNAGGSVKDRISLRMVEDGERAGILKPGDTIIEPTAGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVCTPTSARFDSPESHVGVAWCLKNEIPNSHILDQYRNPSNPLAHYDSTAEEILEQCDGKVDMLVAGACTGGTI--IARKLKDKCPNVKIVGVDPEGSILAEPEHLNKTDKAQYEVEGIGYDFIPTVLDRSVVDTWYKSNGEESFNMSRMLIREKGLLCGGSSGTAMAAAVVVTKE--LKEGQRCVVILPNSIRNYMSKFLNDKWMFEKGFLSEGVLMV---KKPWWWNLKLQGLNMSAPLTVLPTVSCQNTIKILKEKGFDQAPVVDDAGFILGMVTLGNMLSSILAGKIRLSNPISKVYYKQFRQIRLTDNLGKLSRIPETDHFALVVHEQIQYLTDGSAVLKQMVFGMITAVDLLNFV 526          
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Match: ENSORLT00000033433.1 (cystathionine beta-synthase [Source:NCBI gene;Acc:101158999])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/510 (57.25%), Postives = 379/510 (74.31%), Query Frame = 3
Query:  102 PLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P  ++  P + S+C + L +  A SPH +      P ++ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+PE +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SFNM+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM+          R   D         R    +  K+  LN++AP+TV P+V+ + T+++LK++GFDQ PVV+ +G I+GM T+G ++S ++   + L+DPVSK +YK F+++ L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++G+VT +DL++++
Sbjct:   46 PERKWIRPDLPSRCKWSLGASQADSPHLQIPRAPTPTVLPNILHRIGDTPMVRINKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDSTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNVKIVAVDPEGSILAEPEHLNKTDKTQYEVEGIGYDFIPTVLDRSVVDTWYKSNDEESFNMSRMLIREEGLLCGGSSGTAMAAAVAVAKE--LKEGQRCVVILPDSIRNYMSLI--------RGGFDGEEALVRVTRGWEWWNLKLQGLNMSAPLTVLPTVSCQNTIKILKEKGFDQAPVVDDAGLILGMVTLGNMLSSILAGKIRLSDPVSKVLYKQFRQIRLTDNLGKLSRILETDHFALVVHEQIQYLTDGSAVLKQMVFGVVTAVDLLNFV 545          
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Match: ENSORLT00000043729.1 (cystathionine beta-synthase [Source:NCBI gene;Acc:101158999])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/510 (57.25%), Postives = 379/510 (74.31%), Query Frame = 3
Query:  102 PLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYM 1631
            P  ++  P + S+C + L +  A SPH    +   P ++ NIL  IG TP+V++NKI K   + CE+L KCE+ N GGSVKDRISLRM+EDAE +G +KPGDT+IEPTSGNTGIGLALAAAVKGY+CIIVMPEKMS+EKVDVLRALGAEIVRTPTSA +DSPES++ VA RLK EIPNSHIL+QY NPSNPLAHYD TAEEIL  CD  +DM+V  AGTGGT+ G+ARK+K+KCP   +V VDP GSILA+PE +NK+  T YEVEGIGYDF+PTVLDRS VD WYK  D++SFNM+R LIREEGLLCGGSSG A+ AAV  AK+  L +  R VV+LPDS+RNYM          +R   D         R    +  K+  LN++AP+TV P+V+ + T+++LK++GFDQ PVV+ +G I+GM T+G ++S ++   + L+DPVSK +YK F+++ L   + +LSR+L+ DHF LVVH+Q Q    G+  LK+M++G+VT +DL++++
Sbjct:   62 PERKWIRPDLPSRCKWSLGASQADSPH----LAPTPTVLPNILHRIGDTPMVRINKIPKAFGLKCELLAKCEFFNAGGSVKDRISLRMVEDAERAGILKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTSARFDSPESHVGVAWRLKNEIPNSHILDQYRNPSNPLAHYDSTAEEILEQCDGKVDMLVAGAGTGGTITGIARKLKEKCPNVKIVAVDPEGSILAEPEHLNKTDKTQYEVEGIGYDFIPTVLDRSVVDTWYKSNDEESFNMSRMLIREEGLLCGGSSGTAMAAAVAVAKE--LKEGQRCVVILPDSIRNYM--------FPERGGFDGEEALVRVTRGWEWWNLKLQGLNMSAPLTVLPTVSCQNTIKILKEKGFDQAPVVDDAGLILGMVTLGNMLSSILAGKIRLSDPVSKVLYKQFRQIRLTDNLGKLSRILETDHFALVVHEQIQYLTDGSAVLKQMVFGVVTAVDLLNFV 557          
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Match: SMESG000065264.1 (SMESG000065264.1)

HSP 1 Score: 1034.63 bits (2674), Expect = 0.000e+0
Identity = 518/528 (98.11%), Postives = 519/528 (98.30%), Query Frame = 3
Query:   72 MANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTKAIG 1655
            MANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGAAVYAAVQAAKDFNLPQ ARVVVVLPDSVRNYMTKFLSDDWMY+RNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKK        QLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTKAIG
Sbjct:    1 MANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGAAVYAAVQAAKDFNLPQPARVVVVLPDSVRNYMTKFLSDDWMYNRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKK--------QLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIESTKAIG 520          
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Match: SMESG000050056.1 (SMESG000050056.1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 424/532 (79.70%), Postives = 458/532 (86.09%), Query Frame = 3
Query:   45 FQIPLNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIES 1640
             QI + RK + N I SIKSPL QFPN G   K TF++ S+P  S    KE  DKPKIMDNILLDIG TPLVKLN IGK E + CEILVKCEYLNPGGSVK+RISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDN IDM+V   GTGGTL G+A+KIKQ+CPKCLV+GVDP GSI+A+ ES+N S + FYE+EGIG DF+PTVLD S +DKWYKV DK+SF MARRLIREEGLLCGGSSG AVYAAVQAAKDFNLP++ARVVVVLPDSVRNYM                          N++EFE+KIS LNLNAP+TVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTL LTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQI  +G+EELKE +YGI+TRIDL++Y+I+S
Sbjct:    8 LQIFMKRKVLDNQISSIKSPLKQFPNSGKLGKFTFQVASEPEKSSRGTKERQDKPKIMDNILLDIGNTPLVKLNSIGKAENVLCEILVKCEYLNPGGSVKERISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNNIDMIVAGVGTGGTLTGIAKKIKQQCPKCLVIGVDPIGSIVAELESMNNSKIAFYEIEGIGGDFLPTVLDHSIIDKWYKVDDKESFLMARRLIREEGLLCGGSSGTAVYAAVQAAKDFNLPKTARVVVVLPDSVRNYM--------------------------NDIEFEEKISLLNLNAPITVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLALTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQICSSGSEELKETLYGIITRIDLVTYLIDS 513          
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Match: SMESG000050056.1 (SMESG000050056.1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 424/534 (79.40%), Postives = 458/534 (85.77%), Query Frame = 3
Query:   45 FQIPLNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCL--VVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCGGSSGXXXXXXXXXXKDFNLPQSARVVVVLPDSVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPMTVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLVLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGTEELKEMIYGIVTRIDLISYMIES 1640
             QI + RK + N I SIKSPL QFPN G   K TF++ S+P  S    KE  DKPKIMDNILLDIG TPLVKLN IGK E + CEILVKCEYLNPGGSVK+RISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDN IDM+V   GTGGTL G+A+KIKQ+CPKCL  V+GVDP GSI+A+ ES+N S + FYE+EGIG DF+PTVLD S +DKWYKV DK+SF MARRLIREEGLLCGGSSG AVYAAVQAAKDFNLP++ARVVVVLPDSVRNYM                          N++EFE+KIS LNLNAP+TVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTL LTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQI  +G+EELKE +YGI+TRIDL++Y+I+S
Sbjct:    8 LQIFMKRKVLDNQISSIKSPLKQFPNSGKLGKFTFQVASEPEKSSRGTKERQDKPKIMDNILLDIGNTPLVKLNSIGKAENVLCEILVKCEYLNPGGSVKERISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNNIDMIVAGVGTGGTLTGIAKKIKQQCPKCLVSVIGVDPIGSIVAELESMNNSKIAFYEIEGIGGDFLPTVLDHSIIDKWYKVDDKESFLMARRLIREEGLLCGGSSGTAVYAAVQAAKDFNLPKTARVVVVLPDSVRNYM--------------------------NDIEFEEKISLLNLNAPITVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTLALTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQICSSGSEELKETLYGIITRIDLVTYLIDS 515          
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Match: SMESG000065258.1 (SMESG000065258.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 265/328 (80.79%), Postives = 286/328 (87.20%), Query Frame = 3
Query:   45 FQIPLNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCG 1028
             QI + RK + N I SIKSPL QFPN G   K TF++ S+P  S    KE  DKPKIMDNILLDIG TPLVKLN IGK E + CEILVKCEYLNPGGSVK+RISL+MIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDN IDM+V   GTGGTL G+A+KIKQ+CPKCLV+GVDP GSI+A+ ES+N S + FYE+EGIG DF+PTVLD S +DKWYKV DK+SF MARRLIREEGLLCG
Sbjct:    8 LQIFMKRKVLDNQISSIKSPLKQFPNSGKLGKFTFQVASEPEKSSRGTKERQDKPKIMDNILLDIGNTPLVKLNSIGKAENVLCEILVKCEYLNPGGSVKERISLKMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNNIDMIVAGVGTGGTLTGIAKKIKQQCPKCLVIGVDPIGSIVAELESMNNSKIAFYEIEGIGGDFLPTVLDHSIIDKWYKVDDKESFLMARRLIREEGLLCG 335          
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Match: SMESG000065258.1 (SMESG000065258.1)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 263/324 (81.17%), Postives = 284/324 (87.65%), Query Frame = 3
Query:   57 LNRKKMANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMDNILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVVGVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGDKDSFNMARRLIREEGLLCG 1028
            + RK + N I SIKSPL QFPN G   K TF++ S+P  S    KE  DKPKIMDNILLDIG TPLVKLN IGK E + CEILVKCEYLNPGGSVK+RISL+MIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDN IDM+V   GTGGTL G+A+KIKQ+CPKCLV+GVDP GSI+A+ ES+N S + FYE+EGIG DF+PTVLD S +DKWYKV DK+SF MARRLIREEGLLCG
Sbjct:    1 MKRKVLDNQISSIKSPLKQFPNSGKLGKFTFQVASEPEKSSRGTKERQDKPKIMDNILLDIGNTPLVKLNSIGKAENVLCEILVKCEYLNPGGSVKERISLKMIEDAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKVDVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSNPLAHYDGTAEEILLSCDNNIDMIVAGVGTGGTLTGIAKKIKQQCPKCLVIGVDPIGSIVAELESMNNSKIAFYEIEGIGGDFLPTVLDHSIIDKWYKVDDKESFLMARRLIREEGLLCG 324          
The following BLAST results are available for this feature:
BLAST of Cystathionine beta-synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBSL0.000e+057.03cystathionine beta-synthase like [Source:HGNC Symb... [more]
CBSL0.000e+057.03cystathionine beta-synthase like [Source:HGNC Symb... [more]
CBSL0.000e+057.03cystathionine beta-synthase like [Source:HGNC Symb... [more]
CBSL0.000e+057.03cystathionine beta-synthase like [Source:HGNC Symb... [more]
CBS0.000e+057.03cystathionine beta-synthase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbs-11.549e-12155.68Cystathionine Beta-Synthase [Source:UniProtKB/TrE... [more]
cbs-28.038e-11656.09Cystathionine Beta-Synthase [Source:UniProtKB/TrE... [more]
cysl-21.702e-6144.07Bifunctional L-3-cyanoalanine synthase/cysteine sy... [more]
cysl-21.702e-6144.07Bifunctional L-3-cyanoalanine synthase/cysteine sy... [more]
cysl-16.844e-5641.54Cysteine synthase 1 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cbs1.227e-16050.29gene:FBgn0031148 transcript:FBtr0077244[more]
Cbs1.227e-16050.29gene:FBgn0031148 transcript:FBtr0077245[more]
Cbs1.227e-16050.29gene:FBgn0031148 transcript:FBtr0340437[more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbsa0.000e+058.17cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB... [more]
cbsb0.000e+057.39cystathionine beta-synthase b [Source:ZFIN;Acc:ZDB... [more]
cbsb0.000e+057.39cystathionine beta-synthase b [Source:ZFIN;Acc:ZDB... [more]
cbsa0.000e+058.17cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB... [more]
cbsa0.000e+058.17cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nipal33.090e-627.32NIPA-like domain containing 3 [Source:Xenbase;Acc:... [more]
nipal33.490e-627.32NIPA-like domain containing 3 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cbs0.000e+058.65cystathionine beta-synthase [Source:MGI Symbol;Acc... [more]
Cbs0.000e+058.65cystathionine beta-synthase [Source:MGI Symbol;Acc... [more]
Cbs0.000e+057.45cystathionine beta-synthase [Source:MGI Symbol;Acc... [more]
Cbs0.000e+057.45cystathionine beta-synthase [Source:MGI Symbol;Acc... [more]
Cbs4.234e-12874.79cystathionine beta-synthase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Cystathionine beta-synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35520|CBS_HUMAN0.000e+057.03Cystathionine beta-synthase OS=Homo sapiens OX=960... [more]
sp|P0DN79|CBSL_HUMAN0.000e+057.03Cystathionine beta-synthase-like protein OS=Homo s... [more]
sp|Q58H57|CBS_MACFA0.000e+056.45Cystathionine beta-synthase OS=Macaca fascicularis... [more]
sp|Q91WT9|CBS_MOUSE0.000e+057.45Cystathionine beta-synthase OS=Mus musculus OX=100... [more]
sp|P32232|CBS_RAT0.000e+056.95Cystathionine beta-synthase OS=Rattus norvegicus O... [more]
back to top
BLAST of Cystathionine beta-synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7B8230.000e+062.65Cystathionine beta-synthase OS=Arion vulgaris OX=1... [more]
V4A5D00.000e+062.65Cystathionine beta-synthase OS=Lottia gigantea OX=... [more]
A0A1I8GKK30.000e+064.13Cystathionine beta-synthase OS=Macrostomum lignano... [more]
A0A267F3460.000e+062.45Cystathionine beta-synthase (Fragment) OS=Macrosto... [more]
A0A267G0J90.000e+062.45Cystathionine beta-synthase (Fragment) OS=Macrosto... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cbsb0.000e+060.20cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
cbsa0.000e+058.25cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB... [more]
cbsa0.000e+057.89cystathionine beta-synthase a [Source:ZFIN;Acc:ZDB... [more]
cbsb0.000e+057.76cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006465.13.360e-5143.78pep scaffold:Pmarinus_7.0:GL485116:3950:11309:-1 g... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYS42.451e-12843.76Cystathionine beta-synthase; catalyzes synthesis o... [more]
MCY14.928e-3030.70Putative cysteine synthase; localized to the mitoc... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO434690.000e+061.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424374.239e-15349.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370285.601e-4147.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044153.10.000e+058.24cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
ENSORLT00000043890.10.000e+057.50cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
ENSORLT00000034391.10.000e+056.39pep primary_assembly:ASM223467v1:16:223684:225405:... [more]
ENSORLT00000033433.10.000e+057.25cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
ENSORLT00000043729.10.000e+057.25cystathionine beta-synthase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Cystathionine beta-synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065264.10.000e+098.11SMESG000065264.1[more]
SMESG000050056.10.000e+079.70SMESG000050056.1[more]
SMESG000050056.10.000e+079.40SMESG000050056.1[more]
SMESG000065258.10.000e+080.79SMESG000065258.1[more]
SMESG000065258.10.000e+081.17SMESG000065258.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033930 ID=SMED30033930|Name=Cystathionine beta-synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1772bp
TTCAAAGTCATTTGTATCTCTGATAGCACATTTTCAAATTACATTTCCAA
ATTCCATTGAACCGAAAGAAAATGGCCAATCCAATTCCTTCTATTAAAAG
CCCGTTGAGTCAATTTCCAAACCCAGGAATGGGGAGTAAGTGTACATTTA
AGTTAGATTCTGATCCTGCGACATCTCCGCATAGCAAAAAAGAAATCCAT
GATAAGCCAAAAATAATGGATAATATTCTGTTGGATATTGGATTGACTCC
TCTTGTAAAGTTGAACAAAATTGGCAAGATTGAGAAAATTTCATGTGAAA
TTTTGGTCAAATGTGAGTATCTCAATCCCGGCGGAAGTGTTAAAGATAGA
ATATCTTTAAGAATGATTGAGGACGCTGAAGCAAGTGGTAAAATCAAACC
AGGGGATACTCTTATTGAACCAACATCGGGAAATACGGGTATTGGTCTGG
CATTAGCTGCCGCTGTAAAAGGCTATAAATGCATAATTGTTATGCCAGAG
AAAATGAGTATTGAAAAAGTCGATGTTCTGCGGGCACTGGGAGCGGAGAT
TGTGAGGACGCCGACGTCGGCATCTTACGATTCTCCGGAATCCAATATTA
GTGTAGCTCATAGATTGAAACAGGAAATACCCAATTCTCATATCCTCAAC
CAATACACAAATCCCAGCAATCCTCTTGCGCATTACGATGGGACAGCTGA
GGAGATATTATTGAGCTGTGATAACATAATTGACATGGTAGTTATCAGTG
CGGGAACCGGTGGAACCTTAGCTGGAGTTGCGAGGAAAATCAAACAAAAA
TGTCCAAAATGTTTGGTTGTTGGGGTTGATCCATTTGGATCTATTCTTGC
CCAGCCAGAATCAATAAATAAATCAAGTGTAACATTCTACGAAGTTGAAG
GAATCGGCTATGACTTTGTACCAACGGTGCTAGATCGCAGTTTTGTTGAT
AAATGGTATAAAGTTGGAGATAAAGATAGCTTTAATATGGCTAGGCGACT
TATTAGAGAAGAAGGATTATTGTGTGGGGGCAGCAGTGGAGCGGCAGTTT
ATGCTGCTGTACAAGCTGCCAAAGATTTTAATTTACCGCAATCCGCTCGA
GTCGTCGTAGTGCTACCGGATTCAGTGAGGAATTACATGACAAAATTTCT
CAGTGACGACTGGATGTACGATCGGAATTTTATGGACAAACCCATGACCA
ACCAGTCAAATGATCGAAATAATGTCGAATTCGAGAAAAAGATCTCCTCA
CTGAATCTCAACGCTCCAATGACTGTACAGCCATCTGTAACTGTAGAACA
AACACTGGAGTTGCTGAAAAAGGAAGGATTTGACCAAGTTCCTGTGGTTG
AAAGCAGCGGATGCATCATTGGAATGGCCACTGTAGGGCTGATAATGTCA
ATGCTGATGAAGAAGACCCTCGTCCTCACTGACCCTGTATCGAAAGCTAT
TTACAAGAACTTCAAAAAAGTAAATTTGAATTCAACAATTCAGCAGTTGT
CGAGGTTGCTGGACATTGACCATTTCGTGTTGGTCGTTCACCAACAGAGA
CAGATTACCCCTACTGGTACCGAGGAATTAAAGGAAATGATTTACGGTAT
AGTAACGAGGATTGACCTTATCAGTTATATGATTGAAAGCACTAAAGCTA
TTGGATAATAATAATAATAAAGGGGTATTTTCGGGACATGGAACACTGAT
CGCGACACATTTGGTTTACTTTTGGTGCTTTGCTATTAATAAATGATTCC
ATATTTTTACATCATAACATGC
back to top

protein sequence of SMED30033930-orf-1

>SMED30033930-orf-1 ID=SMED30033930-orf-1|Name=SMED30033930-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MANPIPSIKSPLSQFPNPGMGSKCTFKLDSDPATSPHSKKEIHDKPKIMD
NILLDIGLTPLVKLNKIGKIEKISCEILVKCEYLNPGGSVKDRISLRMIE
DAEASGKIKPGDTLIEPTSGNTGIGLALAAAVKGYKCIIVMPEKMSIEKV
DVLRALGAEIVRTPTSASYDSPESNISVAHRLKQEIPNSHILNQYTNPSN
PLAHYDGTAEEILLSCDNIIDMVVISAGTGGTLAGVARKIKQKCPKCLVV
GVDPFGSILAQPESINKSSVTFYEVEGIGYDFVPTVLDRSFVDKWYKVGD
KDSFNMARRLIREEGLLCGGSSGAAVYAAVQAAKDFNLPQSARVVVVLPD
SVRNYMTKFLSDDWMYDRNFMDKPMTNQSNDRNNVEFEKKISSLNLNAPM
TVQPSVTVEQTLELLKKEGFDQVPVVESSGCIIGMATVGLIMSMLMKKTL
VLTDPVSKAIYKNFKKVNLNSTIQQLSRLLDIDHFVLVVHQQRQITPTGT
EELKEMIYGIVTRIDLISYMIESTKAIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005857Cysta_beta_synth
IPR036052Trypto_synt_PLP_dependent
IPR000644CBS_dom
IPR001926PLP-dep
IPR001216P-phosphate_BS
Vocabulary: biological process
TermDefinition
GO:0006535cysteine biosynthetic process from serine
GO:0008652cellular amino acid biosynthetic process
GO:0019343cysteine biosynthetic process via cystathionine
GO:0019344cysteine biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004122cystathionine beta-synthase activity
GO:0016829lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000644CBS domainSMARTSM00116cbs_1coord: 398..446
e-value: 0.0046
score: 26.2
coord: 463..521
e-value: 120.0
score: 0.0
IPR000644CBS domainPFAMPF00571CBScoord: 398..438
e-value: 9.1E-5
score: 22.8
IPR000644CBS domainPROSITEPS51371CBScoord: 391..451
score: 10.05
IPR000644CBS domainPROSITEPS51371CBScoord: 460..527
score: 6.016
IPR005857Cystathionine beta-synthaseTIGRFAMTIGR01137TIGR01137coord: 48..520
e-value: 2.5E-197
score: 654.0
IPR036052Tryptophan synthase beta subunit-like PLP-dependent enzymeGENE3DG3DSA:3.40.50.1100coord: 56..358
e-value: 4.9E-129
score: 431.8
IPR036052Tryptophan synthase beta subunit-like PLP-dependent enzymeGENE3DG3DSA:3.40.50.1100coord: 88..201
e-value: 4.9E-129
score: 431.8
IPR036052Tryptophan synthase beta subunit-like PLP-dependent enzymeSUPERFAMILYSSF53686Tryptophan synthase beta subunit-like PLP-dependent enzymescoord: 39..368
IPR001926Pyridoxal-phosphate dependent enzymePFAMPF00291PALPcoord: 54..350
e-value: 1.0E-64
score: 218.8
NoneNo IPR availableGENE3DG3DSA:3.10.580.10coord: 377..526
e-value: 1.4E-44
score: 153.5
NoneNo IPR availablePANTHERPTHR10314SER/THR DEHYDRATASE AND TRP SYNTHASE FAMILY MEMBERcoord: 22..463
NoneNo IPR availablePANTHERPTHR10314:SF163CYSTATHIONINE BETA-SYNTHASEcoord: 22..463
NoneNo IPR availableCDDcd01561CBS_likecoord: 57..357
e-value: 4.15904E-148
score: 424.234
NoneNo IPR availableCDDcd04608CBS_pair_CBScoord: 389..519
e-value: 1.76197E-41
score: 143.057
NoneNo IPR availableSUPERFAMILYSSF54631CBS-domain paircoord: 395..522
IPR001216Cysteine synthase/cystathionine beta-synthase, pyridoxal-phosphate attachment sitePROSITEPS00901CYS_SYNTHASEcoord: 80..98