CTP synthase

Overview
NameCTP synthase
Smed IDSMED30033929
Length (bp)2026
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CTP synthase (SMED30033929) t-SNE clustered cells

Violin plots show distribution of expression levels for CTP synthase (SMED30033929) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CTP synthase (SMED30033929) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CTP synthase (SMED30033929) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033929

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033929h1SMcG0006110 SmedASXL_009166SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033929h1SMcG0006110 Contig48885newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033929h1SMcG0006110 Contig48885uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30033929h1SMcG0006110 dd_Smed_v4_5375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033929h1SMcG0006110 dd_Smed_v4_5375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30033929h1SMcG0006110 dd_Smed_v4_5375_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CTP synthase vs. Ensembl Human
Match: CTPS1 (CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 430/568 (75.70%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L     P+K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  I +  + + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R  K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VV++MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP + +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ 556          
BLAST of CTP synthase vs. Ensembl Human
Match: CTPS1 (CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 430/568 (75.70%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L     P+K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  I +  + + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R  K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VV++MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP + +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ 556          
BLAST of CTP synthase vs. Ensembl Human
Match: CTPS1 (CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 430/568 (75.70%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L     P+K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  I +  + + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R  K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VV++MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP + +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ 556          
BLAST of CTP synthase vs. Ensembl Human
Match: CTPS1 (CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 430/568 (75.70%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L     P+K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  I +  + + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R  K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VV++MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP + +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ 556          
BLAST of CTP synthase vs. Ensembl Human
Match: CTPS2 (CTP synthase 2 [Source:HGNC Symbol;Acc:HGNC:2520])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 335/586 (57.17%), Postives = 425/586 (72.53%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDD 1823
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ +Q+W+   A++ +D  ++EP+IC+IE+GGTIGDIE  PF+EAFRQFQF+    NFC+IHVSL+P   +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV   QVI + DV + Y+VP++L  Q + +    +L L    +    L+KW+ + D+ ++  +  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  I  T   ++F EAW+K+  A G+++PGGFGIRG  GK+ AI + R  K+P LGVCLGMQ  VIEFARN L   DA STEF  N    +VI+MPE NP   GGTMRLG R T F T N            S++  LY +V  I+ERHRHRFEVNP  ++ FE+N + FVG+D + +RMEI+EL+ HPYFVGVQ+HPE+ SRP +PSPPY GL+LAAT  L+  L+       +D + +D  DD
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTEN------------SILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCKLSSSDRY-SDASDD 573          
BLAST of CTP synthase vs. Ensembl Celegans
Match: ctps-1 (CTP synthase [Source:UniProtKB/TrEMBL;Acc:G5EC98])

HSP 1 Score: 505.753 bits (1301), Expect = 2.231e-171
Identity = 312/639 (48.83%), Postives = 403/639 (63.07%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAP-KKDLY----KWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNN--VVIEMPEFNPLQK--GGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEE------------------------------------------------RMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEE 1817
            +KYILVTGGVISG+GKGIISSS+G LLK+ G++V+AIKIDPYLN DAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NNITTGK+++ V+ +ER GDY GKTVQ++PH+T+ I DWI +VARI +D T ++P++CIIE+GGTIGDIE   ++ AF +FQ     N+  ++HVSLI  P +T E K+KP Q SVR LR  G+ PD+L+CRS   +   L++K++ F  +   QV+ V DV  +Y+VPL+L  Q V E I ++L L+ I    +KDL      W  L +      + V I LVGKYV + DAY SV KAL+HAA+ +  KL +  V++E L    G   +   AW  VK A GVI+PGGF  RG+EG + A ++CR+N VP LGVCLGMQ   IEFARNVL    A+STEF+     N  +VI+MPE N  +K  GGTMRLG+R T F T               ++H LY    +++ERHRHR+EVNP  V    + G  FVG   +E+                                                RME+ E+ +HPYFVG Q+HPEYLS P  PSPP+FGL+LAAT QL+     SG+R      + +EE
Sbjct:    7 VKYILVTGGVISGVGKGIISSSLGVLLKNNGYKVSAIKIDPYLNEDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNITTGKMFKHVMERERRGDYCGKTVQMIPHLTDAIVDWIERVARIPVDGTSEQPDVCIIELGGTIGDIEGMTYLSAFERFQRPTLKNDLMNVHVSLILHPNATGEPKTKPMQNSVRHLRAAGLVPDLLICRSTEKLDPHLREKIAGFGMMDLEQVVGVHDVSNIYKVPLLLQQQGVLEAITQRLRLSEISENIRKDLKFNMNHWTNLSELCDTFQQVVNIALVGKYVKIADAYASVNKALSHAAIHAKRKLKITYVDSELLENKPGMEEQSRAAWDSVKAADGVIVPGGFDKRGVEGMINAAEYCRKNDVPYLGVCLGMQVAAIEFARNVLSIDGANSTEFNSKLHENQQIVIDMPEHNVEEKGLGGTMRLGRRSTVFLTDEC------------ILHRLY-GTHTVEERHRHRYEVNPHVVPQMARKGFLFVGMGVDEQNTDIWDVKKRTDSSAELMQMADQTEIDLLHKIDDLCQRGGDGVTRPAVRMEMFEMKDHPYFVGAQFHPEYLSHPLTPSPPFFGLLLAATRQLNSYF--SGSRSPALQVVNEEE 630          
BLAST of CTP synthase vs. Ensembl Fly
Match: CTPsyn (gene:FBgn0266452 transcript:FBtr0345691)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 338/591 (57.19%), Postives = 434/591 (73.43%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPK-KDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENT--GKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKIS---GNRHRNDSFLTDEEDDL 1826
            MKYILVTGGVISG+GKG+I+SS GTLLKSCG  VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDG EVDLDLGNYERFLDVTL R+NNITTGKIY+ VI KER G+YLGKTVQVVPHIT+ IQ+W+ +VA+  + Q   +P++CI+E+GGTIGDIE  PF+EAFRQFQFRV   NFC  HVSL+P PK+T E K+KPTQ+SVRELRG G+SPD+++CRSE  I  E+K+K+S FCHV  +QVI + D+ ++Y VPL++    V E +  +L L    + + K L +W+ L  + +   REV I +VGKY    D+Y SV KAL HAAL  N KL +  + +  L E T   +  ++ + W+K+  + G+++PGGFG RG+EGK+ A ++ REN+ P+LG+CLG+Q  VIEFARN L   DA++TE D NT N +VI+MPE +  Q GGTMRLGKR T F            GP  SVI  LY N KS+QERHRHR+EVNP++V L E+ GM FVG D ++ RMEI+ELS HPYFV  QYHPEYLSRP +PSPP+ GLILA+ ++L++ ++       R  +D+  +DEED +
Sbjct:    1 MKYILVTGGVISGVGKGVIASSFGTLLKSCGLDVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGAEVDLDLGNYERFLDVTLHRDNNITTGKIYKLVIEKERTGEYLGKTVQVVPHITDAIQEWVERVAQTPV-QGSSKPQVCIVELGGTIGDIEGMPFVEAFRQFQFRVKRENFCLAHVSLVPLPKATGEPKTKPTQSSVRELRGCGLSPDLIVCRSEKPIGLEVKEKISNFCHVGPDQVICIHDLNSIYHVPLLMEQNGVIEYLNERLQLNIDMSKRTKCLQQWRDLARRTETVRREVCIAVVGKYTKFTDSYASVVKALQHAALAVNRKLELVFIESCLLEEETLHSEPSKYHKEWQKLCDSHGILVPGGFGSRGMEGKIRACQWARENQKPLLGICLGLQAAVIEFARNKLGLKDANTTEIDPNTANALVIDMPEHHTGQLGGTMRLGKRITVF----------SDGP--SVIRQLYGNPKSVQERHRHRYEVNPKYVHLLEEQGMRFVGTDVDKTRMEIIELSGHPYFVATQYHPEYLSRPLKPSPPFLGLILASVDRLNQYIQRGCRLSPRQLSDAS-SDEEDSV 577          
BLAST of CTP synthase vs. Ensembl Fly
Match: CTPsyn (gene:FBgn0266452 transcript:FBtr0344431)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 338/591 (57.19%), Postives = 434/591 (73.43%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPK-KDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENT--GKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKIS---GNRHRNDSFLTDEEDDL 1826
            MKYILVTGGVISG+GKG+I+SS GTLLKSCG  VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDG EVDLDLGNYERFLDVTL R+NNITTGKIY+ VI KER G+YLGKTVQVVPHIT+ IQ+W+ +VA+  + Q   +P++CI+E+GGTIGDIE  PF+EAFRQFQFRV   NFC  HVSL+P PK+T E K+KPTQ+SVRELRG G+SPD+++CRSE  I  E+K+K+S FCHV  +QVI + D+ ++Y VPL++    V E +  +L L    + + K L +W+ L  + +   REV I +VGKY    D+Y SV KAL HAAL  N KL +  + +  L E T   +  ++ + W+K+  + G+++PGGFG RG+EGK+ A ++ REN+ P+LG+CLG+Q  VIEFARN L   DA++TE D NT N +VI+MPE +  Q GGTMRLGKR T F            GP  SVI  LY N KS+QERHRHR+EVNP++V L E+ GM FVG D ++ RMEI+ELS HPYFV  QYHPEYLSRP +PSPP+ GLILA+ ++L++ ++       R  +D+  +DEED +
Sbjct:    1 MKYILVTGGVISGVGKGVIASSFGTLLKSCGLDVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGAEVDLDLGNYERFLDVTLHRDNNITTGKIYKLVIEKERTGEYLGKTVQVVPHITDAIQEWVERVAQTPV-QGSSKPQVCIVELGGTIGDIEGMPFVEAFRQFQFRVKRENFCLAHVSLVPLPKATGEPKTKPTQSSVRELRGCGLSPDLIVCRSEKPIGLEVKEKISNFCHVGPDQVICIHDLNSIYHVPLLMEQNGVIEYLNERLQLNIDMSKRTKCLQQWRDLARRTETVRREVCIAVVGKYTKFTDSYASVVKALQHAALAVNRKLELVFIESCLLEEETLHSEPSKYHKEWQKLCDSHGILVPGGFGSRGMEGKIRACQWARENQKPLLGICLGLQAAVIEFARNKLGLKDANTTEIDPNTANALVIDMPEHHTGQLGGTMRLGKRITVF----------SDGP--SVIRQLYGNPKSVQERHRHRYEVNPKYVHLLEEQGMRFVGTDVDKTRMEIIELSGHPYFVATQYHPEYLSRPLKPSPPFLGLILASVDRLNQYIQRGCRLSPRQLSDAS-SDEEDSV 577          
BLAST of CTP synthase vs. Ensembl Fly
Match: CTPsyn (gene:FBgn0266452 transcript:FBtr0344432)

HSP 1 Score: 542.732 bits (1397), Expect = 0.000e+0
Identity = 276/519 (53.18%), Postives = 366/519 (70.52%), Query Frame = 3
Query:  288 NYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPK-KDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENT--GKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKIS---GNRHRNDSFLTDEEDDL 1826
            NYERFLDVTL R+NNITTGKIY+ VI KER G+YLGKTVQVVPHIT+ IQ+W+ +VA+  + Q   +P++CI+E+GGTIGDIE  PF+EAFRQFQFRV   NFC  HVSL+P PK+T E K+KPTQ+SVRELRG G+SPD+++CRSE  I  E+K+K+S FCHV  +QVI + D+ ++Y VPL++    V E +  +L L    + + K L +W+ L  + +   REV I +VGKY    D+Y SV KAL HAAL  N KL +  + +  L E T   +  ++ + W+K+  + G+++PGGFG RG+EGK+ A ++ REN+ P+LG+CLG+Q  VIEFARN L   DA++TE D NT N +VI+MPE +  Q GGTMRLGKR T F            GP  SVI  LY N KS+QERHRHR+EVNP++V L E+ GM FVG D ++ RMEI+ELS HPYFV  QYHPEYLSRP +PSPP+ GLILA+ ++L++ ++       R  +D+  +DEED +
Sbjct:   69 NYERFLDVTLHRDNNITTGKIYKLVIEKERTGEYLGKTVQVVPHITDAIQEWVERVAQTPV-QGSSKPQVCIVELGGTIGDIEGMPFVEAFRQFQFRVKRENFCLAHVSLVPLPKATGEPKTKPTQSSVRELRGCGLSPDLIVCRSEKPIGLEVKEKISNFCHVGPDQVICIHDLNSIYHVPLLMEQNGVIEYLNERLQLNIDMSKRTKCLQQWRDLARRTETVRREVCIAVVGKYTKFTDSYASVVKALQHAALAVNRKLELVFIESCLLEEETLHSEPSKYHKEWQKLCDSHGILVPGGFGSRGMEGKIRACQWARENQKPLLGICLGLQAAVIEFARNKLGLKDANTTEIDPNTANALVIDMPEHHTGQLGGTMRLGKRITVF----------SDGP--SVIRQLYGNPKSVQERHRHRYEVNPKYVHLLEEQGMRFVGTDVDKTRMEIIELSGHPYFVATQYHPEYLSRPLKPSPPFLGLILASVDRLNQYIQRGCRLSPRQLSDAS-SDEEDSV 573          
BLAST of CTP synthase vs. Ensembl Zebrafish
Match: ctps1b (CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-160])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 429/568 (75.53%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A++S+D    EPE+C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI + DV ++Y+VPL+L  Q +     R+L L     P++ L KWK + D+  + L + +I LVGKY  L D+Y SV KAL H+AL  N KL ++ +++ +L     ++  +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARNVL   DA+STEFD  TK+ VVIEMPE NP Q GGTMRLGKR T F ++             S++  LY + + + ERHRHRFEVNPE    FE  G  FVG+D   ERMEI+EL +H YFVGVQYHPE+ SRP +PSPPYFGL+LAA+ +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKVSVDDDGIEPEVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPNSTGEQKTKPTQNSVRELRGLGLSPDLIVCRCSTPLDTAVKEKISMFCHVEPEQVICIHDVSSIYRVPLLLEDQGMVHYFCRRLDLPIQMRPRQMLRKWKEMSDRSDRLLEQTSIALVGKYTKLSDSYASVIKALEHSALAINYKLEVKYIDSAYLEPAALQDEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNVLGWEDANSTEFDPETKHPVVIEMPEHNPGQMGGTMRLGKRRTLFKSTP------------SILRKLYGDAEYVDERHRHRFEVNPELKHHFEDRGFRFVGQDLEGERMEIIELEDHTYFVGVQYHPEFTSRPIKPSPPYFGLLLAASGKLQNYLQ 556          
BLAST of CTP synthase vs. Ensembl Zebrafish
Match: ctps1b (CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-160])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 345/579 (59.59%), Postives = 432/579 (74.61%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSF 1802
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A++S+D    EPE+C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI + DV ++Y+VPL+L  Q +     R+L L     P++ L KWK + D+  + L + +I LVGKY  L D+Y SV KAL H+AL  N KL ++ +++ +L     ++  +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARNVL   DA+STEFD  TK+ VVIEMPE NP Q GGTMRLGKR T F ++             S++  LY + + + ERHRHRFEVNPE    FE  G  FVG+D   ERMEI+EL +H YFVGVQYHPE+ SRP +PSPPYFGL+LAA+ +L   L+        D++
Sbjct:   22 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKVSVDDDGIEPEVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPNSTGEQKTKPTQNSVRELRGLGLSPDLIVCRCSTPLDTAVKEKISMFCHVEPEQVICIHDVSSIYRVPLLLEDQGMVHYFCRRLDLPIQMRPRQMLRKWKEMSDRSDRLLEQTSIALVGKYTKLSDSYASVIKALEHSALAINYKLEVKYIDSAYLEPAALQDEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNVLGWEDANSTEFDPETKHPVVIEMPEHNPGQMGGTMRLGKRRTLFKSTP------------SILRKLYGDAEYVDERHRHRFEVNPELKHHFEDRGFRFVGQDLEGERMEIIELEDHTYFVGVQYHPEFTSRPIKPSPPYFGLLLAASGKLQNYLQKGCRLSPRDAY 588          
BLAST of CTP synthase vs. Ensembl Zebrafish
Match: ctps1a (CTP synthase 1a [Source:NCBI gene;Acc:322089])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 340/568 (59.86%), Postives = 427/568 (75.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A+I +D    EP++C+IE+GGT+GDIES PF+EAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD++MCR    + N +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V     R+L L     P+K L KWK + D+  + L + +I LVGKY    D+Y SV KAL H+AL  + KL ++ V++  L  +  +   +++ EAW+K+ ++ G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARN+L   DA+STEFD  TK+ VVI+MPE NP Q GGTMRLGKR T F   +            S++  LY +V  ++ERHRHRFEVNPE    FE+ G  FVG+D   ERME++E+ +HPYFVGVQYHPE+ SRP +PSPPY GL+LAA  +L   L+
Sbjct:    5 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKIPVDDDDVEPQVCVIELGGTVGDIESMPFVEAFRQFQFKVKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLIMCRCSTPLDNSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEDQGVVGYFCRRLNLPIENRPRKMLAKWKEMSDRSDRLLEQCSIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYVDSADLEPSMLQEEPVKYHEAWQKLCSSDGILVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNMLDWTDANSTEFDPETKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKNKS------------SILRKLYGDVDYVEERHRHRFEVNPELKHHFEEKGFRFVGQDVEGERMEVIEMDDHPYFVGVQYHPEFTSRPIKPSPPYLGLLLAAAGRLQSYLQ 560          
BLAST of CTP synthase vs. Ensembl Zebrafish
Match: ctps1a (CTP synthase 1a [Source:NCBI gene;Acc:322089])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 340/568 (59.86%), Postives = 427/568 (75.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A+I +D    EP++C+IE+GGT+GDIES PF+EAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD++MCR    + N +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V     R+L L     P+K L KWK + D+  + L + +I LVGKY    D+Y SV KAL H+AL  + KL ++ V++  L  +  +   +++ EAW+K+ ++ G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARN+L   DA+STEFD  TK+ VVI+MPE NP Q GGTMRLGKR T F   +            S++  LY +V  ++ERHRHRFEVNPE    FE+ G  FVG+D   ERME++E+ +HPYFVGVQYHPE+ SRP +PSPPY GL+LAA  +L   L+
Sbjct:    5 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKIPVDDDDVEPQVCVIELGGTVGDIESMPFVEAFRQFQFKVKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLIMCRCSTPLDNSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEDQGVVGYFCRRLNLPIENRPRKMLAKWKEMSDRSDRLLEQCSIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYVDSADLEPSMLQEEPVKYHEAWQKLCSSDGILVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNMLDWTDANSTEFDPETKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKNKS------------SILRKLYGDVDYVEERHRHRFEVNPELKHHFEEKGFRFVGQDVEGERMEVIEMDDHPYFVGVQYHPEFTSRPIKPSPPYLGLLLAAAGRLQSYLQ 560          
BLAST of CTP synthase vs. Ensembl Zebrafish
Match: ctps1b (CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-160])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 321/568 (56.51%), Postives = 403/568 (70.95%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A++S+D    EPE+C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IH                    S  +   L I    ++CR    +   +K+K+SMFCHV+  QVI + DV ++Y+VPL+L  Q +     R+L L     P++ L KWK + D+  + L + +I LVGKY  L D+Y SV KAL H+AL  N KL ++ +++ +L     ++  +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARNVL   DA+STEFD  TK+ VVIEMPE NP Q GGTMRLGKR T F ++             S++  LY + + + ERHRHRFEVNPE    FE  G  FVG+D   ERMEI+EL +H YFVGVQYHPE+ SRP +PSPPYFGL+LAA+ +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKVSVDDDGIEPEVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIH--------------------SFVDSACLLIWS--IVCRCSTPLDTAVKEKISMFCHVEPEQVICIHDVSSIYRVPLLLEDQGMVHYFCRRLDLPIQMRPRQMLRKWKEMSDRSDRLLEQTSIALVGKYTKLSDSYASVIKALEHSALAINYKLEVKYIDSAYLEPAALQDEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNVLGWEDANSTEFDPETKHPVVIEMPEHNPGQMGGTMRLGKRRTLFKSTP------------SILRKLYGDAEYVDERHRHRFEVNPELKHHFEDRGFRFVGQDLEGERMEIIELEDHTYFVGVQYHPEFTSRPIKPSPPYFGLLLAASGKLQNYLQ 534          
BLAST of CTP synthase vs. Ensembl Xenopus
Match: ctps2 (CTP synthase 2 [Source:NCBI gene;Acc:100145472])

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 335/564 (59.40%), Postives = 430/564 (76.24%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKYILVTGGVISG+GKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ+VI +ER GDYLGKTVQVVPHIT+ IQ+W+   A++ +D  QKEP+IC+IE+GGTIGDIE  PFIEAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K K+SMFCHV+  QVI V DV + Y+VP++L  Q + +   ++L +     P   L+KWKR+ D+ ++ L+  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      +++ +AW+++  A G+++PGGFG+RG EGK+ AI + RE K+P LG+CLGMQ  V+EFARN+LK  DA+STEFD NT N VVI+MPE +P   GGTMRLG+R+T F TS+            SVI  LY+N + ++ERHRHR+EVNPE V  FE+ G+ FVG+D   +RMEI+EL  HPYFVGVQ+HPE+ SRP +PSPPY G +LAA+ +L+
Sbjct:    7 MKYILVTGGVISGVGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQQVINRERRGDYLGKTVQVVPHITDAIQEWVLNQAKVPVDSDQKEPQICVIELGGTIGDIEGMPFIEAFRQFQFKAKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSAKPIEMAVKQKISMFCHVEPEQVIFVHDVSSTYRVPILLQEQGIIKYFKQRLSIPIDDQPSTLLFKWKRMADRYERLLKTCSIALVGKYTKLSDCYTSVFKALEHSALAINHKLNLMYIDSADLEPSMKAEDPVKYHKAWEELCKAEGILVPGGFGLRGTEGKIQAITWARERKIPFLGICLGMQLAVVEFARNILKMTDANSTEFDPNTNNPVVIDMPEHHPGDMGGTMRLGRRKTVFKTSD------------SVIKKLYDNYEFVEERHRHRYEVNPELVHQFEEKGLKFVGQDNEGQRMEIIELEGHPYFVGVQFHPEFCSRPMKPSPPYLGFMLAASGKLN 558          
BLAST of CTP synthase vs. Ensembl Xenopus
Match: ctps2 (CTP synthase 2 [Source:NCBI gene;Acc:100145472])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 335/564 (59.40%), Postives = 430/564 (76.24%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKYILVTGGVISG+GKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ+VI +ER GDYLGKTVQVVPHIT+ IQ+W+   A++ +D  QKEP+IC+IE+GGTIGDIE  PFIEAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K K+SMFCHV+  QVI V DV + Y+VP++L  Q + +   ++L +     P   L+KWKR+ D+ ++ L+  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      +++ +AW+++  A G+++PGGFG+RG EGK+ AI + RE K+P LG+CLGMQ  V+EFARN+LK  DA+STEFD NT N VVI+MPE +P   GGTMRLG+R+T F TS+            SVI  LY+N + ++ERHRHR+EVNPE V  FE+ G+ FVG+D   +RMEI+EL  HPYFVGVQ+HPE+ SRP +PSPPY G +LAA+ +L+
Sbjct:   19 MKYILVTGGVISGVGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQQVINRERRGDYLGKTVQVVPHITDAIQEWVLNQAKVPVDSDQKEPQICVIELGGTIGDIEGMPFIEAFRQFQFKAKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSAKPIEMAVKQKISMFCHVEPEQVIFVHDVSSTYRVPILLQEQGIIKYFKQRLSIPIDDQPSTLLFKWKRMADRYERLLKTCSIALVGKYTKLSDCYTSVFKALEHSALAINHKLNLMYIDSADLEPSMKAEDPVKYHKAWEELCKAEGILVPGGFGLRGTEGKIQAITWARERKIPFLGICLGMQLAVVEFARNILKMTDANSTEFDPNTNNPVVIDMPEHHPGDMGGTMRLGRRKTVFKTSD------------SVIKKLYDNYEFVEERHRHRYEVNPELVHQFEEKGLKFVGQDNEGQRMEIIELEGHPYFVGVQFHPEFCSRPMKPSPPYLGFMLAASGKLN 570          
BLAST of CTP synthase vs. Ensembl Xenopus
Match: ctps2 (CTP synthase 2 [Source:NCBI gene;Acc:100145472])

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 335/564 (59.40%), Postives = 430/564 (76.24%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKYILVTGGVISG+GKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ+VI +ER GDYLGKTVQVVPHIT+ IQ+W+   A++ +D  QKEP+IC+IE+GGTIGDIE  PFIEAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K K+SMFCHV+  QVI V DV + Y+VP++L  Q + +   ++L +     P   L+KWKR+ D+ ++ L+  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      +++ +AW+++  A G+++PGGFG+RG EGK+ AI + RE K+P LG+CLGMQ  V+EFARN+LK  DA+STEFD NT N VVI+MPE +P   GGTMRLG+R+T F TS+            SVI  LY+N + ++ERHRHR+EVNPE V  FE+ G+ FVG+D   +RMEI+EL  HPYFVGVQ+HPE+ SRP +PSPPY G +LAA+ +L+
Sbjct:   21 MKYILVTGGVISGVGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQQVINRERRGDYLGKTVQVVPHITDAIQEWVLNQAKVPVDSDQKEPQICVIELGGTIGDIEGMPFIEAFRQFQFKAKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSAKPIEMAVKQKISMFCHVEPEQVIFVHDVSSTYRVPILLQEQGIIKYFKQRLSIPIDDQPSTLLFKWKRMADRYERLLKTCSIALVGKYTKLSDCYTSVFKALEHSALAINHKLNLMYIDSADLEPSMKAEDPVKYHKAWEELCKAEGILVPGGFGLRGTEGKIQAITWARERKIPFLGICLGMQLAVVEFARNILKMTDANSTEFDPNTNNPVVIDMPEHHPGDMGGTMRLGRRKTVFKTSD------------SVIKKLYDNYEFVEERHRHRYEVNPELVHQFEEKGLKFVGQDNEGQRMEIIELEGHPYFVGVQFHPEFCSRPMKPSPPYLGFMLAASGKLN 572          
BLAST of CTP synthase vs. Ensembl Xenopus
Match: ENSXETT00000000855.1 (CTP synthase 1 [Source:NCBI gene;Acc:100379698])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 333/569 (58.52%), Postives = 427/569 (75.04%), Query Frame = 3
Query:   69 SMKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            SMKYILVTGGVISGIGKG+I+SS+GT+LKS    VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EPE+C+IE+GGT+GDIES PF+EAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V E   ++L L     P++ L KWK + D+ ++ L   +I LVGKY    D+Y SV KAL H+AL  N +L ++ +++  L + T +   + + EAW+K+ ++ G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V+EFAR+VL   DA+STEF+  T + VVI+MPE NP Q GGTMRLGKR T FH  N            SV+  LY   + ++ERHRHR+EVNPE     E  G+ FVG+D   ERMEI+EL +HPYFVGVQYHPE+LSRP +PSPPYFGL+LA+  +L + ++
Sbjct:   25 SMKYILVTGGVISGIGKGVIASSIGTILKSSNLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGIEPEVCVIELGGTVGDIESMPFVEAFRQFQFKARRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLVVCRCSTPLDTSVKEKISMFCHVEPQQVICVHDVSSIYRVPLLLEEQGVVEYFRQRLDLPISRQPRRLLMKWKEMADRYERLLESCSIALVGKYTKFSDSYASVIKALEHSALAINHRLEIKYIDSADLEQETLQEEPVRYHEAWQKLCSSDGILVPGGFGVRGTEGKIQAIAWARKQKKPFLGVCLGMQLAVVEFARDVLGWKDANSTEFNPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTIFHYQN------------SVMKKLYGGHEYVEERHRHRYEVNPELRRELETRGLKFVGQDTEGERMEIVELEDHPYFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSQYIE 581          
BLAST of CTP synthase vs. Ensembl Xenopus
Match: ENSXETT00000000636.1 (CTP synthase 1 [Source:NCBI gene;Acc:100379698])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 338/598 (56.52%), Postives = 436/598 (72.91%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDDLSLSPYKPINEV 1859
            MKYILVTGGVISGIGKG+I+SS+GT+LKS    VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EPE+C+IE+GGT+GDIES PF+EAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V E   ++L L     P++ L KWK + D+ ++ L   +I LVGKY    D+Y SV KAL H+AL  N +L ++ +++  L + T +   + + EAW+K+ ++ G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V+EFAR+VL   DA+STEF+  T + VVI+MPE NP Q GGTMRLGKR T FH  N            SV+  LY   + ++ERHRHR+EVNPE     E  G+ FVG+D   ERMEI+EL +HPYFVGVQYHPE+LSRP +PSPPYFGL+LA+  +L + ++        D++    E+    SP   I E+
Sbjct:    1 MKYILVTGGVISGIGKGVIASSIGTILKSSNLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGIEPEVCVIELGGTVGDIESMPFVEAFRQFQFKARRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLVVCRCSTPLDTSVKEKISMFCHVEPQQVICVHDVSSIYRVPLLLEEQGVVEYFRQRLDLPISRQPRRLLMKWKEMADRYERLLESCSIALVGKYTKFSDSYASVIKALEHSALAINHRLEIKYIDSADLEQETLQEEPVRYHEAWQKLCSSDGILVPGGFGVRGTEGKIQAIAWARKQKKPFLGVCLGMQLAVVEFARDVLGWKDANSTEFNPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTIFHYQN------------SVMKKLYGGHEYVEERHRHRYEVNPELRRELETRGLKFVGQDTEGERMEIVELEDHPYFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSQYIERGCRLSPRDTYSDRSENS---SPDAEIAEL 583          
BLAST of CTP synthase vs. Ensembl Mouse
Match: Ctps (cytidine 5'-triphosphate synthase [Source:MGI Symbol;Acc:MGI:1858304])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 343/568 (60.39%), Postives = 429/568 (75.53%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKG+I+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L      +K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  +T +   + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VVI+MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP   +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGVIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQSRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSTDLEPSTLQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARKQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDTDYLEERHRHRFEVNPVLKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLPHYLQ 556          
BLAST of CTP synthase vs. Ensembl Mouse
Match: Ctps2 (cytidine 5'-triphosphate synthase 2 [Source:MGI Symbol;Acc:MGI:1933185])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 333/586 (56.83%), Postives = 423/586 (72.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDD 1823
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+   A++S+D  +++P+IC+IE+GGTIGDIE   F+EAFRQFQF+    NF +IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV   QVI + DV ++Y+VPL+L  Q V +    +L L         L+KWK + D+ ++  +  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      ++F EAW+K+  A G+++PGGFGIRG  GK+ AI + R  K+P LG+CLGMQ  VIEFARN L   DA+STEF+ NT   +VI+MPE NP   GGTMRLG R T F T N            S++  LY +V  I+ERHRHR+EVNP  +  FE   + FVG D + +RMEI+EL+ HPYF+GVQ+HPE+ SRP +PSPPY GL+LAAT  L+  L+       +D + +D  DD
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAIQEWVMNQAKVSVDGNKEDPQICVIELGGTIGDIEGMAFVEAFRQFQFKAKKENFYNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSIYRVPLLLEEQGVVKYFQERLGLPINDCSSNLLFKWKAMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEPVTKAEDPVKFHEAWQKLCLADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGICLGMQLAVIEFARNCLNLKDANSTEFEPNTPVPLVIDMPEHNPGDLGGTMRLGLRRTVFTTEN------------SILKKLYGDVPYIEERHRHRYEVNPNLINQFENKDLCFVGEDVDGKRMEIVELTSHPYFIGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAHLQQMNKLPYSDGY-SDASDD 573          
BLAST of CTP synthase vs. Ensembl Mouse
Match: Ctps2 (cytidine 5'-triphosphate synthase 2 [Source:MGI Symbol;Acc:MGI:1933185])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 333/586 (56.83%), Postives = 423/586 (72.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDD 1823
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+   A++S+D  +++P+IC+IE+GGTIGDIE   F+EAFRQFQF+    NF +IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV   QVI + DV ++Y+VPL+L  Q V +    +L L         L+KWK + D+ ++  +  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      ++F EAW+K+  A G+++PGGFGIRG  GK+ AI + R  K+P LG+CLGMQ  VIEFARN L   DA+STEF+ NT   +VI+MPE NP   GGTMRLG R T F T N            S++  LY +V  I+ERHRHR+EVNP  +  FE   + FVG D + +RMEI+EL+ HPYF+GVQ+HPE+ SRP +PSPPY GL+LAAT  L+  L+       +D + +D  DD
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAIQEWVMNQAKVSVDGNKEDPQICVIELGGTIGDIEGMAFVEAFRQFQFKAKKENFYNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSIYRVPLLLEEQGVVKYFQERLGLPINDCSSNLLFKWKAMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEPVTKAEDPVKFHEAWQKLCLADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGICLGMQLAVIEFARNCLNLKDANSTEFEPNTPVPLVIDMPEHNPGDLGGTMRLGLRRTVFTTEN------------SILKKLYGDVPYIEERHRHRYEVNPNLINQFENKDLCFVGEDVDGKRMEIVELTSHPYFIGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAHLQQMNKLPYSDGY-SDASDD 573          
BLAST of CTP synthase vs. Ensembl Mouse
Match: Ctps2 (cytidine 5'-triphosphate synthase 2 [Source:MGI Symbol;Acc:MGI:1933185])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 333/586 (56.83%), Postives = 423/586 (72.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDD 1823
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+   A++S+D  +++P+IC+IE+GGTIGDIE   F+EAFRQFQF+    NF +IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV   QVI + DV ++Y+VPL+L  Q V +    +L L         L+KWK + D+ ++  +  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      ++F EAW+K+  A G+++PGGFGIRG  GK+ AI + R  K+P LG+CLGMQ  VIEFARN L   DA+STEF+ NT   +VI+MPE NP   GGTMRLG R T F T N            S++  LY +V  I+ERHRHR+EVNP  +  FE   + FVG D + +RMEI+EL+ HPYF+GVQ+HPE+ SRP +PSPPY GL+LAAT  L+  L+       +D + +D  DD
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAIQEWVMNQAKVSVDGNKEDPQICVIELGGTIGDIEGMAFVEAFRQFQFKAKKENFYNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSIYRVPLLLEEQGVVKYFQERLGLPINDCSSNLLFKWKAMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEPVTKAEDPVKFHEAWQKLCLADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGICLGMQLAVIEFARNCLNLKDANSTEFEPNTPVPLVIDMPEHNPGDLGGTMRLGLRRTVFTTEN------------SILKKLYGDVPYIEERHRHRYEVNPNLINQFENKDLCFVGEDVDGKRMEIVELTSHPYFIGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAHLQQMNKLPYSDGY-SDASDD 573          
BLAST of CTP synthase vs. Ensembl Mouse
Match: Ctps2 (cytidine 5'-triphosphate synthase 2 [Source:MGI Symbol;Acc:MGI:1933185])

HSP 1 Score: 505.368 bits (1300), Expect = 6.480e-173
Identity = 304/586 (51.88%), Postives = 386/586 (65.87%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDD 1823
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+   A++S+D  +++P+IC+IE+GGTIGDIE   F+EAFRQFQF+    NF +IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV   QVI + DV ++Y+VPL+L  Q V +    +L L         L+KWK + D+ ++  +  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      ++F EAW+K+  A G+++PGGFGIRG  GK+ AI + R  K+P LG+CLGMQ  VIEFARN L   DA+STEF+ NT   +VI+MPE NP   GGTMRLG R T F T N            S++ +                   P F+      G+ F                 HP         E+ SRP +PSPPY GL+LAAT  L+  L+       +D + +D  DD
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAIQEWVMNQAKVSVDGNKEDPQICVIELGGTIGDIEGMAFVEAFRQFQFKAKKENFYNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSIYRVPLLLEEQGVVKYFQERLGLPINDCSSNLLFKWKAMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEPVTKAEDPVKFHEAWQKLCLADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGICLGMQLAVIEFARNCLNLKDANSTEFEPNTPVPLVIDMPEHNPGDLGGTMRLGLRRTVFTTEN------------SILSH-------------------PYFI------GVQF-----------------HP---------EFSSRPMKPSPPYLGLLLAATGNLNAHLQQMNKLPYSDGY-SDASDD 522          
BLAST of CTP synthase vs. UniProt/SwissProt
Match: sp|P17812|PYRG1_HUMAN (CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 344/568 (60.56%), Postives = 430/568 (75.70%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L     P+K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  I +  + + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R  K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VV++MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP + +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQ 556          
BLAST of CTP synthase vs. UniProt/SwissProt
Match: sp|Q6GME1|PYRG2_XENLA (CTP synthase 2 OS=Xenopus laevis OX=8355 GN=ctps2 PE=2 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 334/564 (59.22%), Postives = 429/564 (76.06%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKYILVTGGVISG+GKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ+VI +ER GDYLGKTVQVVPHIT+ IQ+W+   A++ +D+ QKEP+IC+IE+GGTIGDIE  PFIEAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K K+SMFCHV+  QVI V DV + Y+VP++L  Q + +   ++L +     P   L+KWKR+ D+ ++ L+  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +      +++ +AW+++  A G+++PGGFG+RG EGK+ AI + RE K+P LG+CLGMQ  V+EFARN+LK  DA+STEFD NTKN  VI+MPE +P   GGTMRLG R+T F TS             SV+  LY+N   ++ERHRHR+EVNPE V+ FE+ G+ FVG+D   +RMEI+EL  HPYFVGVQ+HPE+ SRP +PSPPY G +LAA+ +L+
Sbjct:    1 MKYILVTGGVISGVGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQQVINRERRGDYLGKTVQVVPHITDAIQEWVLNQAKVPVDRDQKEPQICVIELGGTIGDIEGMPFIEAFRQFQFKAKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSAKPIEMAVKQKISMFCHVEPEQVIFVHDVSSTYRVPILLQEQGIIKYFKQRLSIPIEDQPSTQLFKWKRMADRYERLLKTCSIALVGKYTKLSDCYTSVFKALEHSALAINHKLNLMYIDSADLEPSMKAQDPVKYHKAWEELCKAEGILVPGGFGLRGTEGKIQAITWARERKIPFLGICLGMQLAVVEFARNILKMTDANSTEFDPNTKNPAVIDMPEHHPGDMGGTMRLGSRKTVFKTSE------------SVVKKLYDNQDFVEERHRHRYEVNPELVQQFEEKGLKFVGQDNEGQRMEIIELEGHPYFVGVQFHPEFCSRPMKPSPPYLGFMLAASGKLN 552          
BLAST of CTP synthase vs. UniProt/SwissProt
Match: sp|Q6PEI7|PYRG1_DANRE (CTP synthase 1 OS=Danio rerio OX=7955 GN=ctps1 PE=1 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 340/568 (59.86%), Postives = 427/568 (75.18%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A+I +D    EP++C+IE+GGT+GDIES PF+EAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD++MCR    + N +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V     R+L L     P+K L KWK + D+  + L + +I LVGKY    D+Y SV KAL H+AL  + KL ++ V++  L  +  +   +++ EAW+K+ ++ G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARN+L   DA+STEFD  TK+ VVI+MPE NP Q GGTMRLGKR T F   +            S++  LY +V  ++ERHRHRFEVNPE    FE+ G  FVG+D   ERME++E+ +HPYFVGVQYHPE+ SRP +PSPPY GL+LAA  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQAKIPVDDDDVEPQVCVIELGGTVGDIESMPFVEAFRQFQFKVKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLIMCRCSTPLDNSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEDQGVVGYFCRRLNLPIENRPRKMLAKWKEMSDRSDRLLEQCSIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYVDSADLEPSMLQEEPVKYHEAWQKLCSSDGILVPGGFGVRGTEGKIQAINWARKQKKPFLGVCLGMQLAVCEFARNMLDWTDANSTEFDPETKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKNKS------------SILRKLYGDVDYVEERHRHRFEVNPELKHHFEEKGFRFVGQDVEGERMEVIEMDDHPYFVGVQYHPEFTSRPIKPSPPYLGLLLAAAGRLQSYLQ 556          
BLAST of CTP synthase vs. UniProt/SwissProt
Match: sp|P70698|PYRG1_MOUSE (CTP synthase 1 OS=Mus musculus OX=10090 GN=Ctps1 PE=1 SV=2)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 343/568 (60.39%), Postives = 429/568 (75.53%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKG+I+SSVGT+LKSCG  VT+IKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D+   EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P ST EQK+KPTQ SVRELRGLG+SPD+++CR  N +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +  LR+L L      +K L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L  +T +   + + EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V+EF+RNVL   DA+STEFD  T + VVI+MPE NP Q GGTMRLGKR T F T N            SV+  LY +   ++ERHRHRFEVNP   +  E+ G+ FVG+D   ERMEI+EL +HP+FVGVQYHPE+LSRP +PSPPYFGL+LA+  +L   L+
Sbjct:    1 MKYILVTGGVISGIGKGVIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQSRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSTDLEPSTLQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARKQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPKTSHPVVIDMPEHNPGQMGGTMRLGKRRTLFQTKN------------SVMRKLYGDTDYLEERHRHRFEVNPVLKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLPHYLQ 556          
BLAST of CTP synthase vs. UniProt/SwissProt
Match: sp|Q5F3Z1|PYRG2_CHICK (CTP synthase 2 OS=Gallus gallus OX=9031 GN=CTPS2 PE=2 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 334/568 (58.80%), Postives = 423/568 (74.47%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENT--GKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SS+GT+LKSCG RVTAIKIDPY+NIDAGTFSPYEHGEVFVL+DGGEVDLDLGNYERFLD+ L ++NNITTGKIYQ VI KER+GDYLGKTVQVVPHIT+ +Q+W+   A++ +D  +KEP+IC+IE+GGTIGDIE  PF+EAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVR LRGLG+SPD+++CRS   I   +K+K+SMFCHV+  QVI + DV + Y+VP++L  Q + +   ++L L     P   L KWK++ D+ ++ L+  +I LVGKY  L D Y SV+KAL H+AL  N KL +  +++  L  +T    ++++ +AW K+  A G+++PGGFGIRG EGK+ AI + R  K P LGVCLGMQ  V+EFARN L   DA+STEFD +TK+ VVI+MPE NP   GGTMRLGKR T F T N            S++  LY +   ++ERHRHR+EVNPE    FE+ G+ FVG D    RME++EL  HPYFVGVQ+HPE+ SRP +PSPPY GL+LAAT  L+  L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERHGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDDDRKEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQPNATGEQKTKPTQNSVRALRGLGLSPDLIVCRSAKPIEMAVKEKISMFCHVEPEQVIFIHDVSSTYRVPILLEEQGIIKYFKQRLNLPIDDQPSDLLMKWKKMADRYERLLKVCSIALVGKYTKLSDCYASVFKALEHSALAINHKLDLMYIDSTELERSTEVENSVKYHQAWHKLCKADGILVPGGFGIRGTEGKLQAISWARTKKKPFLGVCLGMQLAVVEFARNCLNWKDANSTEFDPDTKSPVVIDMPEHNPGDMGGTMRLGKRRTVFKTQN------------SILRKLYGDEMFVEERHRHRYEVNPELTHCFEEKGLKFVGHDTEGNRMEMIELENHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGTLNAYLQ 556          
BLAST of CTP synthase vs. TrEMBL
Match: L7M2D6 (CTP synthase OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 358/591 (60.58%), Postives = 452/591 (76.48%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKL-LLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN---IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH----KKLKISGNRHRNDSFLTDEED 1820
            MKYILVTGGVISGIGKG+I+SSVGT+LKSCG +VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDGGEVDLDLGNYERFLD+TL R+NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ KVA I ++ + + PE+CIIE+GGTIGDIE  PF+EAFRQFQFRV   NFC +HVSL+P PKST E K+KPTQASVRELRGLG+SPD+++CRSEN I+  +KDK+S FCHV+  QV+ + DVP++Y VP+ +  Q + E+   +L L      P++ +YKW+ L  + ++  REVTI LVGKY+ L DAY SV KAL HAAL  N +L++  ++AE L E T K    ++F  AW+ +  A G+I+PGGFG RG++GK+AAI++ R+NK P LGVCLG+QC VIEF+RNVL   DA+S E D NT + V+IEMPE N  Q GGTMRLGKRET F+T +            S++  LY N + I+ERHRHR+EVNP FV   EK G+ FVG+D + +RME++ELS+HPYFVGVQ+HPEY+SRP +PSPPY GLILA+  +L+    +  ++S  R  +D   + EED
Sbjct:    1 MKYILVTGGVISGIGKGVIASSVGTILKSCGLQVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGGEVDLDLGNYERFLDITLHRDNNITTGKIYQHVINKERKGDYLGKTVQVVPHITDAIQEWVQKVALIPVNDSNQTPEVCIIELGGTIGDIEGMPFVEAFRQFQFRVKRENFCCVHVSLVPQPKSTGEHKTKPTQASVRELRGLGLSPDLIVCRSENEITKAVKDKISNFCHVEPRQVLCMHDVPSIYHVPIFMEEQGIVELFAERLHLQVPTPRPRRLMYKWRDLALKTERLRREVTIALVGKYIKLQDAYSSVIKALQHAALACNRRLMIMYIDAEEL-EPTMKAEHPVKFHAAWQNLCLADGIIVPGGFGSRGVDGKIAAIEWARKNKKPFLGVCLGLQCAVIEFSRNVLGWQDANSAEIDPNTSHPVIIEMPEHNVGQMGGTMRLGKRETIFNTED------------SLLRKLYQNAEKIEERHRHRYEVNPSFVPDLEKAGLKFVGKDTSGKRMEVIELSDHPYFVGVQFHPEYISRPLKPSPPYMGLILASCGRLNGFLLRGCRMS-PRQLSDVGSSSEED 577          
BLAST of CTP synthase vs. TrEMBL
Match: L7M2D1 (CTP synthase OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 358/591 (60.58%), Postives = 452/591 (76.48%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKL-LLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN---IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH----KKLKISGNRHRNDSFLTDEED 1820
            MKYILVTGGVISGIGKG+I+SSVGT+LKSCG +VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDGGEVDLDLGNYERFLD+TL R+NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ KVA I ++ + + PE+CIIE+GGTIGDIE  PF+EAFRQFQFRV   NFC +HVSL+P PKST E K+KPTQASVRELRGLG+SPD+++CRSEN I+  +KDK+S FCHV+  QV+ + DVP++Y VP+ +  Q + E+   +L L      P++ +YKW+ L  + ++  REVTI LVGKY+ L DAY SV KAL HAAL  N +L++  ++AE L E T K    ++F  AW+ +  A G+I+PGGFG RG++GK+AAI++ R+NK P LGVCLG+QC VIEF+RNVL   DA+S E D NT + V+IEMPE N  Q GGTMRLGKRET F+T +            S++  LY N + I+ERHRHR+EVNP FV   EK G+ FVG+D + +RME++ELS+HPYFVGVQ+HPEY+SRP +PSPPY GLILA+  +L+    +  ++S  R  +D   + EED
Sbjct:    1 MKYILVTGGVISGIGKGVIASSVGTILKSCGLQVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGGEVDLDLGNYERFLDITLHRDNNITTGKIYQHVINKERKGDYLGKTVQVVPHITDAIQEWVQKVALIPVNDSNQTPEVCIIELGGTIGDIEGMPFVEAFRQFQFRVKRENFCCVHVSLVPQPKSTGEHKTKPTQASVRELRGLGLSPDLIVCRSENEITKAVKDKISNFCHVEPRQVLCMHDVPSIYHVPIFMEEQGIVELFAERLHLQVPTPRPRRLMYKWRDLALKTERLRREVTIALVGKYIKLQDAYSSVIKALQHAALACNRRLMIMYIDAEEL-EPTMKAEHPVKFHAAWQNLCLADGIIVPGGFGSRGVDGKIAAIEWARKNKKPFLGVCLGLQCAVIEFSRNVLGWQDANSAEIDPNTSHPVIIEMPEHNVGQMGGTMRLGKRETIFNTED------------SLLRKLYQNAEKIEERHRHRYEVNPSFVPDLEKAGLKFVGKDTSGKRMEVIELSDHPYFVGVQFHPEYISRPLKPSPPYMGLILASCGRLNGFLLRGCRMS-PRQLSDVGSSSEED 577          
BLAST of CTP synthase vs. TrEMBL
Match: A0A131YKL1 (CTP synthase OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 350/567 (61.73%), Postives = 440/567 (77.60%), Query Frame = 3
Query:   69 SMKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKL-LLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN---IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            +MKYILVTGGVISGIGKG+I+SSVGT+LKSCG +VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDGGEVDLDLGNYERFLD+TL R+NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ KVA I ++ + + PE+CIIE+GGTIGDIE  PF+EAFRQFQFRV   NFC +HVSL+P PKST E K+KPTQASVRELRGLG+SPD+++CRSEN I+  +KDK+S FCHV+  QV+ + DVP++Y VP+ +  Q + E+   +L L      P++ +YKW+ L  + ++  REVTI LVGKY+ L DAY SV KAL HAAL  N +L++  ++AE L E T K    ++F  AW+ +  A G+I+PGGFG RG+EGK+AAI++ R+NK P LGVCLG+QC VIEF+RNVL   DA+S E D  T + V+IEMPE N  Q GGTMRLGKRET F+T +            S++  LY N + I+ERHRHR+EVNP  V   EK G+ FVG+D + +RME++ELS+HPYFVGVQ+HPEY+SRP +PSPPY GL+LA+  +L+
Sbjct:   33 AMKYILVTGGVISGIGKGVIASSVGTILKSCGLQVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGGEVDLDLGNYERFLDITLHRDNNITTGKIYQHVINKERKGDYLGKTVQVVPHITDAIQEWVQKVALIPVNDSNQTPEVCIIELGGTIGDIEGMPFVEAFRQFQFRVKRENFCCVHVSLVPQPKSTGEHKTKPTQASVRELRGLGLSPDLIVCRSENEITKAVKDKISNFCHVEPRQVLCMHDVPSIYHVPIFMEEQGIVELFAERLHLQVPTPRPRRLMYKWRDLALKTERLRREVTIALVGKYIKLQDAYSSVIKALQHAALACNHRLMIMYIDAEEL-EPTMKAEHPVKFHAAWQNLCVADGIIVPGGFGSRGVEGKIAAIEWARKNKKPFLGVCLGLQCAVIEFSRNVLGWQDANSAEIDSKTSHPVIIEMPEHNVGQMGGTMRLGKRETIFNTED------------SLLRKLYQNAEKIEERHRHRYEVNPSHVPELEKAGLKFVGKDTSGKRMEVIELSDHPYFVGVQFHPEYISRPLKPSPPYMGLVLASCGRLN 586          
BLAST of CTP synthase vs. TrEMBL
Match: A0A224YKE1 (CTP synthase (Fragment) OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 347/566 (61.31%), Postives = 438/566 (77.39%), Query Frame = 3
Query:   69 SMKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKL-LLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL--IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            +MKYILVTGGVISGIGKG+I+SSVGT+LKSCG +VT+IKIDPY+NIDAGTFSPYEHGEV+VLDDGGEVDLDLGNYERFLD+TL R+NNITTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ KVA I ++ + + PE+CIIE+GGTIGDIE  PF+EAFRQFQFRV   NFC +HVSL+P PKST E K+KPTQASVRELRGLG+SPD+++CRSEN I+  +KDK+S FCHV+  QV+ + DVP++Y VP+ +  Q + E+   +L L      P++ +YKW+ L  + ++  REVTI LVGKY+ L DAY SV KAL HAAL  N +L++  ++AE L         ++F  AW+ +  A G+I+PGGFG RG+EGK+AAI++ R+NK P LGVCLG+QC VIEF+RNVL   DA+S E D  T + V+IEMPE N  Q GGTMRLGKRET F+T +            S++  LY N + I+ERHRHR+EVNP +V   EK G+ FVG+D + +RME++ELS+HPYFVGVQ+HPEY+SRP +PSPPY GL+LA+  +L+
Sbjct:   33 AMKYILVTGGVISGIGKGVIASSVGTILKSCGLQVTSIKIDPYINIDAGTFSPYEHGEVYVLDDGGEVDLDLGNYERFLDITLHRDNNITTGKIYQHVINKERKGDYLGKTVQVVPHITDAIQEWVQKVALIPVNDSNQTPEVCIIELGGTIGDIEGMPFVEAFRQFQFRVKRENFCCVHVSLVPQPKSTGEHKTKPTQASVRELRGLGLSPDLIVCRSENEITKAVKDKISNFCHVEPRQVLCMHDVPSIYHVPIFMEEQGIVELFAERLHLQVPTPRPRRLMYKWRDLALKTERLRREVTIALVGKYIKLQDAYSSVIKALQHAALACNHRLMIMYIDAEELEPAMKAEHPVKFHAAWQNLCVADGIIVPGGFGSRGVEGKIAAIEWARKNKKPFLGVCLGLQCAVIEFSRNVLGWQDANSAEIDSKTSHPVIIEMPEHNVGQMGGTMRLGKRETIFNTED------------SLLRKLYQNAEKIEERHRHRYEVNPSYVPELEKAGLKFVGKDTSGKRMEVIELSDHPYFVGVQFHPEYISRPLKPSPPYMGLVLASCGRLN 586          
BLAST of CTP synthase vs. TrEMBL
Match: A0A4W4FU89 (CTP synthase OS=Electrophorus electricus OX=8005 GN=LOC113577245 PE=3 SV=1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 351/568 (61.80%), Postives = 428/568 (75.35%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQDW+ K A++ +D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+    NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLGISPD++MCR    + N +K+K+SMFCHVQ  QVI V DV ++Y+VPL+L  Q V     R+L L     P+K L KWK + D+  + L   TI LVGKY    D+Y SV KAL H+AL  + KL ++ +++  L   T +   +++ EAW+K+ +A G+++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARNVL   DA+STEFD  +K+ VVI+MPE NP Q GGTMRLGKR T F T +            S++  LY +   + ERHRHRFEVNPE  + FE+ G HFVG+D   ERMEI+EL +HPYFVGVQYHPE+ SRP +PSPPYFGL+LAA  +LH  L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQDWVMKQAKVPVDDDGMEPQVCVIELGGTVGDIESMPFIEAFRQFQFKAKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGISPDLIMCRCSTPLDNSVKEKISMFCHVQPEQVICVHDVSSIYRVPLLLEDQGVVNYFCRRLDLPIESRPRKMLTKWKEMSDRSDRLLEHCTIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYIDSADLEPATLQEEPVKYHEAWQKLCSADGILVPGGFGVRGTEGKMHAISWARKQKKPFLGVCLGMQLAVCEFARNVLGWADANSTEFDPESKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKTKS------------SILRKLYGDADHVDERHRHRFEVNPELKQHFEEKGFHFVGQDMEGERMEIIELEDHPYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLHSYLQ 556          
BLAST of CTP synthase vs. Ensembl Cavefish
Match: ctps1b (CTP synthase 1 [Source:NCBI gene;Acc:103038977])

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 339/564 (60.11%), Postives = 428/564 (75.89%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A++S+D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI + DV ++Y+VPL+L  Q + +   R+L L     P++ L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L + T +   +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFARNVL   DA+STEFD  TK+ VVI+MPE NP Q GGTMRLGKR T F +            N S++  LY + + + ERHRHRFEVNPE    FE+ G+HFVG+D   +RME++EL ++ YFVGVQYHPE+ SRP +PSPPYFGL+LAA  +L 
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVITKERRGDYLGKTVQVVPHITDAIQEWVMRQAKVSVDDDGVEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSTTGEQKTKPTQNSVRELRGLGLSPDLIVCRCSTPLDTAVKEKISMFCHVEPEQVICIHDVSSIYRVPLLLEDQGMVDYFCRRLDLPIEMRPRRMLTKWKEMSDRSDRLLEHTSIALVGKYTKFSDSYASVIKALEHSALAINHKLEVKYIDSADLEQATQQEEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIQAISWARKQKKPFLGVCLGMQLAVCEFARNVLGWQDANSTEFDPETKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKS------------NTSILRKLYGDAEHVDERHRHRFEVNPELTHYFEEKGLHFVGQDVEGQRMEVIELEDYAYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLQ 552          
BLAST of CTP synthase vs. Ensembl Cavefish
Match: ctps1a (CTP synthase 1a [Source:NCBI gene;Acc:322089])

HSP 1 Score: 525.398 bits (1352), Expect = 3.353e-180
Identity = 310/576 (53.82%), Postives = 393/576 (68.23%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDI--------LMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENT--GKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LT++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ + A I +D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD+        +MCR    + N +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V +   R+L L     P+K L KWK + D+  + L + +I LVGKY    D+Y SV KAL H+AL  + KL ++ +++  L + T   + +++ EAW+K+ ++    +   +    +      +K      + +    + + C    F R                     VI+MPE NP Q GGTMRLGKR T F T            N S++  LY +V  + ERHRHRFEVNPE  + FE+ G HFVG+D   ERME++EL +HPYFVGVQYHPE+ SRP +PSPPYFGL+LAA  +LH  L+
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVMRQATIPVDDDGAEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSATGEQKTKPTQNSVRELRGLGLSPDLKCSYFFCKIMCRCSTPLDNSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEDQGVVKYFCRRLDLPIESRPRKMLTKWKEMSDR-YRLLEQCSIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYIDSADLEQTTLLDEPVKYHEAWQKLCSSESSTLLQRYFSPYLSSLTETVK--THKYLFVFLYLIRINC----FTR-------------------LQVIDMPEHNPGQMGGTMRLGKRRTIFKT------------NSSILRKLYGDVDHVDERHRHRFEVNPELKQHFEEKGFHFVGQDVEGERMEVIELDDHPYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLHTYLQ 538          
BLAST of CTP synthase vs. Ensembl Cavefish
Match: ctps1b (CTP synthase 1 [Source:NCBI gene;Acc:103038977])

HSP 1 Score: 472.241 bits (1214), Expect = 8.238e-161
Identity = 225/453 (49.67%), Postives = 307/453 (67.77%), Query Frame = 3
Query:  405 QVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
             VVPHIT+ IQ+W+ + A++S+D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSL+P P +T EQK+KPTQ SVRELRGLG+SPD+++CR    +   +K+K+SMFCHV+  QVI + DV ++Y+VPL+L  Q + +   R+L L     P++ L KWK + D+  + L   +I LVGKY    D+Y SV KAL H+AL  N KL ++ +++  L + T +   +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P L                     DA+STEFD  TK+ VVI+MPE NP Q GGTMRLGKR T F +            N S++  LY + + + ERHRHRFEVNPE    FE+ G+HFVG+D   +RME++EL ++ YFVGVQYHPE+ SRP +PSPPYFGL+LAA  +L 
Sbjct:   55 HVVPHITDAIQEWVMRQAKVSVDDDGVEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSTTGEQKTKPTQNSVRELRGLGLSPDLIVCRCSTPLDTAVKEKISMFCHVEPEQVICIHDVSSIYRVPLLLEDQGMVDYFCRRLDLPIEMRPRRMLTKWKEMSDRSDRLLEHTSIALVGKYTKFSDSYASVIKALEHSALAINHKLEVKYIDSADLEQATQQEEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIQAISWARKQKKPFL---------------------DANSTEFDPETKHPVVIDMPEHNPGQMGGTMRLGKRRTIFKS------------NTSILRKLYGDAEHVDERHRHRFEVNPELTHYFEEKGLHFVGQDVEGQRMEVIELEDYAYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLQ 474          

HSP 2 Score: 70.4774 bits (171), Expect = 2.436e-12
Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEH 236
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEH
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEH 55          
BLAST of CTP synthase vs. Ensembl Yeast
Match: URA7 (Major CTP synthase isozyme (see also URA8); catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis; capable of forming cytoplasmic filaments termed cytoophidium, especially during conditions of glucose depletion; URA7 has a paralog, URA8, that arose from the whole genome duplication [Source:SGD;Acc:S000000135])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 303/573 (52.88%), Postives = 393/573 (68.59%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKD-------LYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEF--DENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLH 1757
            MKY++V+GGVISGIGKG+++SS G L+K+ G +VT+IKIDPY+NIDAGT SP EHGE FVLDDGGE DLDLGNYER+L VTLT+++NITTGKIY  VI KER GDYLGKTVQ+VPH+TN IQDWI +VA+I +D T  EP++CIIE+GGT+GDIESAPF+EA RQFQF+VG  NF  IHVSL+P      EQK+KPTQA+++ LR LG+ PD++ CR    +     DK++MFCHV   QV++V DV + Y VPL+L  QK+ + +  +L L  I   +++       L KWK       +S+  V I LVGKY NL D+Y+SV KAL H+++    KL ++ V A  L     ++   +F EAW  V TA G++IPGGFG+RG EG V A ++ REN +P LGVCLG+Q   IEF R+VL + D+HS EF  D + KN+VV+ MPE +    GG+MRLG R TFF                S I  LY +V  + ERHRHR+E+NP+ V+  E NG+ FVG+D   +R EILEL  HPY++  QYHPEY S+   PS P+ GL+ A+   L 
Sbjct:    1 MKYVVVSGGVISGIGKGVLASSTGMLMKTLGLKVTSIKIDPYMNIDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLGVTLTKDHNITTGKIYSHVIAKERKGDYLGKTVQIVPHLTNAIQDWIERVAKIPVDDTGMEPDVCIIELGGTVGDIESAPFVEALRQFQFKVGKENFALIHVSLVPVIHG--EQKTKPTQAAIKGLRSLGLVPDMIACRCSETLDKPTIDKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQKMIDYLHARLKLDEISLTEEEKQRGLELLSKWKATTGNFDESMETVKIALVGKYTNLKDSYLSVIKALEHSSMKCRRKLDIKWVEATDLEPEAQESNKTKFHEAWNMVSTADGILIPGGFGVRGTEGMVLAARWARENHIPFLGVCLGLQIATIEFTRSVLGRKDSHSAEFYPDIDEKNHVVVFMPEIDKETMGGSMRLGLRPTFFQNET----------EWSQIKKLYGDVSEVHERHRHRYEINPKMVDELENNGLIFVGKDDTGKRCEILELKNHPYYIATQYHPEYTSKVLDPSKPFLGLVAASAGILQ 561          
BLAST of CTP synthase vs. Ensembl Yeast
Match: URA8 (Minor CTP synthase isozyme (see also URA7); catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis; capable of forming cytoplasmic filaments termed cytoophidium, especially during conditions of glucose depletion; URA8 has a paralog, URA7, that arose from the whole genome duplication [Source:SGD;Acc:S000003864])

HSP 1 Score: 529.25 bits (1362), Expect = 0.000e+0
Identity = 298/580 (51.38%), Postives = 396/580 (68.28%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKD-------LYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHL---IENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENT----KNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLK 1769
            MKY++V+GGVISGIGKG+++SS G LLK+ G +VT+IKIDPY+NIDAGT SP EHGE FVLDDGGE DLDLGNYER+L +TL+R++NITTGKIY  VI +ER GDYLGKTVQ+VPH+TN IQDWI +V++I +D T  EP++CIIE+GGT+GDIESAPF+EA RQFQF VG  NF  IHVSL+P      EQK+KPTQA++++LR LG+ PD++ CR    ++    DK++MFCHV   QV++V DV + Y VPL+L  Q + + +  +L L  +    +D       L  W+ +      S   V I LVGKY NL D+Y+SV K+L HA++    +L +  V A +L    +   KN +F ++W K+ +A G+++PGGFG RGIEG + A K+ RE+ VP LGVCLG+Q   IEFARNV+ +P++ STEF + T    ++ VVI MPE +    GGTMRLG R T F  ++   N          I  LY  V  + ERHRHR+E+NP+ V   E  G  FVG+D+  +R EI EL  HPY+VG QYHPEY S+   PS P++GL+ AA+  L + +K
Sbjct:    1 MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMNIDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLGITLSRDHNITTGKIYSHVISRERRGDYLGKTVQIVPHLTNAIQDWIQRVSKIPVDDTGLEPDVCIIELGGTVGDIESAPFVEALRQFQFEVGRENFALIHVSLVPVIHG--EQKTKPTQAAIKDLRSLGLIPDMIACRCSEELNRSTIDKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLKQHMIDYLHSRLKLGEVPLTLEDKERGSQLLTNWENMTKNLDDSDDVVKIALVGKYTNLKDSYLSVTKSLEHASMKCRRQLEILWVEASNLEPETQEVDKN-KFHDSWNKLSSADGILVPGGFGTRGIEGMILAAKWARESGVPFLGVCLGLQVAAIEFARNVIGRPNSSSTEFLDETLLAPEDQVVIYMPEIDKEHMGGTMRLGLRPTIFQPNSEWSN----------IRKLYGEVNEVHERHRHRYEINPKIVNDMESRGFIFVGKDETGQRCEIFELKGHPYYVGTQYHPEYTSKVLEPSRPFWGLVAAASGTLGEVIK 567          
BLAST of CTP synthase vs. Ensembl Nematostella
Match: EDO46668 (CTP synthase [Source:UniProtKB/TrEMBL;Acc:A7RPD3])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 277/526 (52.66%), Postives = 371/526 (70.53%), Query Frame = 3
Query:  288 NYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKD--LYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDE--EDDLSL-SPYK 1844
            NYERFLDVTL R NNITTGKIYQEVI+KERNGDYLGKTVQVVPHIT+ IQDW+ KVA   + + ++  ++CI+E+GGTIGDIE  PF+EAFRQFQF VG  NFC +HVSLIP P +T EQK+KPTQ SVRELRGLG+SPD++MCR + +++ E+K K+S+FCHV  +QVI V D  ++Y+VPL+L  Q + +   ++L +  + +PK    +  WK L +++++ L EV I +VGKY  L+DAY+S+ KAL H+ L  N KL +  V+AE L + +  +  +++ +AW+++    G+++PGGFG RG EGK+AA ++ R    P LGVC GMQ  VIEFARNVL   DA++TE D +TK+ VVI+MPE NP Q GGTMRLG+R T F                S+   LY N + ++ERHRHR+EVNP+ +  FE+ GM FVG+D   ERMEI+EL +HPYF+GVQ+HPEY+SRP +PSPP+ GL+LAA  +L   +          S   DE  ED+++L SP K
Sbjct:   44 NYERFLDVTLHRNNNITTGKIYQEVIQKERNGDYLGKTVQVVPHITDAIQDWVRKVAEDPV-EGKRVADVCIVELGGTIGDIEGMPFVEAFRQFQFNVGRENFCVVHVSLIPTPSATGEQKTKPTQNSVRELRGLGLSPDLIMCRCKYSVTEEVKKKISLFCHVSPDQVIDVHDCKSIYRVPLLLSQQGLVKFFAQRLNMMEMRSPKPRHFMVHWKELAEREERVLEEVKIGIVGKYTKLEDAYLSLLKALKHSTLHCNKKLNVVWVDAESLEKESQHSDPVKYHDAWQRLCGVDGILVPGGFGARGTEGKIAAAEWARTKNKPYLGVCYGMQLAVIEFARNVLGWKDANTTEVDPDTKHPVVIDMPEHNPGQMGGTMRLGRRRTVFSKDQT-----------SIARKLYKNAEFVEERHRHRYEVNPDLISAFEEKGMKFVGKDVEGERMEIMELEDHPYFIGVQFHPEYISRPLKPSPPFLGLVLAAIGRLQPYIARGCRLSPTCSISEDESDEDEIALESPNK 557          
BLAST of CTP synthase vs. Ensembl Nematostella
Match: EDO28530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T678])

HSP 1 Score: 221.861 bits (564), Expect = 4.719e-69
Identity = 103/142 (72.54%), Postives = 121/142 (85.21%), Query Frame = 3
Query:  288 NYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDIL 713
            NYERFLDVTL R NNITTGKIYQEVI+KERNGDYLGKTVQVVPHIT+ IQDW+ KVA   + + ++  ++CI+E+GGTIGDIE  PF+EAFRQFQF VG  NFC +HVSLIP P +T EQK+KPTQ SVRELRGLG+SPD++
Sbjct:   18 NYERFLDVTLHRNNNITTGKIYQEVIQKERNGDYLGKTVQVVPHITDAIQDWVRKVAEDPV-EGKRVADVCIVELGGTIGDIEGMPFVEAFRQFQFNVGRENFCVVHVSLIPTPSATGEQKTKPTQNSVRELRGLGLSPDLV 158          
BLAST of CTP synthase vs. Ensembl Nematostella
Match: EDO25452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWF7])

HSP 1 Score: 83.5741 bits (205), Expect = 1.419e-19
Identity = 48/115 (41.74%), Postives = 64/115 (55.65%), Query Frame = 3
Query: 1398 GGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAA 1742
            GGTMRLG  +            CE   + S +  +Y     I ERHRHR+E N E+++ FEK GM  VGR+   + +E++EL  HPY+V VQ+HPEY S    P P +   I AA
Sbjct:    2 GGTMRLGAYD------------CELRAD-SKLAEIYGTTH-ISERHRHRYEFNNEYLDAFEKAGMIPVGRNPKTQLVEVMELKNHPYYVAVQFHPEYKSTVENPHPLFVAFIKAA 102          
BLAST of CTP synthase vs. Ensembl Medaka
Match: ctps1a (CTP synthase 1 [Source:NCBI gene;Acc:101156102])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 345/567 (60.85%), Postives = 429/567 (75.66%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKL 1766
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ LTR+NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQ+W+ K A++ +D  Q EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSLIP P +T EQK+KPTQ SVRELRGLG+SPD++MCR    +   +K+K+SMFCHV+  QVI V DV ++Y+VPL+L  Q V   + R+L +     P+K L KWK + D+  + L + +I LVGKY    D+Y SV KAL H+AL  + KL ++ +++  L   T ++  +++ EAW+K+ +A GV++PGGFG+RG EGK+ AI + R+ K P LGVCLGMQ  V EFAR+VL+  DA+STEFD  T++ VVI+MPE NP Q GGTMRLGKR T F + N            SV+  LY + + ++ERHRHRFEVNPE    FE+ G  FVG+D   ERME++EL +HPYFVGVQYHPE+ SRP  PSPPY GL+LAA  +L   L
Sbjct:    5 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTRDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQEWVVKQAKVPVDDDQVEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLIPQPSATGEQKTKPTQNSVRELRGLGLSPDLIMCRCSTVLETSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEDQGVVSFLSRRLNMPIEAKPRKMLTKWKEMSDRSDRLLEQCSIALVGKYTKFSDSYASVIKALEHSALAISHKLEVKYIDSACLEPATLQDEPVKYHEAWQKLCSADGVLVPGGFGVRGTEGKIHAISWARKQKKPFLGVCLGMQLAVCEFARSVLEWKDANSTEFDPETRHPVVIDMPEHNPGQMGGTMRLGKRRTIFKSGN------------SVLRKLYGDAEYVEERHRHRFEVNPELKSHFEEKGFRFVGQDIEGERMEVIELDDHPYFVGVQYHPEFTSRPINPSPPYLGLLLAAAGKLQSYL 559          
BLAST of CTP synthase vs. Ensembl Medaka
Match: ctps1b (CTP synthase 1 [Source:NCBI gene;Acc:101165095])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 346/567 (61.02%), Postives = 434/567 (76.54%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKL 1766
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLD+ L ++NN+TTGKIYQ VI KER GDYLGKTVQVVPHIT+ IQDW+ K A+IS+D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSLIP P +T E K+KPTQ SVRELRGLG+S D++MCR   A+   +K+K+SMFCHV+  QVI V+DV ++Y+VPL+L +Q V + + ++L L      +K L KWK + D+  + L +V+I LVGKY  L D+Y SV KAL H+AL  N KL ++ +++  L   T ++  +++ EAW+K+ ++ GV++PGGFG+RG EGK+ AI + R+   P LGVCLGMQ  V EFARNVL+  DA+STEF+  T++ VVI+MPE NP Q GGTMRLGKR T F +S+            SV+  LY +V+ ++ERHRHRFEVNPE    FE+ G+ FVG+D   ERMEI+EL +H YFVGVQYHPE+ SRP +PSPPYFGL+LAA  +L   L
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDICLIKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDAIQDWVMKQAKISVDDDGVEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLIPQPNTTGEHKTKPTQNSVRELRGLGLSADLIMCRCSAALDASVKEKISMFCHVEPTQVICVQDVSSVYKVPLLLEAQGVVDYLCQRLNLPVEMRARKMLTKWKEMADRSDRLLEQVSIALVGKYTKLSDSYTSVIKALEHSALAINHKLEVKYIDSADLESTTLQDEPVKYHEAWQKLCSSHGVLVPGGFGVRGTEGKIMAISWARKQNKPFLGVCLGMQLAVCEFARNVLEWKDANSTEFNPETEHPVVIDMPEHNPGQMGGTMRLGKRRTIFKSSS------------SVLRKLYGDVEYVEERHRHRFEVNPELKHHFERKGLQFVGQDIEGERMEIIELKDHCYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLQSYL 555          
BLAST of CTP synthase vs. Ensembl Medaka
Match: ctps1b (CTP synthase 1 [Source:NCBI gene;Acc:101165095])

HSP 1 Score: 474.937 bits (1221), Expect = 9.067e-162
Identity = 233/456 (51.10%), Postives = 313/456 (68.64%), Query Frame = 3
Query:  405 QVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKN--IEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKL 1766
             VVPHIT+ IQDW+ K A+IS+D    EP++C+IE+GGT+GDIES PFIEAFRQFQF+V   NFC+IHVSLIP P +T E K+KPTQ SVRELRGLG+S D++MCR   A+   +K+K+SMFCHV+  QVI V+DV ++Y+VPL+L +Q V + + ++L L      +K L KWK + D+  + L +V+I LVGKY  L D+Y SV KAL H+AL  N KL ++ +++  L   T ++  +++ EAW+K+ ++ GV++PGGFG+RG EGK+ AI + R+   P L                     DA+STEF+  T++ VVI+MPE NP Q GGTMRLGKR T F +S+            SV+  LY +V+ ++ERHRHRFEVNPE    FE+ G+ FVG+D   ERMEI+EL +H YFVGVQYHPE+ SRP +PSPPYFGL+LAA  +L   L
Sbjct:   55 HVVPHITDAIQDWVMKQAKISVDDDGVEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLIPQPNTTGEHKTKPTQNSVRELRGLGLSADLIMCRCSAALDASVKEKISMFCHVEPTQVICVQDVSSVYKVPLLLEAQGVVDYLCQRLNLPVEMRARKMLTKWKEMADRSDRLLEQVSIALVGKYTKLSDSYTSVIKALEHSALAINHKLEVKYIDSADLESTTLQDEPVKYHEAWQKLCSSHGVLVPGGFGVRGTEGKIMAISWARKQNKPFL---------------------DANSTEFNPETEHPVVIDMPEHNPGQMGGTMRLGKRRTIFKSSS------------SVLRKLYGDVEYVEERHRHRFEVNPELKHHFERKGLQFVGQDIEGERMEIIELKDHCYFVGVQYHPEFTSRPIKPSPPYFGLLLAAAGKLQSYL 477          

HSP 2 Score: 70.4774 bits (171), Expect = 2.123e-12
Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEH 236
            MKYILVTGGVISGIGKGII+SSVGT+LKSCG  VTAIKIDPY+NIDAGTFSPYEH
Sbjct:    1 MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTAIKIDPYINIDAGTFSPYEH 55          
BLAST of CTP synthase vs. Planmine SMEST
Match: SMESG000012989.1 (SMESG000012989.1)

HSP 1 Score: 1165.98 bits (3015), Expect = 0.000e+0
Identity = 602/602 (100.00%), Postives = 602/602 (100.00%), Query Frame = 3
Query:   72 MKYILVTXXXXXXXXXXXXXXXXXTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHXXXXXXXXXXXXXXXXXNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDDLSLSPYKPINEVIMQNGD 1877
            MKYILVTGGVISGIGKGIISSSVGTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDDLSLSPYKPINEVIMQNGD
Sbjct:    1 MKYILVTGGVISGIGKGIISSSVGTLLKSCGFRVTAIKIDPYLNIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDVTLTRENNITTGKIYQEVIRKERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGTIGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQASVRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTLYQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVTIVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKNIEFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGMQCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGKRETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVELFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPYFGLILAATNQLHKKLKISGNRHRNDSFLTDEEDDLSLSPYKPINEVIMQNGD 602          
The following BLAST results are available for this feature:
BLAST of CTP synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTPS10.000e+060.56CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519][more]
CTPS10.000e+060.56CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519][more]
CTPS10.000e+060.56CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519][more]
CTPS10.000e+060.56CTP synthase 1 [Source:HGNC Symbol;Acc:HGNC:2519][more]
CTPS20.000e+057.17CTP synthase 2 [Source:HGNC Symbol;Acc:HGNC:2520][more]
back to top
BLAST of CTP synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctps-12.231e-17148.83CTP synthase [Source:UniProtKB/TrEMBL;Acc:G5EC98][more]
back to top
BLAST of CTP synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CTPsyn0.000e+057.19gene:FBgn0266452 transcript:FBtr0345691[more]
CTPsyn0.000e+057.19gene:FBgn0266452 transcript:FBtr0344431[more]
CTPsyn0.000e+053.18gene:FBgn0266452 transcript:FBtr0344432[more]
back to top
BLAST of CTP synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctps1b0.000e+060.56CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
ctps1b0.000e+059.59CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
ctps1a0.000e+059.86CTP synthase 1a [Source:NCBI gene;Acc:322089][more]
ctps1a0.000e+059.86CTP synthase 1a [Source:NCBI gene;Acc:322089][more]
ctps1b0.000e+056.51CTP synthase 1b [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
back to top
BLAST of CTP synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctps20.000e+059.40CTP synthase 2 [Source:NCBI gene;Acc:100145472][more]
ctps20.000e+059.40CTP synthase 2 [Source:NCBI gene;Acc:100145472][more]
ctps20.000e+059.40CTP synthase 2 [Source:NCBI gene;Acc:100145472][more]
ENSXETT00000000855.10.000e+058.52CTP synthase 1 [Source:NCBI gene;Acc:100379698][more]
ENSXETT00000000636.10.000e+056.52CTP synthase 1 [Source:NCBI gene;Acc:100379698][more]
back to top
BLAST of CTP synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctps0.000e+060.39cytidine 5'-triphosphate synthase [Source:MGI Symb... [more]
Ctps20.000e+056.83cytidine 5'-triphosphate synthase 2 [Source:MGI Sy... [more]
Ctps20.000e+056.83cytidine 5'-triphosphate synthase 2 [Source:MGI Sy... [more]
Ctps20.000e+056.83cytidine 5'-triphosphate synthase 2 [Source:MGI Sy... [more]
Ctps26.480e-17351.88cytidine 5'-triphosphate synthase 2 [Source:MGI Sy... [more]
back to top
BLAST of CTP synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17812|PYRG1_HUMAN0.000e+060.56CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE... [more]
sp|Q6GME1|PYRG2_XENLA0.000e+059.22CTP synthase 2 OS=Xenopus laevis OX=8355 GN=ctps2 ... [more]
sp|Q6PEI7|PYRG1_DANRE0.000e+059.86CTP synthase 1 OS=Danio rerio OX=7955 GN=ctps1 PE=... [more]
sp|P70698|PYRG1_MOUSE0.000e+060.39CTP synthase 1 OS=Mus musculus OX=10090 GN=Ctps1 P... [more]
sp|Q5F3Z1|PYRG2_CHICK0.000e+058.80CTP synthase 2 OS=Gallus gallus OX=9031 GN=CTPS2 P... [more]
back to top
BLAST of CTP synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L7M2D60.000e+060.58CTP synthase OS=Rhipicephalus pulchellus OX=72859 ... [more]
L7M2D10.000e+060.58CTP synthase OS=Rhipicephalus pulchellus OX=72859 ... [more]
A0A131YKL10.000e+061.73CTP synthase OS=Rhipicephalus appendiculatus OX=34... [more]
A0A224YKE10.000e+061.31CTP synthase (Fragment) OS=Rhipicephalus zambezien... [more]
A0A4W4FU890.000e+061.80CTP synthase OS=Electrophorus electricus OX=8005 G... [more]
back to top
BLAST of CTP synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ctps1b0.000e+060.11CTP synthase 1 [Source:NCBI gene;Acc:103038977][more]
ctps1a3.353e-18053.82CTP synthase 1a [Source:NCBI gene;Acc:322089][more]
ctps1b8.238e-16149.67CTP synthase 1 [Source:NCBI gene;Acc:103038977][more]
back to top
BLAST of CTP synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CTP synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
URA70.000e+052.88Major CTP synthase isozyme (see also URA8); cataly... [more]
URA80.000e+051.38Minor CTP synthase isozyme (see also URA7); cataly... [more]
back to top
BLAST of CTP synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO466680.000e+052.66CTP synthase [Source:UniProtKB/TrEMBL;Acc:A7RPD3][more]
EDO285304.719e-6972.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254521.419e-1941.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of CTP synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ctps1a0.000e+060.85CTP synthase 1 [Source:NCBI gene;Acc:101156102][more]
ctps1b0.000e+061.02CTP synthase 1 [Source:NCBI gene;Acc:101165095][more]
ctps1b9.067e-16251.10CTP synthase 1 [Source:NCBI gene;Acc:101165095][more]
back to top
BLAST of CTP synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000012989.10.000e+0100.00SMESG000012989.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033929 ID=SMED30033929|Name=CTP synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=2026bp
CATAGAGATATTTTGTGTAATTTTTTATTAAAAACTTATTTACAATATTT
ATATTTACAATATTTATAAGTATGAAGTATATTTTAGTTACTGGAGGTGT
AATTAGTGGTATTGGTAAAGGCATAATTTCCAGTAGTGTCGGAACGTTAT
TAAAATCATGTGGATTTCGTGTAACAGCTATTAAAATTGATCCTTATTTA
AATATAGATGCTGGGACATTTTCTCCTTATGAACATGGCGAAGTATTTGT
ATTAGATGATGGTGGTGAAGTTGATTTAGACCTTGGTAATTATGAAAGGT
TTCTTGATGTTACTTTGACTAGGGAAAACAATATTACTACTGGAAAAATT
TATCAAGAAGTCATTAGAAAAGAACGAAATGGGGATTACCTCGGGAAAAC
TGTGCAAGTTGTTCCTCACATTACCAATGAAATTCAGGATTGGATAACAA
AAGTAGCTAGAATATCGATTGATCAAACTCAAAAAGAGCCTGAAATTTGT
ATTATTGAAATGGGTGGAACAATTGGTGATATTGAGTCCGCTCCTTTTAT
AGAAGCCTTTCGGCAGTTTCAGTTTCGCGTTGGAATTAACAACTTTTGTA
GTATTCATGTTAGTTTAATACCTTGTCCAAAATCGACTCATGAACAGAAA
TCCAAACCCACTCAAGCCAGTGTTCGTGAGTTACGTGGTTTGGGCATCAG
TCCTGATATTTTAATGTGCCGCTCGGAGAATGCAATATCCAATGAATTGA
AAGATAAGCTTAGCATGTTTTGTCATGTTCAAACTAATCAAGTAATAAGT
GTTGAGGATGTACCAACTCTCTATCAGGTTCCTCTGATTTTGTATTCACA
AAAGGTACATGAAATAATTCTCCGAAAATTGCTTTTAACTGCAATTTGTG
CTCCCAAAAAAGATCTTTATAAATGGAAACGCTTATGTGATCAAGATAAA
AAATCACTCAGAGAAGTTACCATTGTTCTTGTTGGAAAATACGTTAACCT
TGATGATGCATATATTTCGGTTTATAAAGCCTTAAATCACGCTGCTTTAT
TCAGTAATTCTAAACTTGTTATGGAACAAGTAAATGCGGAGCATTTAATA
GAAAATACGGGCAAAAATATAGAGTTTCTTGAGGCTTGGAAAAAAGTTAA
AACAGCAATGGGAGTGATTATTCCTGGTGGCTTTGGGATTCGTGGAATTG
AAGGTAAAGTAGCAGCAATAAAATTCTGTAGAGAGAATAAAGTACCGATG
CTCGGAGTTTGTCTTGGAATGCAATGTCAAGTAATTGAATTCGCTCGAAA
TGTCCTTAAAAAGCCAGATGCTCATTCTACGGAATTCGATGAAAACACAA
AAAACAATGTCGTTATCGAAATGCCGGAATTCAATCCATTACAGAAAGGA
GGAACGATGCGTCTTGGAAAACGGGAAACATTTTTCCATACAAGCAATGT
TTCTGTCAACGGTTGTGAAACCGGACCAAACATCAGTGTCATTCATTATC
TATACAACAATGTGAAATCGATTCAAGAAAGACATCGACATCGATTTGAA
GTAAATCCAGAATTCGTGGAATTATTCGAAAAAAATGGAATGCATTTCGT
CGGTAGAGATAAAAATGAAGAAAGAATGGAAATTCTAGAGTTGAGTGAGC
ATCCATATTTCGTCGGCGTGCAATATCACCCAGAATATCTGAGTCGCCCA
AATCGCCCGAGTCCACCGTATTTTGGTTTGATATTAGCAGCTACTAATCA
ACTTCATAAAAAATTGAAAATCAGTGGAAATCGCCACAGAAATGATTCAT
TTCTGACAGATGAAGAAGACGATCTTTCACTTTCCCCATACAAACCAATC
AATGAAGTTATTATGCAAAATGGAGATTAGATTAAGCGCTATCTAGAGAA
AAAATGTATATTTTTTATCTTTGTAATTCATTGTTGTGAATTGTCCATTG
TCATAAATTTGTTTCATTCATTTCGAGAAATTTTAATATTTTTTATTGAT
TATAAATCAATTTCTAAATTATGTAC
back to top

protein sequence of SMED30033929-orf-1

>SMED30033929-orf-1 ID=SMED30033929-orf-1|Name=SMED30033929-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=603bp
MKYILVTGGVISGIGKGIISSSVGTLLKSCGFRVTAIKIDPYLNIDAGTF
SPYEHGEVFVLDDGGEVDLDLGNYERFLDVTLTRENNITTGKIYQEVIRK
ERNGDYLGKTVQVVPHITNEIQDWITKVARISIDQTQKEPEICIIEMGGT
IGDIESAPFIEAFRQFQFRVGINNFCSIHVSLIPCPKSTHEQKSKPTQAS
VRELRGLGISPDILMCRSENAISNELKDKLSMFCHVQTNQVISVEDVPTL
YQVPLILYSQKVHEIILRKLLLTAICAPKKDLYKWKRLCDQDKKSLREVT
IVLVGKYVNLDDAYISVYKALNHAALFSNSKLVMEQVNAEHLIENTGKNI
EFLEAWKKVKTAMGVIIPGGFGIRGIEGKVAAIKFCRENKVPMLGVCLGM
QCQVIEFARNVLKKPDAHSTEFDENTKNNVVIEMPEFNPLQKGGTMRLGK
RETFFHTSNVSVNGCETGPNISVIHYLYNNVKSIQERHRHRFEVNPEFVE
LFEKNGMHFVGRDKNEERMEILELSEHPYFVGVQYHPEYLSRPNRPSPPY
FGLILAATNQLHKKLKISGNRHRNDSFLTDEEDDLSLSPYKPINEVIMQN
GD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016829lyase activity
GO:0003883CTP synthase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016874ligase activity
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004468CTP_synthase
IPR033828GATase1_CTP_Synthase
IPR027417P-loop_NTPase
IPR017926GATASE
IPR029062Class_I_gatase-like
IPR017456CTP_synthase_N
Vocabulary: biological process
TermDefinition
GO:0006221pyrimidine nucleotide biosynthetic process
GO:0002376immune system process
GO:0006139nucleobase-containing compound metabolic process
GO:0006241CTP biosynthetic process
GO:0006541glutamine metabolic process
GO:0015949nucleobase-containing small molecule interconversion
GO:0042098T cell proliferation
GO:0042100B cell proliferation
GO:0042493response to drug
GO:0044210'de novo' CTP biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004468CTP synthaseTIGRFAMTIGR00337TIGR00337coord: 1..555
e-value: 1.3E-224
score: 744.6
IPR004468CTP synthasePANTHERPTHR11550CTP SYNTHASEcoord: 1..570
IPR017456CTP synthase, N-terminalPFAMPF06418CTP_synth_Ncoord: 2..271
e-value: 1.2E-126
score: 421.5
IPR017926Glutamine amidotransferasePFAMPF00117GATasecoord: 310..554
e-value: 5.7E-47
score: 159.9
IPR017926Glutamine amidotransferasePROSITEPS51273GATASE_TYPE_1coord: 300..564
score: 16.95
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..293
e-value: 7.1E-144
score: 480.2
NoneNo IPR availableCDDcd03113CTPS_Ncoord: 2..268
e-value: 1.56263E-180
score: 508.563
IPR029062Class I glutamine amidotransferase-likeGENE3DG3DSA:3.40.50.880coord: 294..575
e-value: 5.9E-101
score: 339.2
IPR029062Class I glutamine amidotransferase-likeSUPERFAMILYSSF52317Class I glutamine amidotransferase-likecoord: 297..560
IPR033828CTP synthase GATase domainCDDcd01746GATase1_CTP_Synthasecoord: 299..554
e-value: 2.34282E-121
score: 356.478
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..272