Acyl-CoA synthetase short chain family member 3

Overview
NameAcyl-CoA synthetase short chain family member 3
Smed IDSMED30033927
Length (bp)2052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acyl-CoA synthetase short chain family member 3 (SMED30033927) t-SNE clustered cells

Violin plots show distribution of expression levels for Acyl-CoA synthetase short chain family member 3 (SMED30033927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30033927SMESG000043642.1 SMESG000043641.1 Contig6343_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 474.167 bits (1219), Expect = 2.131e-158
Identity = 235/630 (37.30%), Postives = 368/630 (58.41%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+T PE+ W + A+++ W KP+T  +++K  P  +WFV G +N+ YN +D+H+ +G GD +AIIY+  +TNT    TY+++L  V +LAGV+V K  I KGD V++Y P+  Q M  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   VE+A KI Q  P   L+YNRPN     +  G+D DW+ E+  A  H  VP+ S HP++I YTSGTTG PKG +  TG   V   + +  + GL+  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W  N+F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L    +G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   +RKD      +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +KI  T+++P ++  + ++L +A
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLG--NSKTPPPGQAGKSVPGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 465.307 bits (1196), Expect = 5.826e-155
Identity = 234/630 (37.14%), Postives = 367/630 (58.25%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+T PE+ W + A+++ W KP+T  +++K  P  + FV G +N+ YN +D+H+ +G GD +AIIY+  +TNT    TY+++L  V +LAGV+V K  I KGD V++Y P+  Q M  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   VE+A KI Q  P   L+YNRPN     +  G+D DW+ E+  A  H  VP+ S HP++I YTSGTTG PKG +  TG   V   + +  + GL+  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W  N+F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L    +G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   +RKD      +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +KI  T+++P ++  + ++L +A
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTR-FVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLG--NSKTPPPGQAGKSVPGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 284.263 bits (726), Expect = 1.908e-85
Identity = 200/638 (31.35%), Postives = 314/638 (49.22%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKE-VVWSKPYTSVIKDKDKPIPK--WFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGK-DFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLR-------IVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKI--PVTVDNPQVYKEIYDVLIK 1923
            +Y  L   +   P   W  LA++ +VW  PY +V  D D    K  WF+GG++N+S NCLD+HV     + VA+I+E     T  +ITY++LL    +LA  +  +  + +GDRV +Y PV+   +AAMLAC RIGAV+ VIF+GF+ + +AGR+   + K+VIT N     G  +  K+ V++A K C  T  + LV +R +    K+  G  D   E E+    P  A   + S   +F+ YTSG+TG PKG V      ++      K V   +  + F  ++D GWI+G + + YGPL  G T +LFE  PV  PN+      V +  I  F  APT  R+  K       K     LR +   GE  + +  +W+  +     C + + W Q+E G +   P     RP+ +    +  + +R       ++  + G  +    V   L  +   P  A TIY +HQRF+ +YF  YPGY+ T D       G  QI  R DDVI+IS  R+     E+    + ++  +AV+       G+   AF+ V KD A ++  V+ +    V  K+  + +    ++V  LPK ++GK++R  L ++      ++    T+++P +  EI  V  K
Sbjct:   57 SYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVW-DCDFSTGKIGWFLGGQLNVSVNCLDQHVRKS-PESVALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCP-TVQHVLVAHRTDN---KVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVY-PNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAP-----RPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVV-KDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQK 680          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 269.626 bits (688), Expect = 7.364e-80
Identity = 200/654 (30.58%), Postives = 304/654 (46.48%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVI------KDKDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQ---FTPAYSLVYNRPNTAPAKMV---------------------KGKDFDWETEIKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
             Y ELH+ S+  P + W ++AKE  W  P             K K   +W  G   N+ YN LD++V +   GD VA  +E      T +ITY QLL  V Q + V+  K  I KGDRV +Y P+  + + AMLAC RIGA++ ++F+GF+ + +  R+  +   L+ITT+  Y     +N KE  ++A + CQ   F     +V      A   M                      +G D  W   ++ A         ++  P+FI YTSG+TG+PKG V   G  ++      KYV     ++ FW  +D GWI+G + +TYGPL  G T +LFEG P   P+   + +IV+KY +  F TAPT  R+  K   E   K     L+ +   GE  + +   W   +     CPI + + Q+E G     PL G    +P      P   V   I+N    E    E  G ++ K P  P    T+Y NH+RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    + ++  +   Q+ +K+G           P LPK ++GKI+R  L ++A N        TV +P V   ++
Sbjct:   46 RYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPG-SATFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTL-CDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLF 693          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 266.159 bits (679), Expect = 2.416e-78
Identity = 202/667 (30.28%), Postives = 306/667 (45.88%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKD------KDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQ---FTPAYSLVYNRPNTAPAKM----------------VKGK------------------DFDWETEIKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
             Y ELH+ S+  P + W ++AKE  W  P             K K   +W  G   N+ YN LD++V +   GD VA  +E      T +ITY QLL  V Q + V+  K  I KGDRV +Y P+  + + AMLAC RIGA++ ++F+GF+ + +  R+  +   L+ITT+  Y     +N KE  ++A + CQ   F     +V      A   M                V+GK                  D  W   ++ A         ++  P+FI YTSG+TG+PKG V   G  ++      KYV     ++ FW  +D GWI+G + +TYGPL  G T +LFEG P   P+   + +IV+KY +  F TAPT  R+  K   E   K     L+ +   GE  + +   W   +     CPI + + Q+E G     PL G    +P      P   V   I+N    E    E  G ++ K P  P    T+Y NH+RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    + ++  +   Q+ +K+G           P LPK ++GKI+R  L ++A N        TV +P V   ++
Sbjct:   46 RYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTY-PDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPG-SATFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTL-CDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLF 706          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 202.216 bits (513), Expect = 8.824e-56
Identity = 168/627 (26.79%), Postives = 293/627 (46.73%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIK-DKDKPIPKWFV----GGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCH-ILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQF----TPAYSLVYN-----RPNTAPAKMVKGKDFD--WETE-IKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWI---SNIFSCPIYNLWGQSELG-------PVATGPLLGFKR-PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANG 1851
            +Y +L++ SI   ++ W  ++ E+ + +  +  ++ + D      FV    G + N+SYNCL++++  GYG+ +A I+E      T   TY +L   V Q + V+  + H + +GD V LY P+  +   AMLAC RIGA++ V+F+GF+ + +A R+     ++++T +  +     I  K   + AA +         A  +V +     +P+      V   D    +++E +K A   + V  ++S  P+FI YTSG+TG+PKG    T   +       KY    +  + +W  +D GWI+G + + YGPL+ G   I +EG P   P  + + ++ +KY +    T+PT  R    +  +       K L+ I   GE  +     W+     + +  I + + Q+E G       P AT    G    P +     +L  + R++      E P E     L      P     IY + QRF+K+Y   + GY+ T D      DG L I  R DD++++S   +     E   + ++ +  AAVV       G  P AF+ +   + +N  +++A+    V +K+G+  +       P LPK ++GK+ R  L ++A G
Sbjct:   39 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVI------EGPGEG---SLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINE-KLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 202.216 bits (513), Expect = 8.824e-56
Identity = 168/627 (26.79%), Postives = 293/627 (46.73%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIK-DKDKPIPKWFV----GGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCH-ILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQF----TPAYSLVYN-----RPNTAPAKMVKGKDFD--WETE-IKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWI---SNIFSCPIYNLWGQSELG-------PVATGPLLGFKR-PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANG 1851
            +Y +L++ SI   ++ W  ++ E+ + +  +  ++ + D      FV    G + N+SYNCL++++  GYG+ +A I+E      T   TY +L   V Q + V+  + H + +GD V LY P+  +   AMLAC RIGA++ V+F+GF+ + +A R+     ++++T +  +     I  K   + AA +         A  +V +     +P+      V   D    +++E +K A   + V  ++S  P+FI YTSG+TG+PKG    T   +       KY    +  + +W  +D GWI+G + + YGPL+ G   I +EG P   P  + + ++ +KY +    T+PT  R    +  +       K L+ I   GE  +     W+     + +  I + + Q+E G       P AT    G    P +     +L  + R++      E P E     L      P     IY + QRF+K+Y   + GY+ T D      DG L I  R DD++++S   +     E   + ++ +  AAVV       G  P AF+ +   + +N  +++A+    V +K+G+  +       P LPK ++GK+ R  L ++A G
Sbjct:   39 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVI------EGPGEG---SLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINE-KLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 201.83 bits (512), Expect = 9.773e-56
Identity = 168/627 (26.79%), Postives = 293/627 (46.73%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIK-DKDKPIPKWFV----GGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCH-ILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQF----TPAYSLVYN-----RPNTAPAKMVKGKDFD--WETE-IKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWI---SNIFSCPIYNLWGQSELG-------PVATGPLLGFKR-PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANG 1851
            +Y +L++ SI   ++ W  ++ E+ + +  +  ++ + D      FV    G + N+SYNCL++++  GYG+ +A I+E      T   TY +L   V Q + V+  + H + +GD V LY P+  +   AMLAC RIGA++ V+F+GF+ + +A R+     ++++T +  +     I  K   + AA +         A  +V +     +P+      V   D    +++E +K A   + V  ++S  P+FI YTSG+TG+PKG    T   +       KY    +  + +W  +D GWI+G + + YGPL+ G   I +EG P   P  + + ++ +KY +    T+PT  R    +  +       K L+ I   GE  +     W+     + +  I + + Q+E G       P AT    G    P +     +L  + R++      E P E     L      P     IY + QRF+K+Y   + GY+ T D      DG L I  R DD++++S   +     E   + ++ +  AAVV       G  P AF+ +   + +N  +++A+    V +K+G+  +       P LPK ++GK+ R  L ++A G
Sbjct:   29 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVI------EGPGEG---SLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINE-KLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEG 642          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: sur-5 (Acetoacetyl-CoA synthetase [Source:UniProtKB/Swiss-Prot;Acc:Q21166])

HSP 1 Score: 99.7525 bits (247), Expect = 1.505e-21
Identity = 128/643 (19.91%), Postives = 268/643 (41.68%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAK--EVVWSKPYTSVIKD--KDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYK----EQVEKAAKICQFTPAY-----SLVYNRPNTAPAKMVKGKDFDWETEIKT-----ATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYV--GGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHL------RAIYVGGELSDSDLRQWISNIFSCP---IYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPI--CPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMND-GSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVV-PLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQ 1890
            +Y E H+ +  +    W++L K  +V   + Y  VI    K    P+WF G  +N + N +++    G   D+A++   +I  T  + TY  L   V ++A  + N   I  GD V  + P T   + A+ A   +GA +      F P  +  R +   PK++ T N        + YK    +Q +K  +I +  P       S  +        K  +   F    E KT       P    P+  + P+F+ ++SGTTG PK  V   G +++  K+  +++  G  K+ +  +  +  GW+    ++++  L    +++LF+  P+  P++  +  I  K      G    ++  + +      L++P+  L        +Y  G     +   +I N +  P   I ++ G +++     G +        +     L +D++  N    E +  +  G ++  TP    PS  L    + +++  +YF +   ++   D+  + +  G +++L RSD  ++    RI       V  +   + +  V   L +    +  + F+++   + + +S + A  + ++   M    +      V ++P   +GK +  ++ ++ +G+  +   ++ NP+
Sbjct:   75 DYREFHRFTCDNYGIFWEDLLKLSDVKLHQNYNQVIDHNLKINERPRWFNGATLNYTENVIER----GTATDIAVL-NASIEETVTEYTYDNLRKDVYRIATSLRNYG-IGPGDTVCGFVPNTYDTLVAVFATAAVGAAWCSASVDFGPAGVLDRFRQVHPKVLFTVN-------HVTYKKKLIDQTDKINEIVKELPTLEKIVVSDTFTSVKFDATKYNQSDKFSSLEEFKTPIADVVLPFVYTPVPFSDPLFVMFSSGTTGIPKAMVHTVGGTLL--KHIEEHLVQGDSKKHDRMFFYTTCGWMMYNWMISF--LYSKGSVVLFDECPL-APDTHIIMKIAAKTQSTMIGMGAKLYDEYLR------LQIPFNTLYDLSKIHTVYSTGSPLKKECFAYI-NTYIAPGALIASISGGTDIIGCFVGGIKSLSITPGECQCLFLGMDIKSFNYMDEEIINSDEQGELVCVTPFPSMPSHFLND-TDGKKYRDAYFARLEPFWAHGDFVRVNHSTGGVEMLGRSDATLNRGGVRIGTAEIYSVVEKIPHIADCIVAGRLVEEGMDEEVLLFVKMVPGQELTHS-IQAAIVSKLRNDMSPRHVPNKIYAVDDIPYTSSGKKVEVAVKQIVSGKAVQKASSIRNPE 690          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: sur-5 (Acetoacetyl-CoA synthetase [Source:UniProtKB/Swiss-Prot;Acc:Q21166])

HSP 1 Score: 99.7525 bits (247), Expect = 1.505e-21
Identity = 128/643 (19.91%), Postives = 268/643 (41.68%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAK--EVVWSKPYTSVIKD--KDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYK----EQVEKAAKICQFTPAY-----SLVYNRPNTAPAKMVKGKDFDWETEIKT-----ATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYV--GGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHL------RAIYVGGELSDSDLRQWISNIFSCP---IYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPI--CPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMND-GSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVV-PLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQ 1890
            +Y E H+ +  +    W++L K  +V   + Y  VI    K    P+WF G  +N + N +++    G   D+A++   +I  T  + TY  L   V ++A  + N   I  GD V  + P T   + A+ A   +GA +      F P  +  R +   PK++ T N        + YK    +Q +K  +I +  P       S  +        K  +   F    E KT       P    P+  + P+F+ ++SGTTG PK  V   G +++  K+  +++  G  K+ +  +  +  GW+    ++++  L    +++LF+  P+  P++  +  I  K      G    ++  + +      L++P+  L        +Y  G     +   +I N +  P   I ++ G +++     G +        +     L +D++  N    E +  +  G ++  TP    PS  L    + +++  +YF +   ++   D+  + +  G +++L RSD  ++    RI       V  +   + +  V   L +    +  + F+++   + + +S + A  + ++   M    +      V ++P   +GK +  ++ ++ +G+  +   ++ NP+
Sbjct:   75 DYREFHRFTCDNYGIFWEDLLKLSDVKLHQNYNQVIDHNLKINERPRWFNGATLNYTENVIER----GTATDIAVL-NASIEETVTEYTYDNLRKDVYRIATSLRNYG-IGPGDTVCGFVPNTYDTLVAVFATAAVGAAWCSASVDFGPAGVLDRFRQVHPKVLFTVN-------HVTYKKKLIDQTDKINEIVKELPTLEKIVVSDTFTSVKFDATKYNQSDKFSSLEEFKTPIADVVLPFVYTPVPFSDPLFVMFSSGTTGIPKAMVHTVGGTLL--KHIEEHLVQGDSKKHDRMFFYTTCGWMMYNWMISF--LYSKGSVVLFDECPL-APDTHIIMKIAAKTQSTMIGMGAKLYDEYLR------LQIPFNTLYDLSKIHTVYSTGSPLKKECFAYI-NTYIAPGALIASISGGTDIIGCFVGGIKSLSITPGECQCLFLGMDIKSFNYMDEEIINSDEQGELVCVTPFPSMPSHFLND-TDGKKYRDAYFARLEPFWAHGDFVRVNHSTGGVEMLGRSDATLNRGGVRIGTAEIYSVVEKIPHIADCIVAGRLVEEGMDEEVLLFVKMVPGQELTHS-IQAAIVSKLRNDMSPRHVPNKIYAVDDIPYTSSGKKVEVAVKQIVSGKAVQKASSIRNPE 690          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0346110)

HSP 1 Score: 424.861 bits (1091), Expect = 1.235e-139
Identity = 215/640 (33.59%), Postives = 360/640 (56.25%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTP-AYSLVYNRPNTAP--AKMVKGKDFDWETEIKTA---TPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPY--KHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLP 1947
            Y + ++ S+ +P   W+E    + W +P+  V+ + + P  KW+VGG +N  YN +D+H+L G G +VA+I++  +T T  ++TYQ+L   +  LAG +  K  ++KGDRV++Y P+  + + AMLA  R+GA++ V+F GFA   +  R++H EPKLVI +N+  EPG  + Y + +  A  + ++ P   ++++ R N +P   K+    D  W   +K A    P A VP+E+N P++I YTSGTT +PKG +   G  +V   Y L+ + G+     +W  SD GW+ G + + YGPL +G T +++EGKP   P+  +   I+++Y + S  + PT FR+ R+  P+      Y  K LRAI++ GE  D + + WI   F  P+ N W Q+E G   T   LGF++    P Y   LP++  D++I+ +D G E     +GR+ LK P+ P    T+YKN + F   YF K+PGY+DTMD G     G + + +R DDVI+++  R+   + E+  L++  +++ AV  + + T GQVP+      ++    ++++  + I  +   +G    F+    V  LP+ ++GK +R ++++ A      +P T+D+  V+ EI   L + GY  T P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKAD-GSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0084606)

HSP 1 Score: 424.861 bits (1091), Expect = 1.235e-139
Identity = 215/640 (33.59%), Postives = 360/640 (56.25%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTP-AYSLVYNRPNTAP--AKMVKGKDFDWETEIKTA---TPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPY--KHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLP 1947
            Y + ++ S+ +P   W+E    + W +P+  V+ + + P  KW+VGG +N  YN +D+H+L G G +VA+I++  +T T  ++TYQ+L   +  LAG +  K  ++KGDRV++Y P+  + + AMLA  R+GA++ V+F GFA   +  R++H EPKLVI +N+  EPG  + Y + +  A  + ++ P   ++++ R N +P   K+    D  W   +K A    P A VP+E+N P++I YTSGTT +PKG +   G  +V   Y L+ + G+     +W  SD GW+ G + + YGPL +G T +++EGKP   P+  +   I+++Y + S  + PT FR+ R+  P+      Y  K LRAI++ GE  D + + WI   F  P+ N W Q+E G   T   LGF++    P Y   LP++  D++I+ +D G E     +GR+ LK P+ P    T+YKN + F   YF K+PGY+DTMD G     G + + +R DDVI+++  R+   + E+  L++  +++ AV  + + T GQVP+      ++    ++++  + I  +   +G    F+    V  LP+ ++GK +R ++++ A      +P T+D+  V+ EI   L + GY  T P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKAD-GSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0333126)

HSP 1 Score: 267.7 bits (683), Expect = 1.046e-79
Identity = 190/649 (29.28%), Postives = 316/649 (48.69%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDK-----------PIP-KWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEK-ITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKE----QVEKAAKICQFTPAYSLVYNRPNTAPAK---------MVKGKDFDWETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIF---SCPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
            Y++ ++ S+ +P + W  +AK+  W  P      D+DK           PI  KW  G   N+ YN LD++V +G GD +A  +E    +   + +TY++LL  V + A V+ +   I KGDRV +Y P+ ++   AMLAC RIGAV+ ++F+GF+PD +A RM   + KL+IT + A+     +  K      +EK  ++        +V +     P +             +D+ W  E++   P A  P  +++  P+F+ YTSG+TG+PKG +  T   ++      K V   K  + +W   D GWI+G T + YGPL  G T ++FEG P   P +    ++++KY +  F TAPT  R   K      LK     L+ +   GE  + +   W         C I + + Q+E G     PL G    +P      P   V   +++ + G E+  E  G ++   P  P    T+Y NH+RF  +YF+K+PGY+ T D      DG L I  R DD++++S   +     E V  ++  +  +AVV    P  G+    F+   +++ V + ++I+     V +++G F +       P LPK ++GKI+R  L ++A N R      T+ + Q+ ++++
Sbjct:   26 YQKFYQESLDNPAEFWSRVAKQFHWETP-----ADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFF-PGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPG-SASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQP-WPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENE-VFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 662          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078413)

HSP 1 Score: 267.7 bits (683), Expect = 1.046e-79
Identity = 190/649 (29.28%), Postives = 316/649 (48.69%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDK-----------PIP-KWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEK-ITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKE----QVEKAAKICQFTPAYSLVYNRPNTAPAK---------MVKGKDFDWETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIF---SCPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
            Y++ ++ S+ +P + W  +AK+  W  P      D+DK           PI  KW  G   N+ YN LD++V +G GD +A  +E    +   + +TY++LL  V + A V+ +   I KGDRV +Y P+ ++   AMLAC RIGAV+ ++F+GF+PD +A RM   + KL+IT + A+     +  K      +EK  ++        +V +     P +             +D+ W  E++   P A  P  +++  P+F+ YTSG+TG+PKG +  T   ++      K V   K  + +W   D GWI+G T + YGPL  G T ++FEG P   P +    ++++KY +  F TAPT  R   K      LK     L+ +   GE  + +   W         C I + + Q+E G     PL G    +P      P   V   +++ + G E+  E  G ++   P  P    T+Y NH+RF  +YF+K+PGY+ T D      DG L I  R DD++++S   +     E V  ++  +  +AVV    P  G+    F+   +++ V + ++I+     V +++G F +       P LPK ++GKI+R  L ++A N R      T+ + Q+ ++++
Sbjct:   26 YQKFYQESLDNPAEFWSRVAKQFHWETP-----ADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFF-PGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPG-SASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQP-WPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENE-VFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 662          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078414)

HSP 1 Score: 207.608 bits (527), Expect = 7.490e-59
Identity = 149/522 (28.54%), Postives = 250/522 (47.89%), Query Frame = 1
Query:  406 FPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKE----QVEKAAKICQFTPAYSLVYNRPNTAPAK---------MVKGKDFDWETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIF---SCPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
             P+ ++   AMLAC RIGAV+ ++F+GF+PD +A RM   + KL+IT + A+     +  K      +EK  ++        +V +     P +             +D+ W  E++   P A  P  +++  P+F+ YTSG+TG+PKG +  T   ++      K V   K  + +W   D GWI+G T + YGPL  G T ++FEG P   P +    ++++KY +  F TAPT  R   K      LK     L+ +   GE  + +   W         C I + + Q+E G     PL G    +P      P   V   +++ + G E+  E  G ++   P  P    T+Y NH+RF  +YF+K+PGY+ T D      DG L I  R DD++++S   +     E V  ++  +  +AVV    P  G+    F+   +++ V + ++I+     V +++G F +       P LPK ++GKI+R  L ++A N R      T+ + Q+ ++++
Sbjct:    1 MPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFF-PGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPG-SASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQP-WPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENE-VFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 516          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 447.203 bits (1149), Expect = 9.403e-149
Identity = 228/624 (36.54%), Postives = 357/624 (57.21%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPE-EQLKL-PYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVL 1917
            YE+   L+   P+  W E A  + W + +T  + + D   PKWFVGG++N+ YN +D+HV +G GD  A+IY+  +T T + ITY+++   V +LAGV+V K  +  GD V++Y P+  Q M  MLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   VEKA ++    P   L+YNRP+            DWE E+ TA PH  V + ++HP+++ YTSGTTG PKG V  +G   V   + +  V GL   E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+      +++++      TAPT  R  R+  P+ E  KL P   LR ++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  +  P+ T+G +++K P+ P  AL++++NH  F + YFTK+ GY+DTMD G +  +G L I++RSDDVI+++  R+  GA EE  L + ++++ AVV L+D   G VP+A   +R D   +  +++   +  V   +G    F+    V  LPK ++GKI R SL+ + N + +KI  T+++P+V+K+I  +L
Sbjct:    2 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPKGVVRDSGGYAVMLNWTMSNVYGLAPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDMQQVKPR-TLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 623          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 424.476 bits (1090), Expect = 3.527e-139
Identity = 220/625 (35.20%), Postives = 346/625 (55.36%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPE-EQLKL-PYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGF----KRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVL 1917
             YE+   L+   P+  W E A  + W + +T  + + D   PKWFVGG++N+ YN +D+HV +G GD  A+IY+  +T T + ITY+++   V +LAGV+V K  +  GD V++Y P+  Q M  MLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   VEKA ++    P   L+YNRP+            DWE E+ TA PH  V + ++HP+++ YTSGTTG PK                            +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+      +++++      TAPT  R  R+  P+ E  KL P   LR ++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  +  P+ T+G +++K P+ P  AL++++NH  F + YFTK+ GY+DTMD G +  +G L I++RSDDVI+++  R+  GA EE  L + ++++ AVV L+D   G VP+A   +R D   +  +++   +  V   +G    F+    V  LPK ++GKI R SL+ + N + +KI  T+++P+V+K+I  +L
Sbjct:   83 TYEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPK---------------------------VWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDMQQVKPR-TLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss1 (acyl-CoA synthetase short chain family member 1 [Source:ZFIN;Acc:ZDB-GENE-050320-139])

HSP 1 Score: 310.842 bits (795), Expect = 1.506e-95
Identity = 206/629 (32.75%), Postives = 317/629 (50.40%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKE-VVWSKPYTSVIKDKDKPIPK--WFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCH-ILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK----RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIP--VTVDNPQVYKEI 1905
            NY +L++LS+  PE  W  +AKE + W+KP+  V  D D    K  WF+GG++N+S NCLD HV +     VA+I+E     T E+ITY++LL +  +LA  +  K H + +G+RV +Y PV+   +AAMLAC RIGAV+ V+F+GF+ + +AGR++  + K VIT N     G   + K  V+KA K C   P+   V+    T  +  +   D   E  +   +   A  P+ES   +F+ YTSG+TG+PKG V      ++      +YV      + F  ++D GWI+G + + YGPL  G T +LFE  PV  PN       V +  I  F  APT  R+  K       K     L+ +   GE  + +   W  N+     CP+ + W Q+E G V   PL        RP   +  P   +   ++  + G+ +    V   L  +   P  A TI+ +HQRF+ +YF  Y G + T D      DG  QI  R DDVI+IS  R+     E+   ++  +   AV+ +     G+VP AF+ +++  A N   V+ +    V  K+  + +  + ++V  LPK ++GKI+R  L ++A      +    T+D+P V  EI
Sbjct:   61 NYADLYELSVKDPENFWGSIAKERLAWTKPFDQV-SDCDISSGKINWFLGGQLNVSVNCLDVHVAND-PSRVALIWEKDEPGTEERITYRELLEMTCRLANTL--KSHGVQRGERVAIYMPVSPMAVAAMLACARIGAVHTVVFAGFSSEALAGRIQDAQCKFVITCNQGVRGGRVFDLKSTVDKAVKSC---PSVRHVFVAKRTNNSVPMGKLDIPLEEVMAGQSSECAPEPMESEEMLFMLYTSGSTGKPKGIVHTQAGYLLYASLTHQYVFDYTPGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPV-YPNPGRYWETVQRLRINQFYGAPTAIRLLLKYEESWVKKYDRSSLKTLASVGEPINHEAWDWFHNVVGDGRCPLVDTWWQTETGGVCIAPLPAEPGAEIRPAMAM-RPFFGIKPELLG-EKGQIITGNDVNGALCISQPWPGMARTIFGDHQRFVDAYFKPYQGQYFTGDGAYRTEDGYYQITGRMDDVINISGHRLGTAEIEDALDEHPDVPETAVIGIPHEIKGEVPFAFVVLKESAAENQQAVVNELRHLVASKIAKYAVPDHFLVVKRLPKTRSGKIMRRILRKVAVQDTSNLGDVSTLDDPSVVSEI 679          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 268.47 bits (685), Expect = 9.933e-80
Identity = 190/630 (30.16%), Postives = 305/630 (48.41%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFV------GGEINMSYNCLDKHVLD-GYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFT--PAYSLVYNRPNTAPAKMVKGK--------------------DFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA 1845
             Y+EL+  S+  PE+ W ++AK+  W   YT    D +  + K  +      G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V + A V+ ++  + KGDRV +Y P+ ++ + AMLAC RIGAV+ ++F+GF+ + +  R+  ++  L+IT +  Y     IN K   ++A K C+    P    +  +  T   +   G                     D  W + I  A+     V  +S  P+FI YTSG+TG+PKG +      ++      K V      + +W  +D GWI+G + +TYGPL  G T +LFEG P   P+ + +  IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +  QW  N+     CP+ + + Q+E G     PL      +P      P   V   I+N ++GEEL   + G ++ K P  P    T+Y NH RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    N ++ A+   QV +K+G+          P LPK ++GKI+R  L ++A
Sbjct:   29 KYKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTY-PDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPG-SATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTL-NDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIA 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 261.536 bits (667), Expect = 4.641e-77
Identity = 190/646 (29.41%), Postives = 305/646 (47.21%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFV------GGEINMSYNCLDKHVLD-GYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFT--PAYSLVYNRPNTAPAKMVKGK------------------------------------DFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA 1845
             Y+EL+  S+  PE+ W ++AK+  W   YT    D +  + K  +      G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V + A V+ ++  + KGDRV +Y P+ ++ + AMLAC RIGAV+ ++F+GF+ + +  R+  ++  L+IT +  Y     IN K   ++A K C+    P    +  +  T   +   G                                     D  W + I  A+     V  +S  P+FI YTSG+TG+PKG +      ++      K V      + +W  +D GWI+G + +TYGPL  G T +LFEG P   P+ + +  IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +  QW  N+     CP+ + + Q+E G     PL      +P      P   V   I+N ++GEEL   + G ++ K P  P    T+Y NH RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    N ++ A+   QV +K+G+          P LPK ++GKI+R  L ++A
Sbjct:   29 KYKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTY-PDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPG-SATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTL-NDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIA 668          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 482.641 bits (1241), Expect = 2.562e-161
Identity = 237/625 (37.92%), Postives = 367/625 (58.72%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVL 1917
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     +  G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PKG V  +    V   + +  + GL   + +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G     K P      P+   +++I+++D  E  P  T+G +++K P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +KI  T+++P V+K + D +
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 470.7 bits (1210), Expect = 1.545e-156
Identity = 231/608 (37.99%), Postives = 356/608 (58.55%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKI 1866
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     +  G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PKG V  +    V   + +  + GL   + +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G     K P      P+   +++I+++D  E  P  T+G +++K P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +K+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 691          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 464.151 bits (1193), Expect = 2.072e-154
Identity = 233/609 (38.26%), Postives = 356/609 (58.46%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMV--KGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGF----KRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWK 1863
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     MV   G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PKG V  +    V   + +  + GL   + +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G     K P      P+   +++I+++D  E  P  T+G +++K P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +K
Sbjct:   82 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPN-----MVCNAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYK 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 456.447 bits (1173), Expect = 4.418e-151
Identity = 226/604 (37.42%), Postives = 345/604 (57.12%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKI 1866
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     +  G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PKG V  +    V   + +  + GL   + +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G       L  P       +   +  + L K  +    L+ P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +K+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGN---SLKPPAGQAGKPVPGYNGKQNLRKLLLATYPLRLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 450.669 bits (1158), Expect = 3.963e-149
Identity = 226/608 (37.17%), Postives = 346/608 (56.91%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKI 1866
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     +  G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PK                            +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G     K P      P+   +++I+++D  E  P  T+G +++K P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +K+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPK---------------------------VWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 664          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 464.537 bits (1194), Expect = 8.930e-155
Identity = 229/630 (36.35%), Postives = 368/630 (58.41%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+  PE+ W + A+++ W KP+T  ++ +  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +T+T   I+Y+++L  V +LAGV+V K  + KGD V++Y P+  Q +  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   +E+A +I Q  P   L+Y+RPN     ++ G+D DWE E+  A  H  VP+ S HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W   +F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L   ++G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   ++KD   +  +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +K+  T+++P ++  I +VL +A
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLG--NSKTPPPGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 320.857 bits (821), Expect = 1.067e-101
Identity = 153/405 (37.78%), Postives = 236/405 (58.27%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGF 1269
             Y+     S+  PE+ W + A+++ W KP+T  ++ +  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +T+T   I+Y+++L  V +LAGV+V K  + KGD V++Y P+  Q +  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   +E+A +I Q  P   L+Y+RPN     ++ G+D DWE E+  A  H  VP+ S HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W   +F  P+ + W Q+E G   T   +G 
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGL 459          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss1 (acyl-CoA synthetase short-chain family member 1 [Source:MGI Symbol;Acc:MGI:1915988])

HSP 1 Score: 281.952 bits (720), Expect = 1.084e-84
Identity = 199/639 (31.14%), Postives = 311/639 (48.67%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKE-VVWSKPYTSVIKDKDKPIPK--WFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGK-DFDWETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLR-------IVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKI--PVTVDNPQVYKEIYDVLIK 1923
            +Y  L   +   P   W  LA++ +VW  PY +V  D D    K  WF+GG++N+S NCLD+HV     + +A+I+E     T  +ITY++LL    +LA  +  +  + +GDRV +Y PV+   +AAMLAC RIGA++ V+F+GF+ + +AGR+   + K VIT N     G  +  K+ V++A K C  T  + LV +R +T   K+  G  D   E E+    P    P  + S   +F+ YTSG+TG PKG V      ++      K V   +  + F  ++D GWI+G + + YGPL  G T +LFE  PV  P++      V +  I  F  APT  R+  K       K     LR +   GE  + +  +W+  +     C + + W Q+E G +   P     RP+ D    +  + +R       ++  + G  L    V   L  +   P  A TIY +HQRF+ +YF  YPGY+ T D       G  QI  R DDVI+IS  R+     E+    + ++   AV+       G+   AF+ V KD   + + V+ +    V  K+  + +    ++V  LPK ++GK++R  L ++   R   +    T+++P V  EI     K
Sbjct:   50 SYPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVW-DCDFRTGKIGWFLGGQLNVSVNCLDQHVQKS-PETIALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVKSCP-TVQHVLVAHRTDT---KVPMGSLDIPLEQEMAKEAP-VCTPESMSSEDMLFMLYTSGSTGTPKGLVHTQAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVY-PDAGRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIAP-----RPSEDGAEILPGMAMRPFFGIVPVLMDEKGNVLEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFI-VLKDNISDENMVVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLEDPSVITEILSAFQK 673          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 265.388 bits (677), Expect = 1.971e-78
Identity = 198/656 (30.18%), Postives = 308/656 (46.95%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSK----PYTSVIKD--KDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQF-----------------------TPAYSLVYNRPNTAPAKMV---KGKDFDWETEIKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
             Y ELH+ S+  P + W  +AKE  W      P+     D  K K   +W  G   N+ YN LD++V +   GD VA  +E      T KITY++LL  V Q + V+  K  I KGDRV +Y P+ ++ + AMLAC R+GA++ ++F+GF+ + +  R+  +   L+ITT+  Y     +N KE  +++ + C+                        +P+ S    RP   P   +   +G D  W   ++ A         ++  P+FI YTSG+TG+PKG V   G  ++      KYV     ++ FW  +D GWI+G + +TYGPL  G T +LFEG P   P+   + +IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +   W   +     CPI + + Q+E G     PL G    +P      P   V   I+N    E    E  G ++ K P  P    T+Y NH RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    +  +  +   Q+ +K+G           P LPK ++GKI+R  L ++A N        TV +P V   ++
Sbjct:   46 RYRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRP--CPDVQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPG-SASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTL-CDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLF 693          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 261.536 bits (667), Expect = 7.457e-77
Identity = 198/667 (29.69%), Postives = 309/667 (46.33%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSK----PYTSVIKD--KDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQF-----------------------TPAYSLVYNRPN-------TAPAKMVK-------GKDFDWETEIKTATPHAAVP-LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIY 1908
             Y ELH+ S+  P + W  +AKE  W      P+     D  K K   +W  G   N+ YN LD++V +   GD VA  +E      T KITY++LL  V Q + V+  K  I KGDRV +Y P+ ++ + AMLAC R+GA++ ++F+GF+ + +  R+  +   L+ITT+  Y     +N KE  +++ + C+                        +P+ S    RP           +K ++       G D  W   ++ A         ++  P+FI YTSG+TG+PKG V   G  ++      KYV     ++ FW  +D GWI+G + +TYGPL  G T +LFEG P   P+   + +IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +   W   +     CPI + + Q+E G     PL G    +P      P   V   I+N    E    E  G ++ K P  P    T+Y NH RF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D    +  +  +   Q+ +K+G           P LPK ++GKI+R  L ++A N        TV +P V   ++
Sbjct:   46 RYRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQGKLREKSKCIRPQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTY-PDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPG-SASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTL-CDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLF 706          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q9H6R3|ACSS3_HUMAN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 1.024e-157
Identity = 235/630 (37.30%), Postives = 368/630 (58.41%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+T PE+ W + A+++ W KP+T  +++K  P  +WFV G +N+ YN +D+H+ +G GD +AIIY+  +TNT    TY+++L  V +LAGV+V K  I KGD V++Y P+  Q M  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   VE+A KI Q  P   L+YNRPN     +  G+D DW+ E+  A  H  VP+ S HP++I YTSGTTG PKG +  TG   V   + +  + GL+  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W  N+F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L    +G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   +RKD      +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +KI  T+++P ++  + ++L +A
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLG--NSKTPPPGQAGKSVPGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q5REB8|ACSS3_PONAB (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii OX=9601 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 472.241 bits (1214), Expect = 6.129e-157
Identity = 234/630 (37.14%), Postives = 367/630 (58.25%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+T PE+ W + A+++ W KP+T  +++K  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +TNT    TY+++L  V +LAGV+V K  I KGD V++Y P+  Q M  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   VE+A KI Q  P   L+YNRPN     +  G+D DW+ E+  A  H  VP+ S HP++I YTSGTTG PKG +  TG   V   + +  + GL+  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W  N+F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L    +G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G + ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   +RKD      +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +KI  T+++P ++  + ++L +A
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTSWFVEGMLNVCYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLNWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLG--NSKTPPPGQAGKSVPGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A0A0G2K047|ACSS3_RAT (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acss3 PE=1 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.004e-155
Identity = 231/630 (36.67%), Postives = 369/630 (58.57%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+  PE+ W + A+++ W KP+T  ++++  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +T+T   I+Y+++L  V +LAGV+V K  + KGD V++Y P+  Q + AMLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   +E+A +I Q  P   L+YNRPN     ++ G+D DWE E+  A  H  VP+ S HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W   +F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L   ++G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   ++KD      +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +K+  T+++P ++  I +VL +A
Sbjct:   57 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYAMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRIGQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLG--NSKTPPPGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVTDCAVVGKEDPLKGHVPLALCVLKKDVNATEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q14DH7|ACSS3_MOUSE (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus OX=10090 GN=Acss3 PE=1 SV=2)

HSP 1 Score: 464.537 bits (1194), Expect = 6.247e-154
Identity = 229/630 (36.35%), Postives = 368/630 (58.41%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+  PE+ W + A+++ W KP+T  ++ +  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +T+T   I+Y+++L  V +LAGV+V K  + KGD V++Y P+  Q +  MLAC RIGA++ +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   +E+A +I Q  P   L+Y+RPN     ++ G+D DWE E+  A  H  VP+ S HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W   +F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L   ++G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G L ++SR DDVI+++  RI  GA EE  L + ++ + AVV  +DP  G VP+A   ++KD   +  +V+ + +  V + +G    F+NAV V +LPK ++GKI R +LS + NG+ +K+  T+++P ++  I +VL +A
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLG--NSKTPPPGQAGKCVPGYNVMILD-DNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A7MB45|ACSS3_BOVIN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus OX=9913 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.870e-150
Identity = 231/630 (36.67%), Postives = 362/630 (57.46%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP------ILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKA 1926
             Y+     S+T PE+ W + A+++ W KP+T  ++++  P   WFV G +N+ YN +D+H+ +G GD +AIIY+  +TNT   ITY+++L  V +LAGV+V K  + KGD V++Y P+  Q M AMLAC RIGA++ +IF GFA   ++ R+ H +PKLVIT +   EPG  + Y   VE+A +I Q  P   L+YNRP+T    +  G   DW+ E+  A  H  VP+ S HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++     ++ ++ + +  TAPT  R  R+  P   L   Y     + ++V GE  D +  +W   +F  P+ + W Q+E G   T   +G    N   P P      +   ++ I++ D  ++L    +G +++K P+ P     ++KN + F   YF K+PGY+DTMD G +  +G + ++SR DDVI+++  RI  GA EE  L    + + AVV  +D   G +P+A   ++KD       V+ + +  V + +G    F+ AV V +LPK ++GKI R +LS + NG+ +K+  T+++P +++ I  +L +A
Sbjct:   60 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHGVKKGDTVVIYMPMIPQAMYAMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIEPGRKVEYVPLVEEALRIGQHKPDKVLIYNRPHTDMVPLAPGYYLDWDEELSKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLG--NSKTPPPGQAGKSVPGYNVMILD-DNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGALEESILSLGIVADCAVVGKEDSLKGHIPLALCVLKKDINTTEEHVLEEIVKHVRQTIGPVAAFRKAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVSPTIEDPGIFEHIEAMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A3P8V339 (Acyl-CoA synthetase short chain family member 3 OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 3.621e-158
Identity = 240/622 (38.59%), Postives = 369/622 (59.32%), Query Frame = 1
Query:   94 HPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQL--KLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVY----KEIYDVLIKAG 1929
            HPE+ W ++A+++ W +P+T  ++ +D   P WFVGG++NM YN +D+HV  G GD  AIIY+  +T T + ITY++L   V +LAGV+V K  + KGD V++Y P+  Q M  MLAC RIGA + +IF GFA   ++ R+ H +PKL++T++   EPG  + Y   VEKA ++    P+  LVYNRPN     +      DW+ E+ TA PH  VPL SNHP+++ YTSGTTG PKG   GT    V  K+ +  + GL   E +W  SD GW+ G + + Y PLL G T IL+EGKPV  P+      +++ +   S  TAPT  R  R+  P+ ++  K P   LR++++ GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  + +   T+G +++K P+ P  AL++++N   F K+YF+K+PGY+DTMD G +  DG L I+SRSDDVI+++  R+  GA EE  LQ+ ++ + AVV L+D   G VP+A   ++   + N  +VI +T++ V + +G    F+N + V  LPK ++GKI R SL+ + N + +KI  T+++P V+    KE+ +VL   G
Sbjct:   73 HPEQFWSDVARDIHWFQPWTQTLRLEDPVFPNWFVGGQLNMCYNAVDRHVESGRGDQPAIIYDSPVTGTKQIITYRELQEQVSKLAGVLV-KNGVQKGDVVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTSSFGIEPGRRVQYIPLVEKALELSSHKPSKVLVYNRPNMEKVSLKSELSLDWDEEMATARPHDCVPLSSNHPLYVLYTSGTTGTPKGIARGTAGHAVMLKWTMSNIYGLSPGEVWWAASDLGWVVGHSYICYAPLLHGNTTILYEGKPVGTPDPGSFFRVLSDHGASSMFTAPTALRAIRQQDPQAEIGKKYPLTRLRSMFLAGERCDVETLEWAKKSFGVPVLDHWWQTETGSPITSTCIGLGNSLTPPAGQAGRPVPGYNVTVID-DVKQSVQPRTLGNIVVKLPLPPGAALSLWQNEDLFRKTYFSKFPGYYDTMDAGFMDLDGFLYIMSRSDDVINVAGHRLSAGALEECVLQHPAVGDCAVVGLEDSLKGHVPLALCVLKNGVSKNQQDVIKETVNLVRENIGPVAAFRNMLFVRALPKTRSGKIPRSSLANLVNRKPYKITPTIEDPDVFEDIEKEVQNVLRPPG 692          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A5G3KCT6 (Acyl-CoA synthetase short chain family member 3 OS=Xenopus tropicalis OX=8364 GN=acss3 PE=4 SV=1)

HSP 1 Score: 482.641 bits (1241), Expect = 4.022e-158
Identity = 237/625 (37.92%), Postives = 367/625 (58.72%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYK--HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVL 1917
            NYE + + S+  PEKVW E A  + W KP++ ++ + + P  KWF+ GE+N+ YN +D+H+  G GD  AIIY+  +TNT + ITY+++   V +LA V+  K  + KGDRV++Y P+  Q   AMLAC RIGA++ +IF GFA   +A R+ H +PKL+IT +   EPG  + Y   VE+A +I +  P   ++Y+RPN     +  G+D DW  EI  A PH  VP+ S HP+++ YTSGTTG PKG V  +    V   + +  + GL   + +W  SD GW+ G + + YGPLL G T +L+EGKPV  P+++    +++++ + +  TAPT  R  R+  PE +L  P+     R ++V GE  D +  +W   IF  P+ + W Q+E G   T   +G     K P      P+   +++I+++D  E  P  T+G +++K P+ P    T++KN   F   YFTK+PGY+DTMD G    DG + +LSR DDVI+++  R+  GA EE  L + ++ + AVV L+DP  G VP+A   +R        ++  + +  V + +G    F+  VIV +LPK ++GKI R +LS + NG+ +KI  T+++P V+K + D +
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANP-NTLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: J7JE35 (PrpE protein OS=Burkholderia cepacia GG4 OX=1009846 GN=GEM_5816 PE=4 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 2.922e-157
Identity = 234/633 (36.97%), Postives = 367/633 (57.98%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQL--KLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG-----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKAT 1941
            ++E+H  S+T PE  WDE A+ + W KP+T V+ D + P  +WFVGGE+N  YN +D+HV DG G   AIIY+  +T+T + ITY +L  LV   AG +  +  + KGDRVLLY P+  Q + AMLAC R+GAV+ V+F GFAP+ +A R+    PK+++  +   EP   + YK  ++ A    +  P   +V+ RP  A A MV G+D DW T +  A P   VP+ +  P++I YTSGTTG+PKG V   G   V  ++ ++Y   ++  E +W  SD GW+ G + + YGPLL GCT ++FEGKPV  P++     ++ ++ + +  TAPT FR  ++  P+ +   K    H RA+++ GE SD D  +W  +    P+ + W Q+E G    G  LG      K  +    +P    D+R++N +  +++P+  +G + +K P+ P    T++   +RF KSY   Y GY+ T D G I  DG + +++R+DD+I+++  R+  GA EEV   +  +   AV+ + D   GQVP+ FL ++      + E++ + +  V +++G    FK AV+V  LPK ++GKILR ++ ++ANG  +K P T+D+P+V  EI   L   GY  +
Sbjct:    9 FDEMHTRSLTDPEGFWDEAAQGISWYKPWTKVLDDSNAPFYRWFVGGELNTCYNAVDRHVEDGCGAQAAIIYDSPVTDTVQTITYAELQDLVAHFAGALRAQG-VEKGDRVLLYMPMIPQSVVAMLACARLGAVHSVVFGGFAPNELATRIDDATPKVIVAASCGIEPNRVVEYKPMLDAAIDQAEHKPDGVIVFQRPQ-AIAPMVDGRDIDWNTAVAQALPADCVPVRATDPLYILYTSGTTGQPKGVVRDNGGHAVALRWTMEYFYDVQPGEVYWAASDVGWVVGHSYIVYGPLLAGCTTVVFEGKPVGTPDAGTFWRVIAQHKVTTLFTAPTAFRAIKREDPDARHLGKHDLSHFRALFLAGERSDPDTLRWAEDNLKVPVIDHWWQTETGWAVAGNPLGVHLFPIKYGSAARAMP--GWDVRVLNGNQ-DDVPRGDIGALCVKLPLPPGALPTLWNADERFKKSYLHAYSGYYQTGDAGFIDEDGYVHVMARTDDIINVAGHRLSTGAMEEVLANHKDVAECAVIGVADGLKGQVPLGFLCLKVGVMRPHEEIVKEVVQLVREQIGPVADFKRAVVVDRLPKTRSGKILRGTMQKIANGEEYKTPATIDDPEVLPEISKALHSGGYSKS 636          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A1B6EB89 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.40977 PE=4 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 5.656e-156
Identity = 237/637 (37.21%), Postives = 371/637 (58.24%), Query Frame = 1
Query:   55 SLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQL--KLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLP 1947
            S  Y E  + S+  PE+ W E+   V WSK +T V+ + D+P  KWFVGGE+N  YN +D+HV  G G+ VA+I++  +T +  ++TY++L   V  LAG +V K  + KGDRVL+Y P+  + + +MLA  RIGAV+ V+F GFA   +  R+ H EPK++I  +   EP   + YK+ + +A ++ Q  P+  +++ R N   A++  G D  W+  +  + PH  VP+E+N P++I YTSGT G+PKG +  TG  I T  + +  + G+   + +W  SD GW+ G + + YGPL  G T +++EGKP   P+S +   ++  + + +  TAPT  R+ R+  PE ++  K P K LR ++V GE  D + + W   +F  PI N W Q+E G   T   +G       P Y   +P    D+RI+ SD G E     +GR+++K P+ P    T+YK  QRFL+ YF+ YPGY+DTMD G     G + + +R DDVI+++  R+   A E+V + +  +++AAVV + +PT G++PI    +RK    +  ++  + I +V + +G    F+ +  V  LP+ ++GKI R S+S++A     KIP T+++P VYKEI  VL K GY  T P
Sbjct:   41 SDKYFEAFRRSLEDPEEFWAEVGNTVHWSKRWTKVLDNTDQPFTKWFVGGELNACYNAVDRHVEAGKGNKVALIHDSPVTKSVRRVTYRELQLQVSLLAGALV-KLGVKKGDRVLIYMPLIPEAIISMLATVRIGAVHSVVFGGFAARELCMRIDHAEPKVIIGASCGVEPTKIVKYKDILNEAIEVAQVKPSKCIIFQRRNVFEAELTPGMDILWDDALNLSKPHPCVPVEANDPLYILYTSGTMGQPKGILRPTGGHIATLAWTMSAIYGMNGDDVWWTASDMGWVVGHSYICYGPLCAGITSVMYEGKPDRTPDSGQYFRVIRDHQVNAILTAPTALRVIRREDPEVRVGRKYPSKSLRHLFVAGEHFDHETKSWAEQVFKVPILNHWWQTETGHSITANCIGLGHNPSPPKYSAGMPFPGYDVRILRSD-GSECDCHELGRIVVKLPLPPGVMATLYKATQRFLEVYFSTYPGYYDTMDAGYRDEYGYIYVTARDDDVINVAGHRLSTSALEDVVMSHQDIVDAAVVGVPEPTKGEIPICLYIIRKGCEKSEEKISRELIRRVRELIGPIAAFRLSAAVTGLPRTRSGKIARKSISDLARNLQIKIPGTIEDPTVYKEIKRVLQKLGYAKTAP 675          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: W5NHM2 (Acyl-CoA synthetase short chain family member 3 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 1.835e-155
Identity = 233/626 (37.22%), Postives = 364/626 (58.15%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQL--KLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIK 1923
            Y+E  + S+  P   W   A+ + W KP+++ +   + P PKWFVGG++N+ YN +D+H   G GD  AIIY+  +T + +  TY ++L  V +LAGV+  K  + KGD V++Y P+  Q M AMLAC RIGA + +IF GFA   ++ R+ H +PK+V+T +   EPG  + Y   VEKA ++ +  P   L+YNRPN     M      +W+ E+  A PH  VP+ S+HP++I YTSGTTG PKG V  TG   V   + +  V GL   E +W  SD GW+ G + + YGPLL G T +L+EGKPV  P++A    +++++ + +  TAPT  R  R+  P+  L  + P   +R ++V GE  D +   W   IF  P+ + W Q+E G   T   +G       P       +   ++ +V+ D  +E+   T+G +++K P+ P  A T+++N   F++ YFT++PGY+DTMD G +  +  L I+SRSDDVI+++  R+  GA EE  LQ+ ++++ AVV L+D   G VP+A   +R D      +V+ + +  V + +G    F+  V V  LPK ++GKI R +L+ + + + +KI  T+++P V+KEI D+L K
Sbjct:   11 YDEAFRTSLRDPANFWANAAQRITWFKPWSNTLDYSNPPFPKWFVGGKLNICYNAIDRHCESGRGDQTAIIYDSPVTGSKQFFTYSEVLKEVSRLAGVLA-KNGVKKGDLVVIYMPMIPQAMFAMLACARIGATHSLIFGGFASKELSVRVDHAKPKMVVTASFGIEPGRRVEYIPLVEKALELGKHKPERVLIYNRPNMETVSMAPDISLNWDEEMAAANPHDCVPVSSDHPLYILYTSGTTGTPKGVVRDTGGCAVMLNWTMASVYGLSPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAAAYFRLISEHGVTAMFTAPTAIRAIRQQDPQASLGRQYPLTRMRTLFVAGERCDVETLDWAKKIFKVPVLDHWWQTESGSPITASCIGLGNSSTPPAGQAGKAVPGYNVMVVD-DNMQEVKPRTLGNIVVKLPLPPGSASTLWQNDDLFVQLYFTRFPGYYDTMDAGFMDEERFLYIMSRSDDVINVAGHRLSTGALEEAVLQHSAVVDCAVVGLEDSLKGHVPLALCVLRNDLQTKEEDVVEEIVRLVRESIGPVAAFRKVVFVNRLPKTRSGKIPRSTLAALVSRKAYKISPTIEDPVVFKEIEDILKK 634          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 265.388 bits (677), Expect = 1.236e-78
Identity = 191/635 (30.08%), Postives = 307/635 (48.35%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKD------KDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQ---FTPAYSLVYNR------------------PNTAPAKMVKGK---DFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGR 1854
            N++EL+  S+  PE+ W ++AKE  W   +T    D      K +   K   G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V + A V+ ++  + KGDRV +Y P+ ++ + AMLAC RIGAV+ ++F+GF+ + +  R+  +   L+IT +  Y     IN K   ++A + C+   F     +V                       + P   V  K   D  W + ++ A+     V  ES  P+FI YTSG+TG+PKG +      ++      K V      + +W  +D GWI+G + +TYGPL  G T +LFEG P   P+ + +  IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +  QW  N+     CP+ + + Q+E G     PL      +P      P   V   I+N ++GEEL     G ++ K P  P    T++ NHQRF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D     + + A+   QV +K+G+          P LPK ++GKI+R  L ++A+ +
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPG-SATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTL-ADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQ 657          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 260.381 bits (664), Expect = 1.217e-76
Identity = 193/651 (29.65%), Postives = 310/651 (47.62%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKD------KDKPIPKWFVGGEINMSYNCLDKHVLDG-YGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQ---FTPAYSLVYNRPN------------TAPAKMV---------KGK----------------DFDWETEIKTATPHAA-VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGR 1854
            N++EL+  S+  PE+ W ++AKE  W   +T    D      K +   K   G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V + A V+ ++  + KGDRV +Y P+ ++ + AMLAC RIGAV+ ++F+GF+ + +  R+  +   L+IT +  Y     IN K   ++A + C+   F     +V    +            + PAK           KG                 D  W + ++ A+     V  ES  P+FI YTSG+TG+PKG +      ++      K V      + +W  +D GWI+G + +TYGPL  G T +LFEG P   P+ + +  IV+KY +  F TAPT  R+  K   +   K     L+ +   GE  + +  QW  N+     CP+ + + Q+E G     PL      +P      P   V   I+N ++GEEL     G ++ K P  P    T++ NHQRF  +YF K+PGY+ T D      DG   I  R DD++++S   +     E   ++++++  AAVV    P  G+    F+ +  D     + + A+   QV +K+G+          P LPK ++GKI+R  L ++A+ +
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQQEKQKGNVRKVRSIPKVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPG-SATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTL-ADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQ 673          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000043882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:22941:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000043882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.054 bits (632), Expect = 2.692e-73
Identity = 123/306 (40.20%), Postives = 176/306 (57.52%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFE 981
            YE   + +   PE+ W E A+ V W   +   +       P+WFVGGE+NM YN +D+HV  G G+  AII++  +T + +  TY+++   V +LAGV+V K  + KGD V++Y P+  Q M  MLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   VEKA ++    P   L+YNRP      M  G   DW+ E+ TA P   V + S+HP+++ YTSGTTG PKG V  TG   V   + +  V GL   E +W  SD GW+ G + + Y PLL G T +L+E
Sbjct:  167 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMERVAMSSGLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 471          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic-like [Source:NCBI gene;Acc:107197877])

HSP 1 Score: 245.358 bits (625), Expect = 2.667e-71
Identity = 184/623 (29.53%), Postives = 297/623 (47.67%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVI------KDKDKPIPKWFVGGEINMSYNCLDKHVLD-GYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFD-------------WETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMAN 1848
            +Y  L+K SI  PE+ W ++A+E  W +P +  +        K K   K+  G + NM YN LD++VLD   G  VA  +E    +    ITY QLL  V + A  +  +  + KGDRV +Y P+  + + +MLAC RIGAV+ ++F+GF+ + +A R+   +  +++T +  Y     I  K+  ++A   C+   + ++         A  + G D               W  E          P  +E+  P+FI YTSG+TG+PKG +      ++      KYV    R + +W  +D GWI+G + +TYGPL  G T +LFEG PV+ P+      I+ KY +  F TAPT  R+  K   E   K     LR +   GE  + +   W  +      CP+ + + Q+E G     PL      +P     LP   V L I+ ++ GEEL  E  G ++ + P  P     +Y N +RF  +YF K+PG++ T D      DG   I  R DD++++S   +     E    ++ ++  AAVV       G+    F+ ++  +  N++ ++ +   +V +K+G           P LPK ++GKI+R  L ++A 
Sbjct:   31 SYLALYKKSIEEPEEFWRDVAQEFYWKEPPSGQMLQYNFDATKGKVYVKFMEGAKTNMCYNVLDRNVLDRNLGSRVAFHWEGNSPDHHMTITYSQLLKQVCRCANAL-KQMGVKKGDRVAIYLPMIPELVYSMLACARIGAVHSIVFAGFSSESLAERIMDAQCTVLVTADGVYRGDKLIKLKQISDEALDHCREKNSLTVRKCLVVKHHAFRIHGNDTCNKLQTLWNAECDVWWDEAVEGVSDECDPEWMEAEDPLFILYTSGSTGKPKGVLHTIAGYLLYTSLTFKYVFDHHRDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGIPVH-PHVGRFWEIIEKYRVSKFYTAPTAIRLLMKYGREPLSKYDLSSLRVLGTVGEPINPEAWLWYHDAVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPG-SATLPFFGV-LPIILNEHGEELEGEAEGYLVFQKPW-PGIMRGVYGNQERFENTYFKKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTSEVEAALSEHSAVAEAAVVSRPHTIKGECLYCFVTLKDCREFNHT-LLEELKRKVREKIGPIATPDFIQNAPALPKTRSGKIMRRVLRQIAR 647          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000036840.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:23509:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000036840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.195 bits (609), Expect = 4.148e-71
Identity = 121/306 (39.54%), Postives = 175/306 (57.19%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFE 981
            YE   + +   PE+ W E A+ V W   +   +       P+WFVGGE+NM YN +D+HV  G G+  AII++  +T + +  TY+++   V +LAGV+V K  + KGD V++Y P+  Q M  MLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   VEKA ++    P   L+YNRP      +      DW+ E+ TA P   V + S+HP+++ YTSGTTG PKG V  TG   V   + +  V GL   E +W  SD GW+ G + + Y PLL G T +L+E
Sbjct:   68 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMVRPCL----GLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 368          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006895.1 (pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-1 gene:ENSPMAG00000006232.1 transcript:ENSPMAT00000006895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 320.857 bits (821), Expect = 1.040e-102
Identity = 172/477 (36.06%), Postives = 261/477 (54.72%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDI-VSFGTAPTVFRIFRKMCPEEQLKLPY------KHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKY 1461
            Y+   KL+ + PE+ W E AK V W+K +  V+ D   P  +WFV G++NM YN LD+HV  G GD  AII++  +T   + ITY+Q L+ V +LA V+V K  + KGDRV++Y P+  Q M AMLAC RIGA++ +IF GFA   +A R+ H +  +V++ +   EPG  + YK  +E A  I    P   LVY+RP  A A ++ G+D  W+ E+  A PH  VP+ S+HP++I YTSGTTG PKG V  TG   V   + +  + GLK  E +W  SD GW+ G + + YGPLL G T +L+E  P   P       +  K+ + + F  +P    I   M   + L   Y         R+++V GE+ D +   W    F+ P+ + W Q+E G   T    G       P       +   D+R+V+S+  +E  +  +G +++K P+ P    T+++N+Q++  +YF  +
Sbjct:    1 YDAAFKLAKSEPERFWAEAAKGVAWTKSWDRVLDDSKSPYTRWFVDGQLNMCYNALDRHVEAGRGDQAAIIHDSPVTGIIQTITYRQALSEVTRLASVLV-KNGVQKGDRVVIYMPMIPQAMFAMLACARIGAIHSLIFGGFASKELAVRINHAKVSMVLSASFGIEPGRQVAYKPLLEAALDIATHKPEKVLVYSRPGMARASLIPGRDMCWQEEVSAAKPHDCVPVSSDHPLYILYTSGTTGAPKGVVRPTGGHAVMLNWSMSAIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEPAPPVSPPPKVFYEVDEKHGLNLCFIPSPRSHYISLPMSNPQLLYHLYIKTPCVPRFRSMFVAGEICDKETLNWGKATFNVPLLDHWWQTETGSAITATCTGLGGSLYPPAGQCGKSVPGYDVRVVDSNN-QESKRGNLGNIVVKLPLAPGCMATLWENNQKYEDTYFKSF 475          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 172.17 bits (435), Expect = 1.743e-47
Identity = 119/396 (30.05%), Postives = 189/396 (47.73%), Query Frame = 1
Query:  682 KGKDFDWETEIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMAN 1848
             G+D  W  E+         P   ++  P+F+ YTSG+TG+PKG +  T   ++      K V  ++ ++ +W  +D GWI+G + + YGPL  G T +LFEG P   P++      V KY +  F TAPT  R+  K      LK   + LR +   GE  + +   W+  +     CPI + + Q+E G     PL G    +P     LP   V+  I++ + GEEL  E  G ++ K P  P    T++ +H+R   +YF K+PGY+ T D      DG   I  R+DD++++S   +     E   L + S+  AAVV       G+    F+ +     +N   + A+   +V +K+G           P LPK ++GKI+R  L ++A 
Sbjct:   10 SGRD-SWWHELMCGASTTCEPAWCDAEDPLFVLYTSGSTGKPKGVLHTTAGYLLFVATTHKLVFDIRPQDVYWCTADIGWITGHSYIVYGPLANGVTSVLFEGIPTF-PDAGRFWQTVEKYAVSKFYTAPTAVRLLMKHGDAFVLKHSRRSLRVLGTVGEPINREAWHWLHGVVGGGRCPIVDTFWQTETGGHVLTPLPGATPLKPG-SATLPFFGVEPAILD-ERGEELRGEAEGFLVFKRPW-PGILRTVFGDHERLEATYFGKFPGYYATGDGCRRDKDGYYWITGRTDDMLNVSGHLLSTAEVESALLSHGSVAEAAVVGRPHALKGESLYCFVTLNHGLELNPC-LAAELKKRVREKIGPIATPDFIQSAPSLPKTRSGKIMRRLLRKIAQ 399          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002799.1 (pep scaffold:Pmarinus_7.0:GL484478:769:8847:-1 gene:ENSPMAG00000002554.1 transcript:ENSPMAT00000002799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.397e-8
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 1
Query:   52 LSLNYEELHKLSITHPEKVWDELAK--EVVWSKPYTSVIKDKDKPI---PKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFP 411
            L+ NY ELH+ S+ +  + W    K   +V S PY  V+ D  K I   P+WF G  +N + N L +    G  + VA+           K+T+ +L + V   A  M  K  I KGDRV    P
Sbjct:    4 LAANYAELHQWSVENYAEFWGVFWKFSGMVHSVPYDEVV-DTSKTIADVPEWFRGSRLNFAENLLHR----GDAEKVALYAAVEGGEEVSKVTFGELRSDVALYAAAM-RKLGIGKGDRVAGMIP 122          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005866.1 (pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gene:ENSPMAG00000005307.1 transcript:ENSPMAT00000005866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.573e-8
Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  307 KITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFA 492
            +ITY++LL  V + + V+++   + KGDRV +Y P+  + + AMLAC R+GAV+ ++ S  A
Sbjct:   37 QITYKELLDQVCKCSNVLLSH-GVGKGDRVAIYMPMITELVVAMLACARVGAVHSIVVSSRA 97          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 313.923 bits (803), Expect = 1.433e-97
Identity = 201/640 (31.41%), Postives = 321/640 (50.16%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVV-WSKPYTSV-IKDKDKPIPK-----WFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPA--YSLVYNRPNTAPAKMVKGKDFDWETEIKT-ATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIF---SCPIYNLWGQSELGPVATGPLLGFKRPNY--DLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNS------EVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIP--VTVDNPQVYKEIYD 1911
            +Y+ LHK SI  P K +   A + + WSKP+  V I D     P      WF+ G++N  YNC+D+H L    +  AII+E         ITY++LL  V Q+A V+     + KGD V +Y P+  + +  +LA +RIGA++ V+F+GF+ + +  R+   + K+VITT+ +   G  I  K  V+ A    + TP   + LVY + N         +D DW TE K   T +   P++S  P+F+ YTSG+TG PKG    T   ++     ++Y     +++ F+   D GWI+G T + YGPLL GC  ++FEG P   PN +   +I++++ +  F  APT  R+ ++           K LR +   GE   +++ +W S        PI + + Q+E G     PL G   P        P   +D  +++ +TGEEL       VL      PS A TI+KNH R+L +Y   YPGY+ T D      DG + IL R DDV+++S  R+     E   +++  +   AVV  +D   GQ   AF+ ++   + + +      ++    +  V K +G F   K  ++V +LPK ++GKI+R  L ++  G   ++    T+ NP + + + D
Sbjct:   75 DYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFIPDPKTGRPSFQNNAWFLNGQLNACYNCVDRHALKT-PNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVLTYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRGGKVIETKRIVDDA---LRETPGVRHVLVYRKTNNPSVAFHAPRDLDWATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPA-YPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLID 709          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 298.516 bits (763), Expect = 6.580e-92
Identity = 197/636 (30.97%), Postives = 317/636 (49.84%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVV-WSKPYTSVIKDK-DKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEI-KTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIF---SCPIYNLWGQSELGPVATGPLLGF--KRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNS-----------EVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIP--VTVDNPQVYKEI 1905
            +Y+E+++ SI  PEK +D++AKE + W  PYT V     +     WF+ G++N SYNC+D+H      D  A+IYE    +  + IT+ +LL  V Q+AGV+     + KGD V +Y P+  + + AMLA  RIGA++ V+F+GF+   +  R+     K+VIT +     G TIN K+ V++         +  LV+ R  T    M  G+D+ W  E  K  T    V  ++  P+F+ YTSG+TG PKG V  TG  ++      +YV  +  ++  +   D GWI+G T   YGPL +G   I+FE  P   P+      I+ ++    F  APT  R+ +++   E  K     LR +   GE    DL +W        +C I +   Q+E G     PL G    +P     +P   ++  I++  TG EL    V  VL      PS A +++ +H R++ +Y   YPG++ T D     +DG   I  R DDV+++S  R+     E     ++++  AAVV + D   GQ  +A++ ++     NN+            +  + I QV  ++G F   K  ++V +LP+ ++GKI+R  L ++A+    ++    T+ NP+V   I
Sbjct:   39 HYQEMYQQSINEPEKFFDKMAKEYLHWDAPYTKVQSGSLNNGDVAWFLNGKLNASYNCVDRHAF-ANPDKPALIYEADDESDNKIITFGELLRKVSQIAGVL-KSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEGLNGVDLV-SRILVFQRTGTEGIPMKAGRDYWWHEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPA-YPDYGRYWRIIQRHKATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPG-SATVPFFGINACIIDPVTGVELEGNDVEGVLAVKSPWPSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITPDNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLRKVASNEAEQLGDLTTLANPEVVPAI 669          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 57.3806 bits (137), Expect = 4.135e-9
Identity = 66/271 (24.35%), Postives = 110/271 (40.59%), Query Frame = 1
Query: 1033 KYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLL--GFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSE 1839
            KY+   F   PT+  I   M P+     P+ H+R I              +   F+ P+   +  +E     T   L  G ++P        +TV   ++  D    LP   VG V ++      G    Y N+ +  K  FTK   YF T D G    +G L +  R  ++I+    +I     + + L +  +  A    + D   GQV  A + ++K + +   E+    ++ + K + SF +      V +LPK  TGKI R  ++E
Sbjct:  276 KYNCNWFSCVPTISMIMLNM-PKPN---PFPHIRFIRSCSSALAPATFHKLEKEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQGVTV---VILDDNDNVLPPGKVGEVSIRGENVTLG----YANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAIVLKKGEKMTYEEL----VNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRRVIAE 531          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 46.9802 bits (110), Expect = 9.815e-6
Identity = 80/331 (24.17%), Postives = 133/331 (40.18%), Query Frame = 1
Query:  769 INYTSGTTGEPKGFVMGTGNSIV----TDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVG--------------CTIILFEGKPVNKPNSAEV-----ANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLP---------YK--------HLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLP-ILT--VDLRIVNSDTGEELPKETVGRVLLK-TPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIH-ISAARICGGAFEEVCLQNDSLLNAAV 1626
            I YTSG+TGEPKG V+   N +          LK+VG   R  CF  L+    +  + L  Y    +G              C   L E KP      A V       I+N+ D + F T    +  +      ++L +P         +K         LR +  GG     D +++I+N+  CP+   +G +E    A+  +L     N++L +   LT  V +++V+ +      K   G V +    + P      YKN +   ++  +   G+F T D G    +G L+I+ R  +++  ++   I     E V   N+ + N  V
Sbjct:  267 IMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELLSFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLTKKIFWTAYNTKLNMQRLHIPGGGALGNLVFKKIRTATGGQLRYLLNGGSPISRDAQEFITNLI-CPMLIGYGLTE--TCASTTIL--DPANFELGVAGDLTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPE----YYKNEEETSQALTS--DGWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSNEYVANICV 586          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO49293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH51])

HSP 1 Score: 473.396 bits (1217), Expect = 1.197e-158
Identity = 234/633 (36.97%), Postives = 371/633 (58.61%), Query Frame = 1
Query:   55 SLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPY--KHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPL-----PILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGY 1932
            +  Y+E  K S+  PE  WD++A+ + W KPYT V+ +   P  KWF GGE+N  +NCLD+H+ +G G  +A+IY+  ++   E  +YQ L  LV + AG + N  ++ KGDRV++Y P+  Q + AMLAC RIGA++ V+F GFA   +A R++H EP++++T +   EP   + YK  V++A KI  F P+  ++Y R +     ++ G+D  W+  ++ A PH  VP+ +  P++I YTSGTTG+PKG V   G   V   + +K + G+   E +W  SD GW+ G + + Y PL  GCT +LFEGKPV  P++     ++ ++ ++S  TAPT  RI R   P+ +L   Y   H R +++ GE  D D  QW     S P+Y+ W Q+E G   T   +G  RP  D  L      +   +++I+  D   E  +  +G++ +K P+ P    T+++  +RF K+YF KYPGY+D+ D G++  DG + I++R+DDVI+++  RI   + EE  ++   +++AA + L D   G VP+ F+ V K  ++   ++I +    V + +G    FK AVIVP LPK ++GK +R  L+++ +G  +K+  T+DNPQ   +I DVLI  GY
Sbjct:   54 AYTYDEAFKQSVEDPEGFWDDVAQGIDWYKPYTKVVDNATPPFTKWFPGGELNTCFNCLDRHIENGIGGRIALIYDSPVSGKIEMYSYQNLQRLVAKFAGAL-NSLNVGKGDRVVIYMPMVPQAVIAMLACARIGAIHSVVFGGFAAAELARRIEHAEPRVIVTASCGIEPSRIVTYKPLVDEAIKISSFKPSTVVLYQR-DQCTGDIIPGRDITWDQVMERAEPHDCVPVLATDPLYILYTSGTTGDPKGIVRRNGGHAVALNWSMKNIYGVNPGEVWWAASDLGWVVGHSYIVYAPLFNGCTTVLFEGKPVGTPDAGAFFRVIEQHKVISMFTAPTAIRIIRTEDPKAELIRQYDLSHFRDMFLAGEHLDKDTMQWARRAISAPVYDNWWQTESGWAITAHTVGLGRP-MDEKLETTGKAVPGYNVKILREDM-TEADRGELGQICVKLPMPPGTMGTLWRADERFKKTYFEKYPGYYDSSDAGVMDEDGYVSIMARTDDVINVAGHRISTKSLEEGMMKPSFVVDAACIGLKDGIKGHVPLGFVIVDKTVSMKKEDMIKEVKKSVREFVGPVAAFKTAVIVPALPKTRSGKTVRGILAKIVHGEPYKVTPTMDNPQCLDQIKDVLISEGY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO39135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ3])

HSP 1 Score: 278.87 bits (712), Expect = 5.990e-85
Identity = 184/571 (32.22%), Postives = 286/571 (50.09%), Query Frame = 1
Query:  187 KWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCH-ILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGK-DFDWETEIKTATPHAA--VPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFKRPNYD-------LPL-PILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGR 1854
            +WFVGGEIN+S NC+D H +  + +  A+I+E       E ++Y QL  +V ++A ++  KCH + KGD V LY PV+   +AAMLAC RIGA + V+F+GF+ D +A R+   + + VIT N A   G  I+ K  V+ A      +P    V+    T  A++  GK D   E E     P      P++S  P+F+ YTSG+TG+PKG V      ++  K   KY    K+ + F  ++D GWI+G + + YGPL  G T +LFE  P   P+      +V +  I  F  APT  R+  K       K     L+ +   GE  + +   W +++     C + + W Q+E G +   P     RP  D        P+ P   VD  +V+ + G+EL    V   L      P    TIY +H+RFL +Y+  YPGY+ T D  +   DG  +I  R DDV+++S  R+     E+    + ++   AVV    P  G+   A+  ++ D  +   +   +    V +K+G+F + +   +VP LPK ++GKI+R  L ++A  +
Sbjct:   11 RWFVGGEINVSENCVDHH-MRSHPNRTALIWEKDEPGDVEHVSYIQLYGMVNRMANML--KCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRINDAQAETVITANQAVRGGRAIDLKRVVDDAVSK---SPGVKRVFVMKRTG-AQVPMGKLDIPLE-EAMAEQPDECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDVFGCVADIGWITGHSYVVYGPLANGATTVLFESTP-TYPDPGRYWEMVERLRINQFYGAPTAIRLLLKSGNSWVEKYDRSSLKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGGILISP-----RPAPDNSPVKPEFPMRPFFGVDPVLVD-EKGKELTGNNVTGALCFRSSVPGMCRTIYGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMDNHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEIIQVVPGLPKTRSGKIMRRILRKVAQDK 566          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO42084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2B4])

HSP 1 Score: 265.774 bits (678), Expect = 3.313e-79
Identity = 196/656 (29.88%), Postives = 313/656 (47.71%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTS--VIK-----DKDKPIPKWFVGGEINMSYNCLDKHVLD-GYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQ---FTPAYSLVYNRPNTAPAKMVKGK----------------DFD-----WETEI--KTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFKRPNYDLP-LPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMA-NGRVWKIPVTVDNPQVYKEIYDV 1914
            Y+  +K SI  P   W E+A +  W  P  S   +K     D      KW  G + N+ YN LD++V D G GD VA  +E  +   T++ITY +LL  V + A V+ +K  + KGDRV +Y P+ ++ + AMLAC R+GAV+ ++F GF+ + +A R+  +  K++IT + +Y     IN KE  + A   C+   F     +V    +  P K V                    FD     W  E+  + +  H  V +++  P+F+ YTSG+TG+PKG +   G  ++      +Y       E +W  +D GWI+G + +TYGP+  G   +LFEG P   P+     +IV+KY +  F TAPT  R   K   E       + L+ +   GE  + +   W  ++     C I + + Q+E G     PL G  R        P   V+  IV+ + G EL     G +++K P  P  A TIY NH+RF   YF K+ GY+ T D      +G   +  R+DD +++S   +     E   +++D++  AAVV       G+    F  + ++  ++  ++I +   +V  K+G F         P LPK ++GKI+R  L ++A N R      T+ +P V   +++ 
Sbjct:   33 YKARYKQSIEDPAGFWGEVASDFFWKVPPKSDHFLKYNFDLDNGSVDIKWMQGAKTNICYNVLDRNVHDKGLGDTVAFYWEGNVPGDTKQITYGELLKQVCKFANVLESKG-VKKGDRVAIYMPMIMELVIAMLACARLGAVHSIVFGGFSAESLAERILDSTCKILITADASYRGLKMINLKEIADHAIIKCRERSFNVEACIVVR--HLGPDKRVPTDPSSSPPPKRPCHQLQTSFDSSIDCWWHEVMAEASDEHDTVWVDAEDPLFMLYTSGSTGKPKGVLHTHGGYMLYTALTFRYSFDYHPGEVYWCTADIGWITGHSYITYGPMANGAISVLFEGTPF-YPDCGRFWDIVDKYKVSKFYTAPTAIRSLMKFGKEIVTSHNLESLKVLGTVGEPINPEAWLWYYHVVGHNKCAIVDTYWQTETGGHVITPLPGATRTRPGAATFPFFGVEPAIVD-EKGNELEGPCEGFLVIKRP-WPGMARTIYGNHKRFENVYFDKFRGYYTTGDGCKRDENGYYWVTGRTDDCMNVSGHLLSTAQIESALVEHDAVSEAAVVSCPHKEKGEGIYCFATLMENVELDE-KLIRELKQKVRLKIGPFASPDVIQSAPALPKTRSGKIMRRVLRQVAKNDRQTGDLSTIYDPAVVDSLFEA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO37374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG02])

HSP 1 Score: 110.153 bits (274), Expect = 4.188e-25
Identity = 122/525 (23.24%), Postives = 218/525 (41.52%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDEL--AKEVVWSKPYTSVIKDKDK--PIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAP---------------AKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIF--RKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS-CPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPI-CPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMND-GSLQILSRSDDVIHISAAR 1563
            +YE+L   S+ H  + W+       ++ S+ Y  VI    +   IP+WF G  +N + N     +L G  +D+A+ Y          +T+QQL   V  LA  +  K  I  GDRV+ Y P     + AMLA + IGA++      F    +  R    +PK++ + N     G      + + K   + Q  P    V   P                   + ++K  D   E E K         L  NHP+FI Y+SGTTG PK  V   G +++      K  G + + +     +  GW+    L++   L VG  ++L++G P   P+   + ++V++  I   GT     +    + + P++  +L   H   +  G  L  +       +I S   + ++ G +++  +  G   G   P Y   +   ++ + + + +       ++ G ++   P  C         N  ++ K+YFTK+ G +   D+  I +  G + +L RSD  ++ +  R
Sbjct:   35 SYEQLRLWSVNHYAEFWEMFWTFSGIIHSQTYDEVIDTTKRIDEIPEWFHGARMNYAEN-----LLQGKDEDIAL-YTAGENQEVRTVTFQQLREKVAVLASAL-GKLGIKMGDRVVGYIPNCALAVEAMLAASSIGAIWSSTSPDFGVSGVLDRFSQIQPKVMFSVNAVRYNG---KIHDHMAKLDGVVQGLPELEKVVIIPFVGTEEKIEISQIKNSIFLSDLLKLADDRPELEFKQ--------LPFNHPLFIMYSSGTTGPPKCMVHSAGGTLLQHLKEHKLHGNMGKTDIIMYYTTTGWMMWNWLVS--ALAVGAALVLYDGSPF-IPSPYVIWDLVDEIGITILGTGARWLQALEDKHVYPKDSNRLTSLH-TILSTGSPLKPASFDYVYKHIKSDLLLGSITGGTDIISLFAGHNTGL--PVYRGEIQARSLGMAVESWNEEGVSVYDSSGELICTKPFPCMPTHFWNDPNGSKYRKAYFTKFKGVWAHGDFCKITSRTGGIVMLGRSDGTLNPNGVR 535          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO44212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW67])

HSP 1 Score: 87.0409 bits (214), Expect = 2.894e-18
Identity = 110/424 (25.94%), Postives = 180/424 (42.45%), Query Frame = 1
Query:  439 LACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVIT--TNIAYEPGTTINYKEQVEKAAKICQFTPAYSLV--YNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPK-----GFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGE-LSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLK-TPICPSGALTIY-KNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFL 1674
            LAC+RIG+V +       P     R K    +L+++    I  +P T     E V++      F  +++L+  ++R    P K +  +          +T H   P  S+    I +TSGTTG PK         G G+SI T KY+L     L   +  W +SD GW        YGP + G ++ +       K  +  + + + KY I +    PT +R+   M  E+  +  +  LR     GE L+   +  W        I   +GQ+E   +         RP   +  P    D+R+++ +   E P    G + +   P  P G  + Y ++++R + +Y   Y   + T D  +   DG L  + RSDDVI  +  RI     E   +++ ++  AAVV   DP  G+V  AF+
Sbjct:   15 LACSRIGSVII-------PGSTQLRSKDILARLLVSRANTIVADPATA----EVVDEVYNKINFL-SFNLIVSFHRKGWLPFKTLYKQ---------ASTVHTCAPTTSDETSIIFFTSGTTGLPKMTQHTHASQGIGHSI-TGKYWLD----LCPDDVHWTVSDPGWAKTAYGCLYGPWIQGASVFIHHT--TEKFEAKVILDHLQKYPISTMCLPPTAYRM---MIHEDLSRYQFPALRHCLSAGEPLNPEVMVDWKEKT-GLDIREGYGQTETTLLCGTFRCIETRPG-SMGKPAPGYDVRVID-EKCNETPAGIEGDIAVYLKPRRPVGLFSEYIEDYERNVSAYRGDY---YLTGDRAVRDEDGYLWFIGRSDDVIISAGYRIGPFEVESALIEHPAVAEAAVVSSPDPVRGEVVKAFV 401          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 439.499 bits (1129), Expect = 3.299e-145
Identity = 224/620 (36.13%), Postives = 352/620 (56.77%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQ--LKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKR----PNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEI 1905
            Y      +   P+  W E   ++ W +P+T  +  +D   P WFVGG +NM YN +D+HV  G G+  AII++  +T T + ITY +L   V +LAGV+V K  + +GD V++Y P+  + M AMLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   V+KA ++    P+  L+YNRPN     +      DW+ E+ +A PH  V L SNHP+++ YTSGTTG PKG V  T    V  K+ +  + GLK  + +W  SD GW+ G + + Y PLL G + IL+EGKPV  P+      +++++   S  TAPT  R  R+  P      K     L++++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  +E+   T+G ++++ P+ P  AL++++N   F K YF+K+PGY+DTMD G +  DG L I+SRSDDVI+++  R+  GA EE  L + ++ + AVV L+D   G +P+A   ++ +      +V  + +  V   +G    FKN + V  LPK ++GKI R SLS + NG+ +K+  T+++P+V+K+I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVID-DQMQEVKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 672          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 419.083 bits (1076), Expect = 5.785e-137
Identity = 215/580 (37.07%), Postives = 336/580 (57.93%), Query Frame = 1
Query:  184 PKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQ--LKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEI 1905
            P+ FVGG +NM YN +D+HV  G G+  AII++  +T T + ITY +L   V +LAGV+V K  + +GD V++Y P+  + M AMLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   V+KA ++    P+  L+YNRPN     +      DW+ E+ +A PH  V L SNHP+++ YTSGTTG PKG V  T    V  K+ +  + GLK  + +W  SD GW+ G + + Y PLL G + IL+EGKPV  P+      +++++   S  TAPT  R  R+  P      K     L++++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  +E+   T+G ++++ P+ P  AL++++N   F K YF+K+PGY+DTMD G +  DG L I+SRSDDVI+++  R+  GA EE  L + ++ + AVV L+D   G +P+A   ++ +      +V  + +  V   +G    FKN + V  LPK ++GKI R SLS + NG+ +K+  T+++P+V+K+I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVID-DQMQEVKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 697          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 405.216 bits (1040), Expect = 2.663e-132
Identity = 221/620 (35.65%), Postives = 337/620 (54.35%), Query Frame = 1
Query:   64 YEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQ--LKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLG----FKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEI 1905
            Y      +   P+  W E   ++ W +P+T  +  +D   P WFVGG +NM YN +D+HV  G G+  AII++  +T T + ITY +L   V +LAGV+V K  + +GD V++Y P+  + M AMLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   V+KA ++    P+  L+YNRPN     +      DW+ E+ +A PH  V L SNHP+++ YTSGTTG PKG V  T    V  K+ +  + GLK  + +W  SD GW+ G + + Y PLL G + IL+EGKPV  P+      +++++   S  TAPT  R  R+  P      K     L++++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   +   V  D  +E+   T+G ++++ P+ P  AL++++N   F K YF+K+PGY+DTMD G +  DG L I+SRSDDVI+++  R+  GA EEV                     + P   + VR  +    +E++    D V    G    FKN + V  LPK ++GKI R SLS + NG+ +K+  T+++P+V+K+I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQ--VSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYN---VIDDQMQEVKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEEV---------------------RNPAFAVCVRDTEEKVRTEIVKLVRDTV----GPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 643          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 395.201 bits (1014), Expect = 4.894e-128
Identity = 207/580 (35.69%), Postives = 324/580 (55.86%), Query Frame = 1
Query:  184 PKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQ--LKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGF----KRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEI 1905
            P+ FVGG +NM YN +D+HV  G G+  AII++  +T T + ITY +L   V +LAGV+V K  + +GD V++Y P+  + M AMLAC RIGA + +IF GFA   ++ R+ H +PKL++T +   EPG  + Y   V+KA ++    P+  L+YNRPN     +      DW+ E+ +A PH  V L SNHP+++ YTSGTTG PK                            +W  SD GW+ G + + Y PLL G + IL+EGKPV  P+      +++++   S  TAPT  R  R+  P      K     L++++V GE  D +  +W    F  P+ + W Q+E G   T   +G       P      P+   ++ +++ D  +E+   T+G ++++ P+ P  AL++++N   F K YF+K+PGY+DTMD G +  DG L I+SRSDDVI+++  R+  GA EE  L + ++ + AVV L+D   G +P+A   ++ +      +V  + +  V   +G    FKN + V  LPK ++GKI R SLS + NG+ +K+  T+++P+V+K+I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPK---------------------------IWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVID-DQMQEVKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101172107])

HSP 1 Score: 268.47 bits (685), Expect = 7.356e-80
Identity = 193/623 (30.98%), Postives = 296/623 (47.51%), Query Frame = 1
Query:   61 NYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFV------GGEINMSYNCLDKHVLD-GYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYK----EQVEKAAKI--CQFTPAYSLVYNRPNTAPAKMVKGKDFDWET-------EIKTATPHAAVP--LESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFS---CPIYNLWGQSELGPVATGPLLGFK--RPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMAN 1848
            +Y E+++ S+  PE  W E+A E  W KP T  +   +  + K  V      G + NM YN LD+HV +   G+ VA  +E         ITYQQLL+ V + A V+  K  + KGDRV +Y P+  + +  MLAC RIGAV+ ++F+GF+ + +  R+   +  +++T +  Y     IN K    E +EK  +   C  T    + +  P T    +       W+T       E    +P    P  L++  P+FI YTSG+TG+PKG +  T   ++      KYV      + +W  +D GWI+G + +TYGPL  G T +LFEG PV  P+      I+ KY +  F TAPT  R+  K   E   K     LR +   GE  + +  QW   +     CP+ + + Q+E G     PL      +P      P   V+  I+N    E    E  G ++ + P  P    T+YKNH+RF  +YF K+PG++ T D      DG   I  R DD++++S   +     E    Q+ ++  AAVV       G+    F+ + KD    N +++ +   QV  ++G           P LPK ++GKI+R  L ++A 
Sbjct:   28 SYLEIYRKSLEDPEAFWKEVADEFFWKKPATGPMLQYNFDVTKGSVYIKCMEGAKTNMCYNVLDRHVKERNLGEKVAFHWEGNSPEHHLTITYQQLLSRVCRCANVL-KKMGVKKGDRVSIYLPMIPELIYTMLACARIGAVHSIVFAGFSSESLCERIMDAQSSVLVTADGVYRGEKLINLKQISDEALEKCGEKAPCSVTKCLVVNHQAPRTNSGTLCNKLLTPWDTKRDLWWDEAMADSPEECEPEWLDAEDPLFILYTSGSTGKPKGVLHTTAGYLLYTSLTFKYVFDHHHDDVYWCTADVGWITGHSYITYGPLANGATSVLFEGVPVY-PHVGRFWEIIEKYRVNKFYTAPTAIRMLMKYGQEPLQKYDLSTLRILGTVGEPINPEAWQWYYEVVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPG-SATFPFFGVEPTILNEHGEELE-GEAEGYLVFRRPW-PGIMRTVYKNHERFESTYFRKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLMSTAEVEAALAQHPAVSEAAVVGRPHKVKGECLHCFVTL-KDCKEFNQKLVEELKKQVRDRIGPIATPDFIQNAPALPKTRSGKIMRRILRQIAR 644          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043641.1 (SMESG000043641.1)

HSP 1 Score: 1211.05 bits (3132), Expect = 0.000e+0
Identity = 597/635 (94.02%), Postives = 597/635 (94.02%), Query Frame = 1
Query:   49 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 1953
            MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSA                             E QL        AIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID
Sbjct:    1 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSA-----------------------------ERQL--------AIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 598          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043642.1 (SMESG000043642.1)

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 459/635 (72.28%), Postives = 536/635 (84.41%), Query Frame = 1
Query:   49 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 1953
            ML  NYE+++KLSI+ PEK+WDELAKEV+W+KPYTSVIK++D PIP WF GGEINMSYNCLDKHVLDGYGDDVAIIYECT+T+T+E++TYQQLLTLVE LAGVMVNKCH+ KGDRVLLYFPVTIQG+AAMLACTRIGAVYVVIFS   PDLIA ++  TEPKLVITTNI YEPG TI YKE VE A K+ QF P Y LVYNR NT PAKMV GKD DWETEIKTATPHAAVPLESNHPM+I YTSGTTGEPK  VMGTGNSIVTDKYFLKYVGG++RK+CFWM SDFGWISGQTLMTYGPLLVGCT+IL+EGKP+ K    EVA I+N++++  FG+ PT FRI +K+C E  +KLPYK L+ I +GGE S+++LRQWIS IFS PI+N+WGQSELGP+ TG   G+ RPNYD  +P  +++ +I+NS T E+LP  TVGR++LKTPI PS ALTIYKNHQ++L  +FTKYPGYFDTMDYGM+ +DGSLQ+LSRS+ +I IS+  ICGG  EEVCLQN+ LLNAAVVPLDDP  GQVPIAFLEV+ DK + N+EVI   I+ VTKK+G F  FKNAVIVPELPKN+ GK+LRYSL  MANG+ W +PV V+ P V+KEIYDVLI AGYKA+LP++
Sbjct:    1 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLSRSESIIEISSTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITNNEVIENIIELVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLE 635          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 399/635 (62.83%), Postives = 499/635 (78.58%), Query Frame = 1
Query:   49 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 1953
            M  LN+ +L++LSI+ PEKVWDEL  EVVWSKPYTSVIKDKD PIPKWF GGEINMSYNCLDKHVLDGYGDDVA+IYEC + N TEK++Y+QLLTLVE LAGVMVNKCH+ KGDRVLLY PVT+QG+AA+LACTRIGAVYVV F GFAPDLIA R+KHTEPKL+ITTN  YEP  T+NYKE V++A    QF P Y +VYNRPNT  A M+  +D DWETEI  ATP+A V LES  P+FI YTSGT GEPKG VM  G  IV++KYF+KYV GL R++C+WM  D+GWISGQT MT+GPLL+GC+ IL+EGK ++  +   +  I+++ ++  F  APT FR  +    E+ +K     LR + +GGELS++ L++W+SN+F CP+Y+LWGQ+ELG +ATGP LGFK  + +   P+L+V  ++VNS TGE LP ET+GR+LLK P+CPS A ++YK+H RFLK+YF+KY GY+DTMDYGMI NDG+LQIL+R+DDVI +SA RICGGA EEVCL N+ L NAA V L+DP  GQVP AFLE +KD+ +NN  +I +++  V K++GSFTLF   V+V +LPK KTGKILR +L  M NG+ WK P TV+NP+V++EIY +LI+AGYKA+LP D
Sbjct:    1 MFDLNFADLYELSISQPEKVWDELGNEVVWSKPYTSVIKDKDSPIPKWFDGGEINMSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISSNGLSPMLSVHPKVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLPND 635          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 357/580 (61.55%), Postives = 452/580 (77.93%), Query Frame = 1
Query:  214 MSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 1953
            MSYNCLDKHVLDGYGDDVA+IYEC + N TEK++Y+QLLTLVE LAGVMVNKCH+ KGDRVLLY PVT+QG+AA+LACTRIGAVYVV F GFAPDLIA R+KHTEPKL+ITTN  YEP  T+NYKE V++A    QF P Y +VYNRPNT  A M+  +D DWETEI  ATP+A V LES  P+FI YTSGT GEPKG VM  G  IV++KYF+KYV GL R++C+WM  D+GWISGQT MT+GPLL+GC+ IL+EGK ++  +   +  I+++ ++  F  APT FR  +    E+ +K     LR + +GGELS++ L++W+SN+F CP+Y+LWGQ+ELG +ATGP LGFK  + +   P+L+V  ++VNS TGE LP ET+GR+LLK P+CPS A ++YK+H RFLK+YF+KY GY+DTMDYGMI NDG+LQIL+R+DDVI +SA RICGGA EEVCL N+ L NAA V L+DP  GQVP AFLE +KD+ +NN  +I +++  V K++GSFTLF   V+V +LPK KTGKILR +L  M NG+ WK P TV+NP+V++EIY +LI+AGYKA+LP D
Sbjct:    1 MSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISSNGLSPMLSVHPKVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLPND 580          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043652.1 (SMESG000043652.1)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 308/633 (48.66%), Postives = 446/633 (70.46%), Query Frame = 1
Query:   49 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCPEEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLP 1947
            M +L++E+L+ LS+  PEK+WD LA EVVW K Y++VI  +  P+PKWF  G+INMS+NCLD+H+ DG GDD+A+I+E  +T T +KITYQ LL  VE+L+GV+ ++C+   GDRVLLYFPV  Q + AMLAC+RIG +Y VI+ GF  + +A R++H EPK+++T+N+ ++   T++YK+ V++A +I QF   Y +VYNR N   A M+  +D DWETE+  A P   +P+ES+HP+FI Y+SGTTGEPKGFVM TG +IVTDKY +KY+  +K KE FWM SDFGWI+GQT+M+YGPLL+GCT IL+EGKP   PN  E+A I+N++++ SF  +PT+FRI +        K+   +LRAIY+ GE SDS+L +WIS+ F+CP+Y++WGQ+EL  V T P L F +P   +P+P+  +  +++  +   E+  +  G +LL   + P  A T++K+ +R++++YFT Y G++DT D G +  +G L+ILSRSDD+I +++ R CGGA EE+CL+N  L++AAVV +D+   GQVP  FL  RKD  VN  +++ KT + V          +N + V +LPK  T KI R SLS M N +++KIP TV+N  VY++IY+ L +AG +A+LP
Sbjct:    1 MWNLSFEKLYDLSLKEPEKLWDSLASEVVWDKKYSAVINHRSSPLPKWFFEGKINMSFNCLDRHINDGRGDDLAVIFESPVTRTVQKITYQSLLESVEKLSGVLADRCNTKAGDRVLLYFPVIPQCLIAMLACSRIGVIYTVIYGGFPAEEVADRIRHIEPKIILTSNVGFDGYNTVDYKQIVDEAIEISQFDVEYCVVYNRGNYPMASMIDIRDLDWETEMMYAVPQRWIPMESDHPLFIIYSSGTTGEPKGFVMTTGAAIVTDKYTIKYLLNIKSKETFWMFSDFGWITGQTVMSYGPLLMGCTTILYEGKPATTPNPQEMARIINEHNVASFMASPTIFRILKNYESIPTFKITINYLRAIYIAGEKSDSNLIRWISDAFNCPVYDIWGQTELNGVVTSPALYFGKPVNSVPVPMFGIKPKLIYPNP--EILGDAFGEILLTAGLSPVFAETLFKDDKRYIETYFTTYQGFYDTKDCGRMTEEGGLEILSRSDDIIKVNSMRFCGGAIEEICLKNHELVSAAVVGVDNEENGQVPFGFLVKRKDSNVNEKDIMNKTKELVKHHYNGLARLENLIFVADLPKTNTHKISRCSLSAMLNRKIFKIPPTVENRNVYQDIYETLRQAGIEASLP 631          
The following BLAST results are available for this feature:
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS32.131e-15837.30acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS35.826e-15537.14acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS11.908e-8531.35acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS27.364e-8030.58acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS22.416e-7830.28acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-198.824e-5626.79Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-198.824e-5626.79Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-199.773e-5626.79Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
sur-51.505e-2119.91Acetoacetyl-CoA synthetase [Source:UniProtKB/Swis... [more]
sur-51.505e-2119.91Acetoacetyl-CoA synthetase [Source:UniProtKB/Swis... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64321.235e-13933.59gene:FBgn0039184 transcript:FBtr0346110[more]
CG64321.235e-13933.59gene:FBgn0039184 transcript:FBtr0084606[more]
AcCoAS1.046e-7929.28gene:FBgn0012034 transcript:FBtr0333126[more]
AcCoAS1.046e-7929.28gene:FBgn0012034 transcript:FBtr0078413[more]
AcCoAS7.490e-5928.54gene:FBgn0012034 transcript:FBtr0078414[more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss39.403e-14936.54acyl-CoA synthetase short chain family member 3 [S... [more]
acss33.527e-13935.20acyl-CoA synthetase short chain family member 3 [S... [more]
acss11.506e-9532.75acyl-CoA synthetase short chain family member 1 [S... [more]
acss29.933e-8030.16acyl-CoA synthetase short chain family member 2 [S... [more]
acss24.641e-7729.41acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS32.562e-16137.92acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.545e-15637.99acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS32.072e-15438.26acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS34.418e-15137.42acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS33.963e-14937.17acyl-CoA synthetase short chain family member 3 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acss38.930e-15536.35acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss31.067e-10137.78acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss11.084e-8431.14acyl-CoA synthetase short-chain family member 1 [S... [more]
Acss21.971e-7830.18acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss27.457e-7729.69acyl-CoA synthetase short-chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H6R3|ACSS3_HUMAN1.024e-15737.30Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q5REB8|ACSS3_PONAB6.129e-15737.14Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|A0A0G2K047|ACSS3_RAT2.004e-15536.67Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q14DH7|ACSS3_MOUSE6.247e-15436.35Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|A7MB45|ACSS3_BOVIN1.870e-15036.67Acyl-CoA synthetase short-chain family member 3, m... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8V3393.621e-15838.59Acyl-CoA synthetase short chain family member 3 OS... [more]
A0A5G3KCT64.022e-15837.92Acyl-CoA synthetase short chain family member 3 OS... [more]
J7JE352.922e-15736.97PrpE protein OS=Burkholderia cepacia GG4 OX=100984... [more]
A0A1B6EB895.656e-15637.21Uncharacterized protein OS=Clastoptera arizonana O... [more]
W5NHM21.835e-15537.22Acyl-CoA synthetase short chain family member 3 OS... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss21.236e-7830.08acyl-CoA synthetase short chain family member 2 [S... [more]
acss21.217e-7629.65acyl-CoA synthetase short chain family member 2 [S... [more]
ENSAMXT00000043882.12.692e-7340.20pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
acss2l2.667e-7129.53acetyl-coenzyme A synthetase, cytoplasmic-like [So... [more]
ENSAMXT00000036840.14.148e-7139.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006895.11.040e-10236.06pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-... [more]
acss21.743e-4730.05acyl-CoA synthetase short chain family member 2 [S... [more]
ENSPMAT00000002799.12.397e-832.80pep scaffold:Pmarinus_7.0:GL484478:769:8847:-1 gen... [more]
ENSPMAT00000005866.12.573e-840.32pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gen... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ACS11.433e-9731.41Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
ACS26.580e-9230.97Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
PCS604.135e-924.35Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
FAA19.815e-624.17Long chain fatty acyl-CoA synthetase; activates fa... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492931.197e-15836.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391355.990e-8532.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420843.313e-7929.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373744.188e-2523.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442122.894e-1825.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss33.299e-14536.13acyl-CoA synthetase short chain family member 3 [S... [more]
acss35.785e-13737.07acyl-CoA synthetase short chain family member 3 [S... [more]
acss32.663e-13235.65acyl-CoA synthetase short chain family member 3 [S... [more]
acss34.894e-12835.69acyl-CoA synthetase short chain family member 3 [S... [more]
acss2l7.356e-8030.98acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043641.10.000e+094.02SMESG000043641.1[more]
SMESG000043642.10.000e+072.28SMESG000043642.1[more]
SMESG000043645.10.000e+062.83SMESG000043645.1[more]
SMESG000043645.10.000e+061.55SMESG000043645.1[more]
SMESG000043652.10.000e+048.66SMESG000043652.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033927 ID=SMED30033927|Name=Acyl-CoA synthetase short chain family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2052bp
TATATATAATTGAAATTTTTAAATTAATCTCGGATATTTTAATATGATAT
GCTCAGTTTAAATTATGAAGAATTACACAAGCTTTCAATTACGCACCCGG
AAAAAGTTTGGGACGAGTTAGCAAAGGAGGTAGTTTGGAGCAAACCTTAT
ACATCGGTCATAAAGGATAAAGACAAGCCAATTCCGAAATGGTTTGTTGG
CGGAGAAATCAACATGTCTTATAATTGCTTAGATAAACACGTCCTGGACG
GGTACGGAGACGACGTGGCCATTATCTATGAGTGCACAATAACAAACACA
ACTGAAAAAATTACTTACCAACAACTATTAACATTGGTAGAACAATTAGC
AGGGGTGATGGTTAATAAATGCCATATATTAAAGGGTGACCGAGTTTTAC
TATACTTTCCCGTCACAATCCAGGGAATGGCGGCCATGTTGGCGTGCACG
CGGATTGGTGCGGTCTACGTTGTCATATTCAGCGGATTCGCTCCAGATTT
GATAGCAGGTCGAATGAAGCACACTGAGCCTAAACTAGTAATAACAACCA
ACATAGCATATGAACCGGGGACAACTATTAATTACAAAGAACAAGTTGAA
AAGGCTGCTAAAATTTGTCAATTTACCCCTGCTTATTCTCTTGTTTATAA
CAGACCGAATACTGCACCCGCTAAAATGGTAAAAGGGAAAGATTTTGATT
GGGAAACTGAAATCAAAACCGCTACTCCTCATGCTGCGGTTCCACTGGAA
TCCAACCATCCTATGTTTATTAATTATACATCCGGAACGACTGGTGAGCC
CAAAGGATTTGTCATGGGGACTGGAAATTCTATAGTTACTGATAAGTATT
TCTTAAAATATGTTGGAGGATTGAAAAGAAAAGAATGTTTTTGGATGTTA
AGTGATTTTGGATGGATATCTGGCCAAACTCTAATGACCTACGGACCTTT
ACTGGTCGGCTGCACGATTATACTTTTTGAAGGCAAACCAGTAAATAAAC
CAAATTCCGCTGAAGTAGCAAATATTGTAAATAAATATGATATTGTAAGT
TTCGGTACAGCGCCAACTGTGTTTCGAATTTTCCGAAAAATGTGCCCCGA
AGAGCAGTTAAAACTTCCATATAAACATCTAAGAGCAATTTATGTCGGAG
GAGAGTTGTCAGATTCGGATTTGCGACAATGGATTTCGAATATATTTTCC
TGCCCAATATATAACCTATGGGGACAAAGTGAATTGGGCCCAGTAGCAAC
TGGGCCTCTGCTTGGATTCAAGCGACCAAATTACGATTTACCCTTGCCGA
TATTAACCGTAGATTTAAGAATTGTAAACAGTGATACTGGAGAAGAATTG
CCAAAAGAAACTGTTGGAAGAGTTCTACTCAAAACGCCTATTTGTCCGTC
GGGCGCTCTGACAATTTATAAAAATCATCAAAGATTTTTAAAATCATATT
TCACTAAATATCCAGGATACTTTGATACAATGGATTACGGAATGATTATG
AATGATGGCAGTTTACAAATTCTTTCAAGGTCTGATGATGTAATTCACAT
TTCTGCAGCCCGTATTTGTGGAGGAGCCTTTGAAGAGGTTTGTTTACAAA
ACGACAGCTTACTCAACGCAGCAGTAGTACCTTTGGATGACCCGACAGCG
GGTCAAGTTCCAATAGCCTTTCTTGAAGTTAGAAAAGATAAAGCTGTCAA
TAATAGTGAAGTTATTGCAAAAACTATAGACCAAGTGACCAAAAAAATGG
GATCATTTACCCTTTTTAAGAATGCTGTAATCGTTCCAGAATTACCAAAA
AATAAAACCGGGAAAATTTTAAGATATTCGCTTTCAGAAATGGCTAATGG
GAGGGTTTGGAAGATTCCGGTGACTGTTGATAATCCACAGGTTTATAAAG
AAATTTACGATGTCCTCATTAAAGCCGGATATAAAGCAACTTTACCAATC
GATTAAAACAAAATTATATTTATTTGCAACAACTTAATAAGTTTATTTCA
TTATCACATTTTTCAGAAAACTAATGAAGCTTTTTACTTATATCAGTTTT
TA
back to top

protein sequence of SMED30033927-orf-1

>SMED30033927-orf-1 ID=SMED30033927-orf-1|Name=SMED30033927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=636bp
MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFV
GGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQL
AGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPD
LIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVY
NRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGE
PKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGP
LLVGCTIILFEGKPVNKPNSAEVANIVNKYDIVSFGTAPTVFRIFRKMCP
EEQLKLPYKHLRAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVA
TGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICP
SGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIH
ISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAV
NNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMAN
GRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR032387ACAS_N
IPR000873AMP-dep_Synth/Lig
IPR025110AMP-bd_C
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0019427acetyl-CoA biosynthetic process from acetate
GO:0019654acetate fermentation
GO:0006085acetyl-CoA biosynthetic process
GO:0016573histone acetylation
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016880acid-ammonia (or amide) ligase activity
GO:0000166nucleotide binding
GO:0003987acetate-CoA ligase activity
GO:0005524ATP binding
GO:0016208AMP binding
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0043231intracellular membrane-bounded organelle
GO:0005783endoplasmic reticulum
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032387Acetyl-coenzyme A synthetase, N-terminal domainPFAMPF16177ACAS_Ncoord: 6..60
e-value: 6.8E-19
score: 67.5
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 67..501
e-value: 2.4E-66
score: 224.1
IPR025110AMP-binding enzyme, C-terminal domainPFAMPF13193AMP-binding_Ccoord: 512..589
e-value: 1.7E-9
score: 38.5
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 29..495
e-value: 5.7E-72
score: 244.7
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 497..625
e-value: 2.0E-13
score: 52.6
NoneNo IPR availablePANTHERPTHR43347FAMILY NOT NAMEDcoord: 4..623
NoneNo IPR availableCDDcd05967PrpEcoord: 6..619
e-value: 0.0
score: 577.73
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 5..622
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 241..252