RuvB-like helicase

Overview
NameRuvB-like helicase
Smed IDSMED30033919
Length (bp)1414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RuvB-like helicase (SMED30033919) t-SNE clustered cells

Violin plots show distribution of expression levels for RuvB-like helicase (SMED30033919) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RuvB-like helicase (SMED30033919) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RuvB-like helicase (SMED30033919) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033919

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033919SMESG000031725.1 SmedASXL_013131SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033919SMESG000031725.1 SmedASXL_013131SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033919SMESG000031725.1 dd_Smed_v4_3490_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 249/306 (81.37%), Postives = 277/306 (90.52%), Query Frame = 1
Query:  211 LAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTY 1128
            +AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y
Sbjct:    1 MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLY 306          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 249/306 (81.37%), Postives = 277/306 (90.52%), Query Frame = 1
Query:  211 LAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTY 1128
            +AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y
Sbjct:    1 MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLY 306          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL2 (RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGNC:10475])

HSP 1 Score: 366.696 bits (940), Expect = 1.599e-122
Identity = 197/459 (42.92%), Postives = 290/459 (63.18%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ E++  T+  RI +HSH++GLGLD+     P  AS G+VGQ  AR AAGV+ EMI+  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L K+KV+ GDVI I+ ++G + + GRS   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+E F++L+RALE  +AP++I ATNRG+  ++GT   +S HGIP DLLDR+LI+ T  Y +    +IL+IR + E+V++S +A   L  I  +T+LRYA+QL+T AS + +      V ++ +     LFL+  RS Q +   ++ ++ 
Sbjct:    9 KVPEIRDVTRIERIGAHSHIRGLGLDDALE--PRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEI---QIDRPATGTGSKVGK--LTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGT-SYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLF 452          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-1 (RuvB-like 1 [Source:UniProtKB/Swiss-Prot;Acc:O17607])

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 259/453 (57.17%), Postives = 350/453 (77.26%), Query Frame = 1
Query:   34 IEEVKSTTKT-HRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQ-DIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKE 1386
            IEEVK T K   RIA+HSHVKGLG+D         A+G VGQ  AR AA ++ +MI+ K +AGRAVL+AGPP TGKTAIALA++QELG  VPF P+V SEV+S+E+KKTEVLM +FRRAIGLR+KE K+VYEGEVTE++PV+A + +S  GKTISH+++ LKTAKG+K LK+DP IY+++ K++VEVGDVIYIE +SG VKR GR DVY++E+DLEADE+VP+PKGD  K K++VQ+V+LHDLD+ANA PQG Q D+++++ QLM  KKTE+TD+LR +I+K+VN+YI+ G AEL+PGVLFIDEVHMLD+ECFTYL RALE  +AP+V+FATNRG  +V+G  D K+ HGIP ++LDR++II T  Y+++   +IL  R + ENV+   +A   L+ +  + +LRYALQL+ PA   ++ C +E + +E V    +LF++  R   +  +E+E
Sbjct:   20 IEEVKPTPKQIKRIAAHSHVKGLGIDTETQEAHYEAAGFVGQAPARTAASIVVDMIRLKCMAGRAVLIAGPPATGKTAIALAMSQELGDGVPFVPLVASEVFSNEVKKTEVLMRSFRRAIGLRVKETKDVYEGEVTELSPVEASD-NSGMGKTISHLVLSLKTAKGSKQLKLDPSIYDSILKQRVEVGDVIYIEANSGIVKRVGRCDVYASEFDLEADEFVPMPKGDVRKSKDIVQNVSLHDLDIANARPQGRQGDVSNIVSQLMTPKKTEVTDRLRSEINKVVNEYIESGVAELMPGVLFIDEVHMLDVECFTYLYRALESPMAPVVVFATNRGTTTVRGLGD-KAPHGIPPEMLDRLMIIPTMKYNEEDIRKILVHRTEAENVQFEEKAFDLLSKVGAEKSLRYALQLIAPARLCAQTCGREVIEVEDVDRCTKLFMD--RGESLKKAEEE 468          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-2 (RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH2])

HSP 1 Score: 332.798 bits (852), Expect = 8.146e-110
Identity = 192/454 (42.29%), Postives = 278/454 (61.23%), Query Frame = 1
Query:   43 VKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEAD--EYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSK-ETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            VK   K  R + HSH+ GLGL++   +   V+ G+VGQ  AR+AAG+I +MI+  K+AGRA+L+ G PG GKTAIA+AI++ELG   PF  +V SE+YS+EI KTE L + FRRA+G++IKE  EV EGEV  +   + D  ++  G  +    + ++T        +   + +   KEKV  GDVI ++ +SG V R GRS   S++YD      + V  P G+  K++E V  V LHD+DV N+  QG          L      EI  ++R  I+K V ++ ++G A+ VPGVLFIDE HMLD+ECF++L+RA+E  ++P++I ATNR +  V+GT D++S+HGIP D LDR+LII    Y K+   +IL IR   E VK+   A   L  + + T+LRY + L+  AS++ +I SK E VT +H+  A  LF + KRS +IL  E   ++
Sbjct:    9 VKDIVKVERTSVHSHITGLGLNDRLEA-EYVSGGMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELGEDTPFVSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISL---EVDRSANGMGPKVGK--LTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQG-------YVALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLIA-ASEVIRIRSKAEIVTTDHIGSAYRLFFDTKRSEKILTEESAGFL 447          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-2 (RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH2])

HSP 1 Score: 332.798 bits (852), Expect = 8.146e-110
Identity = 192/454 (42.29%), Postives = 278/454 (61.23%), Query Frame = 1
Query:   43 VKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEAD--EYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSK-ETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            VK   K  R + HSH+ GLGL++   +   V+ G+VGQ  AR+AAG+I +MI+  K+AGRA+L+ G PG GKTAIA+AI++ELG   PF  +V SE+YS+EI KTE L + FRRA+G++IKE  EV EGEV  +   + D  ++  G  +    + ++T        +   + +   KEKV  GDVI ++ +SG V R GRS   S++YD      + V  P G+  K++E V  V LHD+DV N+  QG          L      EI  ++R  I+K V ++ ++G A+ VPGVLFIDE HMLD+ECF++L+RA+E  ++P++I ATNR +  V+GT D++S+HGIP D LDR+LII    Y K+   +IL IR   E VK+   A   L  + + T+LRY + L+  AS++ +I SK E VT +H+  A  LF + KRS +IL  E   ++
Sbjct:    9 VKDIVKVERTSVHSHITGLGLNDRLEA-EYVSGGMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELGEDTPFVSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISL---EVDRSANGMGPKVGK--LTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQG-------YVALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGT-DVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLIA-ASEVIRIRSKAEIVTTDHIGSAYRLFFDTKRSEKILTEESAGFL 447          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: vps-4 (Related to yeast Vacuolar Protein Sorting factor [Source:UniProtKB/TrEMBL;Acc:Q9BL83])

HSP 1 Score: 48.1358 bits (113), Expect = 9.713e-6
Identity = 50/205 (24.39%), Postives = 92/205 (44.88%), Query Frame = 1
Query:  139 SGLVGQYEAREAAGVIT----EMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMEN-FRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQ 738
            +GL G  EA + A ++     ++    +   + +LL GPPGTGK+ IA A+A E G    F  +  S++ S  + ++E L++N F  A   R  +   ++  E+  +   ++DN S S  +  +  M+ ++       L  D ++          +G      +   A++R+            E   Y+PLP  D H +KE+ +
Sbjct:  121 AGLEGAKEALKEAVILPIKFPQLFTGNRKPWQGILLFGPPGTGKSYIAKAVATEAGEST-FFSISSSDLMSKWLGESEKLVKNLFALA---REHKPSIIFIDEIDSLCSARSDNESESARRIKTEFMVQMQGV----GLNNDGILV---------LGATNIPWILDSAIRRR-----------FEKRIYIPLP--DIHARKEMFR 295          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: pont (gene:FBgn0040078 transcript:FBtr0082226)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 316/457 (69.15%), Postives = 383/457 (83.81%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            MKIEEVKST +T RIA+HSHVKGLGLDE G ++   A+GLVGQ  AREAAG++ ++IK+KK+AGRA+LLAGPPGTGKTAIALAIAQELG+KVPFCPMVGSEV+S+EIKKTEVLMENFRR+IGLRI+E KEVYEGEVTE+TPV+ +NP   YGKTIS+V+I LKTAKGTK LK+DP I++ LQKEKVEVGDVIYIE +SGAVKRQGRSD ++ E+DLE +EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQGGQD+ SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLFIDE+HMLDLE FTYL ++LE  IAPIVIFATNRG C ++GT DI S HGIP DLLDR+LII+T  Y      +I+K+RAQ E +++   A  +L+ I   +TLRYA+QLLTPA ++ K+  +  ++ + + +   LFL+AKRS++ L+ +  K+ML
Sbjct:    1 MKIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHS-AAGLVGQKAAREAAGIVVDLIKSKKMAGRALLLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLMENFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDPSIFDALQKEKVEVGDVIYIEANSGAVKRQGRSDTFATEFDLETEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDVLSMMGQLMKPKKTEITDKLRMEINKVVNKYIDQGIAELVPGVLFIDEIHMLDLETFTYLHKSLESPIAPIVIFATNRGRCVIRGTTDIVSPHGIPLDLLDRLLIIRTLLYSTADMEQIIKLRAQTEGLQLEENAFTRLSEIGTSSTLRYAVQLLTPAHQMCKVNGRNQISKDDIEDVHSLFLDAKRSSKHLSEKNNKFML 456          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0331852)

HSP 1 Score: 365.155 bits (936), Expect = 5.828e-122
Identity = 200/455 (43.96%), Postives = 289/455 (63.52%), Query Frame = 1
Query:   40 EVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            EV+  T+  RI +HSH++GLGLD+   +   V+ G+VGQ +AR AAGV+ +M++  K+AGR +LLAG P TGKTAIA+ +AQ LG++ PF  M GSE+YS E+ KTE L +  R++IG+RIKE  E+ EGEV EI   Q + P+S  G+ +  V   LKT +   +  +   I E   KEK++ GDVI I+ +SG V + GRS   + +YD    +  +V  P+G+  K+KEVV  VTLH++DV N+   G          L      EI  ++R  I+  V ++ ++G AE+ PGVLFIDEVHMLD+ECF++L+RALE  +AP+V+ ATNRG+  ++GT + +S HGIP DLLDR++II+T  Y +    EILKIR + E+  +  +A   L  IA  T+LRYA+QL+T A+ + +      V  E V +   LFL+  RS++IL   ++ YM 
Sbjct:    8 EVRDVTRIERIGAHSHIRGLGLDDVLEARL-VSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEI---QIERPASGTGQKVGKV--TLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHG-------FLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGT-NYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMF 448          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0074988)

HSP 1 Score: 365.155 bits (936), Expect = 5.828e-122
Identity = 200/455 (43.96%), Postives = 289/455 (63.52%), Query Frame = 1
Query:   40 EVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            EV+  T+  RI +HSH++GLGLD+   +   V+ G+VGQ +AR AAGV+ +M++  K+AGR +LLAG P TGKTAIA+ +AQ LG++ PF  M GSE+YS E+ KTE L +  R++IG+RIKE  E+ EGEV EI   Q + P+S  G+ +  V   LKT +   +  +   I E   KEK++ GDVI I+ +SG V + GRS   + +YD    +  +V  P+G+  K+KEVV  VTLH++DV N+   G          L      EI  ++R  I+  V ++ ++G AE+ PGVLFIDEVHMLD+ECF++L+RALE  +AP+V+ ATNRG+  ++GT + +S HGIP DLLDR++II+T  Y +    EILKIR + E+  +  +A   L  IA  T+LRYA+QL+T A+ + +      V  E V +   LFL+  RS++IL   ++ YM 
Sbjct:    8 EVRDVTRIERIGAHSHIRGLGLDDVLEARL-VSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEI---QIERPASGTGQKVGKV--TLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHG-------FLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGT-NYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMF 448          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0344993)

HSP 1 Score: 365.155 bits (936), Expect = 5.828e-122
Identity = 200/455 (43.96%), Postives = 289/455 (63.52%), Query Frame = 1
Query:   40 EVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            EV+  T+  RI +HSH++GLGLD+   +   V+ G+VGQ +AR AAGV+ +M++  K+AGR +LLAG P TGKTAIA+ +AQ LG++ PF  M GSE+YS E+ KTE L +  R++IG+RIKE  E+ EGEV EI   Q + P+S  G+ +  V   LKT +   +  +   I E   KEK++ GDVI I+ +SG V + GRS   + +YD    +  +V  P+G+  K+KEVV  VTLH++DV N+   G          L      EI  ++R  I+  V ++ ++G AE+ PGVLFIDEVHMLD+ECF++L+RALE  +AP+V+ ATNRG+  ++GT + +S HGIP DLLDR++II+T  Y +    EILKIR + E+  +  +A   L  IA  T+LRYA+QL+T A+ + +      V  E V +   LFL+  RS++IL   ++ YM 
Sbjct:    8 EVRDVTRIERIGAHSHIRGLGLDDVLEARL-VSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEI---QIERPASGTGQKVGKV--TLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHG-------FLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGT-NYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMF 448          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl1 (RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:317679])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 338/456 (74.12%), Postives = 387/456 (84.87%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE GN+    ASGLVGQ  AREA G+ITE+I++KK+AGRA+LLAGPPGTGKTA+ALA+AQELG+KVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D ++ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE SIAPIV+FA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRYA+QLLTPAS ++++  +E V  EHV E  ELF +AK SA+IL  +  K+M
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDEAGNAKQS-ASGLVGQESAREACGIITELIRSKKMAGRAILLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVVFASNRGNCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGLNISEEALSHLGEIGTKTTLRYAVQLLTPASLLARVQGREVVEKEHVEEINELFYDAKSSAKILQDQHTKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl2 (RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:317678])

HSP 1 Score: 362.844 bits (930), Expect = 3.294e-121
Identity = 197/458 (43.01%), Postives = 293/458 (63.97%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEA--DEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  +R AAG+I EMIK  ++AGRAVL+AG PGTGKTAIA+ IAQ LG   PF  + GSE++S E+ KTE L + FR+AIG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L KE+V+ GDVI I+ ++G + + GRS   + +YD      ++V  P+G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V+++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  ++P++I ATNRG+  ++GT + +S HGIP D+LDR+LII T  Y +    +ILKIR + E+V++S EA   L  I  +T+LRYA+QL++ A  + +      V +E +     LFL+  RS+Q +   ++ ++ 
Sbjct:    9 KVPEVRDITRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLASRRAAGLILEMIKDGQIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEI---QIDRPATGTGAKVGK--LTLKTTEMETIYDLGTKMIESLSKERVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGT-NYQSPHGIPIDMLDRLLIIATTPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFLF 452          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl2 (RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:317678])

HSP 1 Score: 360.147 bits (923), Expect = 2.897e-120
Identity = 196/457 (42.89%), Postives = 292/457 (63.89%), Query Frame = 1
Query:   34 IEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEA--DEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            + EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  +R AAG+I EMIK  ++AGRAVL+AG PGTGKTAIA+ IAQ LG   PF  + GSE++S E+ KTE L + FR+AIG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L KE+V+ GDVI I+ ++G + + GRS   + +YD      ++V  P+G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V+++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  ++P++I ATNRG+  ++GT + +S HGIP D+LDR+LII T  Y +    +ILKIR + E+V++S EA   L  I  +T+LRYA+QL++ A  + +      V +E +     LFL+  RS+Q +   ++ ++ 
Sbjct:    1 VPEVRDITRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLASRRAAGLILEMIKDGQIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEI---QIDRPATGTGAKVGK--LTLKTTEMETIYDLGTKMIESLSKERVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGT-NYQSPHGIPIDMLDRLLIIATTPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFLF 443          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: med21 (mediator complex subunit 21 [Source:Xenbase;Acc:XB-GENE-5719290])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 389/456 (85.31%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIA+HSHVKGLGLDENG +    A+GLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELG+KVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRI+E KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE S+APIVIFATNRG C ++GTED+ S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  ++EK+M
Sbjct:    1 MKIEEVKSTTKTQRIATHSHVKGLGLDENGMA-KQAAAGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGNKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRAEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIFATNRGNCIIRGTEDVASPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEINELFYDAKSSAKILAEQQEKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: med21 (mediator complex subunit 21 [Source:Xenbase;Acc:XB-GENE-5719290])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 316/451 (70.07%), Postives = 363/451 (80.49%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSE 1380
            MKIEEVKSTTKT RIA+HSHVKGLGLDENG +    A+GLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELG+KVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRI+E KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQ                       LR +I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE S+APIVIFATNRG C ++GTED+ S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  E
Sbjct:    8 MKIEEVKSTTKTQRIATHSHVKGLGLDENGMA-KQAAAGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGNKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQ-----------------------LRAEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIFATNRGNCIIRGTEDVASPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEINELFYDAKSSAKILAEE 434          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 377.867 bits (969), Expect = 6.909e-127
Identity = 201/458 (43.89%), Postives = 292/458 (63.76%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  AR AAGVI EMIK  K+AGRAVL+AG PGTGKTAIA+ +AQ LGS  PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV E   VQ D P++  G  +    + LKT +      +   + E+L KEKV+ GDVI I+ ++G + + GR+   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  +AP++I ATNRG+  ++GT + +S HGIP DLLDR+LII T  Y++    +ILKIR + E+V ++ +A   L  I  +T+LRY++QL+T AS + +      V ++ +     LFL+  RS Q +   ++ +M 
Sbjct:    8 KVPEVRDVTRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVE---VQIDRPATGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMF 451          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 377.096 bits (967), Expect = 1.534e-126
Identity = 201/458 (43.89%), Postives = 292/458 (63.76%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  AR AAGVI EMIK  K+AGRAVL+AG PGTGKTAIA+ +AQ LGS  PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV E   VQ D P++  G  +    + LKT +      +   + E+L KEKV+ GDVI I+ ++G + + GR+   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  +AP++I ATNRG+  ++GT + +S HGIP DLLDR+LII T  Y++    +ILKIR + E+V ++ +A   L  I  +T+LRY++QL+T AS + +      V ++ +     LFL+  RS Q +   ++ +M 
Sbjct:   16 KVPEVRDVTRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVE---VQIDRPATGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMF 459          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 365.155 bits (936), Expect = 5.468e-122
Identity = 196/447 (43.85%), Postives = 284/447 (63.53%), Query Frame = 1
Query:   64 HRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            H   +HSH++GLGLD +      V+ G+VGQ  AR AAGVI EMIK  K+AGRAVL+AG PGTGKTAIA+ +AQ LGS  PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV E   VQ D P++  G  +    + LKT +      +   + E+L KEKV+ GDVI I+ ++G + + GR+   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  +AP++I ATNRG+  ++GT + +S HGIP DLLDR+LII T  Y++    +ILKIR + E+V ++ +A   L  I  +T+LRY++QL+T AS + +      V ++ +     LFL+  RS Q +   ++ +M 
Sbjct:   12 HIYCAHSHIRGLGLD-DALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVE---VQIDRPATGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMF 444          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl1 (RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:1928760])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 366.696 bits (940), Expect = 1.040e-122
Identity = 197/459 (42.92%), Postives = 290/459 (63.18%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ E++  T+  RI +HSH++GLGLD+     P  AS G+VGQ  AR AAGV+ EMI+  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L K+KV+ GDVI I+ ++G + + GRS   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+E F++L+RALE  +AP++I ATNRG+  ++GT   +S HGIP DLLDR+LI+ T  Y +    +IL+IR + E+V++S +A   L  I  +T+LRYA+QL+T AS + +      V ++ +     LFL+  RS Q +   ++ ++ 
Sbjct:    9 KVPEIRDVTRIERIGAHSHIRGLGLDDALE--PRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEI---QIDRPATGTGSKVGK--LTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGT-SYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLF 452          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 366.696 bits (940), Expect = 1.040e-122
Identity = 197/459 (42.92%), Postives = 290/459 (63.18%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ E++  T+  RI +HSH++GLGLD+     P  AS G+VGQ  AR AAGV+ EMI+  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L K+KV+ GDVI I+ ++G + + GRS   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+E F++L+RALE  +AP++I ATNRG+  ++GT   +S HGIP DLLDR+LI+ T  Y +    +IL+IR + E+V++S +A   L  I  +T+LRYA+QL+T AS + +      V ++ +     LFL+  RS Q +   ++ ++ 
Sbjct:    9 KVPEIRDVTRIERIGAHSHIRGLGLDDALE--PRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEI---QIDRPATGTGSKVGK--LTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGT-SYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLF 452          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl1 (RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:1928760])

HSP 1 Score: 235.343 bits (599), Expect = 4.679e-76
Identity = 113/134 (84.33%), Postives = 124/134 (92.54%), Query Frame = 1
Query:  211 LAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIE 612
            +AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE
Sbjct:    1 MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIE 134          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 191.045 bits (484), Expect = 1.710e-57
Identity = 105/254 (41.34%), Postives = 152/254 (59.84%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQG 786
            K+ E++  T+  RI +HSH++GLGLD+                E R+       MI+  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E+ KTE L + FRR+IG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L K+KV+ GDVI I+ ++G + + GRS   + +YD    +  +V  P G+  K+KEVV  V+LH++DV N+  QG
Sbjct:    9 KVPEIRDVTRIERIGAHSHIRGLGLDDA--------------LEPRQ-------MIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEI---QIDRPATGTGSKVGK--LTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG 236          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q9DE26|RUVB1_XENLA (RuvB-like 1 OS=Xenopus laevis OX=8355 GN=ruvbl1 PE=2 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 389/456 (85.31%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIA+HSHVKGLGLDENG +    A+GLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELG+KVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRI+E KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGRSD Y+ E+DLEA+EYVPLPKGD H+KKEV+QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR  I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE S+APIVIFATNRG C ++GTED+ S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  ++EK+M
Sbjct:    1 MKIEEVKSTTKTQRIATHSHVKGLGLDENGIA-KQAAAGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGNKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRSDTYATEFDLEAEEYVPLPKGDVHQKKEVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGQINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSLAPIVIFATNRGNCIIRGTEDVASPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEINELFYDAKSSAKILAEQQEKFM 455          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|P60123|RUVB1_RAT (RuvB-like 1 OS=Rattus norvegicus OX=10116 GN=Ruvbl1 PE=1 SV=1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|P60122|RUVB1_MOUSE (RuvB-like 1 OS=Mus musculus OX=10090 GN=Ruvbl1 PE=1 SV=1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q9Y265|RUVB1_HUMAN (RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/456 (74.34%), Postives = 388/456 (85.09%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE+G +    ASGLVGQ  AREA GVI E+IK+KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP I+E+LQKE+VE GDVIYIE +SGAVKRQGR D Y+ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIVIFA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRY++QLLTPA+ ++KI  K+++  EHV E  ELF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDESGLA-KQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q8AWW7|RUVB1_DANRE (RuvB-like 1 OS=Danio rerio OX=7955 GN=ruvbl1 PE=2 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 337/456 (73.90%), Postives = 387/456 (84.87%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE GN+    ASGLVGQ  AREA G+ITE+I++KK+AGRA+LLAGPPGTGKTA+ALA+AQELG+KVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D ++ E+DLEA+EYVPLPKGD H+KKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE SIAPIV+FA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS EA   L  I  +TTLRYA+QLLTPAS ++++  +E V  EHV E  ELF +AK SA+IL  +  K+M
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDEAGNAKQS-ASGLVGQESAREACGIITELIRSKKMAGRAILLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDLEAEEYVPLPKGDVHEKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVVFASNRGNCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGLNISEEALSHLGEIGTKTTLRYAVQLLTPASLLARVQGREVVEKEHVEEINELFYDAKSSAKILQDQHTKFM 455          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A2C9JD95 (RuvB-like helicase OS=Biomphalaria glabrata OX=6526 GN=106054037 PE=3 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 343/456 (75.22%), Postives = 396/456 (86.84%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKST+K  RIASHSH+KGLGLDENG +I   +SGLVGQ  AREAAGV+ E+I++KK+AGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQKEKVEVGDVIYIE +SGAVKRQGRSD Y+ EYDLEA+EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR++I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE +IAPIVIFATNRG C +KGTEDI + HG+P DLLDRI+I++T  Y ++   +ILKIRAQ+E ++I  EA  KLA    ++TLRYA+Q+LTPA+ +S+I  K++VT E V E  +LF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTSKAQRIASHSHIKGLGLDENGYAIQS-SSGLVGQELAREAAGVVVELIRSKKMAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPAETENPMGGYGKTVSHVVIGLKTAKGTKQLKLDPSIYESLQKEKVEVGDVIYIEANSGAVKRQGRSDNYATEYDLEAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDIMSMMGQLMKPKKTEITDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESTIAPIVIFATNRGKCVIKGTEDIVAPHGMPLDLLDRIMIVRTLPYSQEEMTQILKIRAQIEGIQIDDEALKKLAMTGVKSTLRYAVQMLTPANVMSRINGKDSVTKEEVEEVGDLFFDAKSSAKILAEQEDKYM 455          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A0B7B8P4 (RuvB-like helicase OS=Arion vulgaris OX=1028688 GN=ORF166502 PE=3 SV=1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 343/456 (75.22%), Postives = 398/456 (87.28%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKST+K  RIASHSH+KGLGLDENG +I   ++GLVGQ  AREAAGV+ E+I++KK+AGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQKEKVEVGDVIYIE +SGAVKRQGRSD Y+ EYDLEA+EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR++I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE +IAPIVIFATNRG C +KGTEDI + HG+P DLLDRILII+T  Y ++  ++ILKIRAQ+E+++I  E+   LA+I  ++TLRYA+Q+LTPA+ +S+I  K++VT E V E   LF +AK SA+IL  +++KYM
Sbjct:    1 MKIEEVKSTSKAQRIASHSHIKGLGLDENGYAIQS-SAGLVGQELAREAAGVVVELIRSKKMAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPAETENPMGGYGKTVSHVVIGLKTAKGTKQLKLDPSIYESLQKEKVEVGDVIYIEANSGAVKRQGRSDNYATEYDLEAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDIMSMMGQLMKPKKTEITDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESTIAPIVIFATNRGKCVIKGTEDIVAPHGMPLDLLDRILIIRTLPYSQEEMMQILKIRAQIESIQIDDESLKGLAAIGVKSTLRYAVQVLTPANIMSRINGKDSVTKEEVEEISSLFYDAKSSAKILAEQEDKYM 455          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A293MX40 (RuvB-like helicase (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 337/456 (73.90%), Postives = 394/456 (86.40%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIA+HSHVKG+GLDENG +IP VASGLVGQ +AREAAG+I E+IK+KK+AGRAVLLAGPPGTGKTAIALAIAQELG+KVPFCPMVGSEVYSSE+KKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQ+EKVEVGDVIYIE +SGAVKRQGRSD Y+ E+DLEA+EYVPLPKGD HKKK+V+QDVTLHDLDVANA PQGGQDI SMMGQLMK +KTEITDKLR++I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE SIAPIVIFATNRG C+V+GTED+ S HGIP DLLDR++I++T  Y ++  ++IL+IRAQ E ++I  E+   L  I   TTLRYA QLL+P+S ++K+  + ++  E V E  +LF +AK SA+IL    +KYM
Sbjct:    1 MKIEEVKSTTKTQRIAAHSHVKGIGLDENGMAIP-VASGLVGQEQAREAAGIIIELIKSKKMAGRAVLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSSEVKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTVSHVIIGLKTAKGTKQLKLDPTIYESLQREKVEVGDVIYIEANSGAVKRQGRSDAYATEFDLEAEEYVPLPKGDVHKKKDVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPRKTEITDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVIFATNRGRCTVRGTEDVVSPHGIPLDLLDRLMIVRTLPYSQEEMVQILRIRAQTEGIEIDEESLQSLGEIGTHTTLRYAAQLLSPSSLLAKVNGRSSIRKEDVKEISDLFHDAKSSAKILAEHNDKYM 455          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A2R5LHA1 (RuvB-like helicase (Fragment) OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 337/456 (73.90%), Postives = 393/456 (86.18%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIA+HSHVKG+GLDENG +IP VASGLVGQ +AREAAG+I E+IK+KK+AGRAVLLAGPPGTGKTAIALAIAQELG+KVPFCPMVGSEVYSSE+KKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQ+EKVEVGDVIYIE +SGAVKRQGRSD Y+ E+DLEA+EYVPLPKGD HKKK+V+QDVTLHDLDVANA PQGGQDI SMMGQLMK +KTEITDKLR++I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE SIAPIVIFATNRG C+V+GTED+ S HGIP DLLDR++I++T  Y ++  ++IL+IRAQ E + I  E+   L  I   TTLRYA QLL+P+S ++K+  + ++  E V E  +LF +AK SA+IL    +KYM
Sbjct:    3 MKIEEVKSTTKTQRIAAHSHVKGIGLDENGMAIP-VASGLVGQEQAREAAGIIIELIKSKKMAGRAVLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSSEVKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTVSHVIIGLKTAKGTKQLKLDPTIYESLQREKVEVGDVIYIEANSGAVKRQGRSDAYATEFDLEAEEYVPLPKGDVHKKKDVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPRKTEITDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVIFATNRGRCTVRGTEDVVSPHGIPLDLLDRLMIVRTLPYSQEEMVQILRIRAQTEGIDIDEESLQSLGEIGTHTTLRYAAQLLSPSSLLAKVNGRSSIRKEDVKEISDLFHDAKSSAKILAEHNDKYM 457          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A1Z5LAI6 (RuvB-like helicase (Fragment) OS=Ornithodoros moubata OX=6938 PE=3 SV=1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 336/456 (73.68%), Postives = 393/456 (86.18%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKS TKT RIA+HSHVKG+GLDENG +IP VASGLVGQ +AREAAG+I E+IK+KK+AGRAVLLAGPPGTGKTAIALAIAQELG+KVPFCPMVGSEVYSSE+KKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQ+EKVEVGDVIYIE +SGAVKRQGRSD Y+ E+DLEA+EYVPLPKGD HKKK+V+QDVTLHDLDVANA PQGGQDI SMMGQLMK +KTEITDKLR++I+K+VNKYIDQG AELVPGVLFIDEVHMLD+ECFTYL RALE SIAPIVIFATNRG C+V+GTED+ S HGIP DLLDR++I++T  Y ++  ++IL+IRAQ E ++I  E+   L  I   TTLRYA QLL+P+S ++K+  + ++  E V E  +LF +AK SA+IL    +KYM
Sbjct:    1 MKIEEVKSNTKTQRIAAHSHVKGIGLDENGMAIP-VASGLVGQEQAREAAGIIIELIKSKKMAGRAVLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSSEVKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTVSHVIIGLKTAKGTKQLKLDPTIYESLQREKVEVGDVIYIEANSGAVKRQGRSDAYATEFDLEAEEYVPLPKGDVHKKKDVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPRKTEITDKLRKEINKVVNKYIDQGIAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVIFATNRGRCTVRGTEDVVSPHGIPLDLLDRLMIVRTLPYSQEEMVQILRIRAQTEGIEIDEESLQALGDIGTHTTLRYAAQLLSPSSLLAKVNGRSSIRKEDVKEISDLFHDAKSSAKILAEHNDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Match: ruvbl1 (RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:103040048])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 332/456 (72.81%), Postives = 384/456 (84.21%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLD+ GN+    ASGLVGQ  AREA G+I E+I++KK+AGRAVLLAGPPGTGKTA+ALA+AQELG+KVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKT KGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D ++ E+DLEA+EYVPLPKGD HKKKE++QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VN+YIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIV+FA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS +A   L  I  +TTLRYA+QLLTPA+ ++++  KE V  E V E  ELF +AK SA+IL  +  K+M
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDDAGNA-KQTASGLVGQEAAREACGIIVELIRSKKMAGRAVLLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTGKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNRYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVVFASNRGNCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEDALSHLGEIGTKTTLRYAVQLLTPANLLARVQGKEGVEREQVEEINELFYDAKSSAKILQDQHTKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:103024854])

HSP 1 Score: 376.326 bits (965), Expect = 1.795e-126
Identity = 200/458 (43.67%), Postives = 292/458 (63.76%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEA--DEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  +R AAG+I EMIK   +AGRAVL+AG PGTGKTAIA+ IAQ LGS  PF  + GSE++S E+ KTE L + FR+AIG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT        +   + E+L KEKV+ GDVI I+ ++G + + GRS   + +YD      ++V  P+G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V+++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  ++P++I ATNRG+  ++GT + +S HGIP DLLDR+LII T  Y +    +ILKIR + E+V++S EA   L  I  +T+LRYA+QL++ A  + +      V +E +     LFL+  RS+Q +   ++ ++ 
Sbjct:    9 KVPEVRDITRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLASRRAAGLILEMIKDGHIAGRAVLIAGQPGTGKTAIAMGIAQSLGSDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEI---QIDRPATGTGAKVGK--LTLKTTDMETIYDLGSKMIESLSKEKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIIATSPYTEKETRQILKIRCEEEDVELSDEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDESRSSQYMKEYQDSFLF 452          
BLAST of RuvB-like helicase vs. Ensembl Sea Lamprey
Match: ruvbl1 (RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:317679])

HSP 1 Score: 447.973 bits (1151), Expect = 2.889e-158
Identity = 219/273 (80.22%), Postives = 242/273 (88.64%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEIT 846
            MKIEEV+STTKT RIA HSHVKGLGLDE G +    A+GLVGQ   REA G+I E+I++KK+AGRAVLLAGPPGTGKTA+ALAIAQELGSKVPFCPMVGSEVYS+EIKKTEVLMENFRRAIGLRIKE KEVYEGEV E++P + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKEKVEVGDVIYIE +SGAVKRQGR D ++ E+DLEA+EYVPLPKGD HKKKEV+QDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEIT
Sbjct:    1 MKIEEVRSTTKTQRIAVHSHVKGLGLDEAGFA-KANAAGLVGQEMGREACGIIVELIRSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVMELSPCETENPMGGYGKTISHVIISLKTAKGTKQLKLDPSIYESLQKEKVEVGDVIYIEANSGAVKRQGRCDTFATEFDLEAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEIT 272          
BLAST of RuvB-like helicase vs. Ensembl Yeast
Match: RVB1 (ATP-dependent DNA helicase, also known as pontin; member of the AAA+ and RuvB-like protein families; similar to Rvb2p; conserved component of multiple complexes including the INO80 complex, the Swr1 complex, and the R2TP complex (Rvb1-Rvb2-Tah1-Pih1); involved in multiple processes such as chromatin remodeling, box C/D snoRNP assembly, and RNA polymerase II assembly [Source:SGD;Acc:S000002598])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 281/437 (64.30%), Postives = 363/437 (83.07%), Query Frame = 1
Query:   67 RIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNS 1377
            R A+H+H+KGLGLDE+G +   V  G VGQ EAREA GVI ++IKAKK++GRA+LLAG P TGKTA+ALAI+QELG KVPFCP+VGSE+YS E+KKTE LMENFRRAIGLRIKE KEVYEGEVTE+TP  A+NP   YGKTISHV++ LK+AKGTK+L++DP IYE++Q+EKV +GDVIYIE ++GAVKR GRSD Y+ E+DLE +EYVPLPKG+ HKKKE+VQDVTLHDLDVANA PQGGQD+ SMMGQL+K KKTEIT+KLR++++K+V KYIDQG AEL+PGVLFIDEV+MLD+E FTYL++ALE +IAP+V+ A+NRG+ +V+GTED+ S HG+P DL+DR+LI++T  YDKD    I++ RA +E +++   A   LA++  +T+LRYALQLL P   +++  +++ + +  V EA+ LFL+AKRS +IL +
Sbjct:   23 RTAAHTHIKGLGLDESGVA-KRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILET 458          
BLAST of RuvB-like helicase vs. Ensembl Yeast
Match: RVB2 (ATP-dependent DNA helicase, also known as reptin; member of the AAA+ and RuvB protein families, similar to Rvb1p; conserved component of multiple complexes including the INO80 complex, the Swr1 complex, and the R2TP complex (Rvb1-Rvb2-Tah1-Pih1); involved in multiple processes such as chromatin remodeling, box C/D snoRNP assembly, and RNA polymerase II assembly [Source:SGD;Acc:S000006156])

HSP 1 Score: 348.591 bits (893), Expect = 1.711e-116
Identity = 195/444 (43.92%), Postives = 280/444 (63.06%), Query Frame = 1
Query:   70 IASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYD-LEAD-EYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            IA+HSH+ GLGLDEN    P  + G+VGQ +AR AAGVI +M++   +AGRAVL+AGPP TGKTA+A+ ++Q LG  VPF  + GSE++S E+ KTE L + FR++IG++IKE  E+ EGEV EI   ++       GK      + +KT       ++   + + L KEKV  GDVI I+ +SG + + GRS   S +YD + AD  +V  P+G+  K+K VV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE+VPGVLFIDEVHMLD+ECF++++RALE   APIV+ ATNRGV   +GT + KS HG+P DLLDR +II TK+Y++     IL IRAQ E V++S +A   L     +T+LRY+  L++ A +I+      TV +E V  A  LFL++ RS + +   + +Y+
Sbjct:   20 IAAHSHITGLGLDENLQPRP-TSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGK------LTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQG-------FLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGT-NYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYI 448          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO40477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S760])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 322/456 (70.61%), Postives = 389/456 (85.31%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIA+HSH+KGLGLDENG + P +ASGLVGQ  ARE +GVI ++I++KK+AGRAVLLAGPPGTGKTA+ALAIAQELG KVPFCPMVGSEVYS+E+KKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKT+SHV+I LKTAKGTK LK+DP IYE+LQKEKVE GDVIYIE +SGAVKRQGRSD ++ E+DLEA+EYVPLPKGD HKKKE+VQDVTLHDLD+ANA PQGGQDI SMM QL + KKTEITDKLR++I+K+VNKYIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE +I+PIVIFATNRG C+++GTE I + HGIP DLLDR++I++T  Y +D  ++I+KIRAQ+E +++  E+   L     +TTLRYA+QLLTPA+ +++I  ++T+    V E  ELF +AK SA++L  + +KYM
Sbjct:    1 MKIEEVKSTTKTQRIAAHSHIKGLGLDENGFAHP-MASGLVGQETAREGSGVIVDLIRSKKMAGRAVLLAGPPGTGKTALALAIAQELGPKVPFCPMVGSEVYSTEVKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTVSHVVIGLKTAKGTKQLKLDPSIYESLQKEKVEAGDVIYIEANSGAVKRQGRSDTFATEFDLEAEEYVPLPKGDVHKKKELVQDVTLHDLDIANARPQGGQDILSMMEQLTRSKKTEITDKLRKEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESTISPIVIFATNRGNCTIRGTE-ISAPHGIPLDLLDRVMIVRTLPYSQDEMMQIIKIRAQIEGIQVDDESLELLGETGTKTTLRYAVQLLTPANLLARINGRDTINKGDVEEINELFYDAKSSAKLLAEQADKYM 454          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO39842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Z2])

HSP 1 Score: 163.696 bits (413), Expect = 1.395e-44
Identity = 95/214 (44.39%), Postives = 131/214 (61.21%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYD 672
            K++EV+  T+  RI +HSH++GLGLD+   +   V+ G+VGQ  AR AAG+I EMIK  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E+ KTE L + FR++IG+RIKE  E+ EGEV E   VQ D P++  G  +    + LKT +      +   + E+L K      D  Y +   G   RQG+ + Y    D
Sbjct:    8 KVQEVRDITRIERIGAHSHIRGLGLDDALEARQ-VSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQAFRKSIGVRIKEETEIIEGEVVE---VQIDRPTTGTGAKVGK--LTLKTTEMETIYDLGTKMIESLTK------DEQYRQGKDGQY-RQGKDEQYRQGKD 208          

HSP 2 Score: 154.066 bits (388), Expect = 3.951e-41
Identity = 90/270 (33.33%), Postives = 145/270 (53.70%), Query Frame = 1
Query:  595 DVIYIEVSSGAVKRQGRSDVYSNEYDLEADE--YVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            D+I I+ ++G + + GRS   + +YD    +  +V  P+G+  K+KEVV  VTLH++DV N+  QG   +A   G        EI  ++R  I+  V ++ ++G A++VPGVLF+DEVHMLD+ECF++L+RALE  +AP++I ATNRG+                                   C E        E+V++S +A + L  IA +T+LRY++QL+T AS + +      V ++ +     LF +  RS Q L   ++++M 
Sbjct:  315 DIITIDKATGKISKLGRSFTRARDYDAMGPQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGF--LALFAGDT-----GEIKSEVREQINSKVAEWREEGKADIVPGVLFVDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITK---------------------------------CEE--------EDVEMSDDAMMVLTKIAQETSLRYSIQLITAASLVCRKRKGTEVAMDDIKRVYSLFFDESRSTQFLKEYQQEFMF 536          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO26041 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD16])

HSP 1 Score: 107.457 bits (267), Expect = 1.945e-28
Identity = 53/93 (56.99%), Postives = 70/93 (75.27%), Query Frame = 1
Query:   76 SHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKK 354
            +HSH++GLGLD+   +   V+ G+VGQ  AR AAG+I EMIK  K+AGRAVL+AG PGTGKTAIA+ +AQ LG   PF  + GSE++S E++K
Sbjct:    2 AHSHIRGLGLDDALEARQ-VSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMRK 93          
BLAST of RuvB-like helicase vs. Ensembl Medaka
Match: ruvbl1 (RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:101175391])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 337/456 (73.90%), Postives = 385/456 (84.43%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            MKIEEVKSTTKT RIASHSHVKGLGLDE GN+    A GLVGQ  AREA G+I E+I+AKK+AGRA+LLAGPPGTGKTA+ALAIAQELG+KVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKE KEVYEGEVTE+TP + +NP   YGKTISHV+I LKTAKGTK LK+DP IYE+LQKE+VEVGDVIYIE +SGAVKRQGR D ++ E+DLEA+EYVPLPKGD HKKKE+VQDVTLHDLDVANA PQGGQDI SMMGQLMK KKTEITDKLR +I+K+VN+YIDQG AELVPGVLF+DEVHMLD+ECFTYL RALE SIAPIV+FA+NRG C ++GTEDI S HGIP DLLDR++II+T  Y      +I+KIRAQ E + IS +A   LA I  +TTLRYA+QLLTP S + ++  KETV  E V E  ELF +AK SA+IL  ++ K+M
Sbjct:    1 MKIEEVKSTTKTQRIASHSHVKGLGLDEAGNA-KQTACGLVGQEAAREACGIIVELIQAKKMAGRAILLAGPPGTGKTALALAIAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDLEAEEYVPLPKGDVHKKKEIVQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRAEINKVVNRYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVVFASNRGKCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGISISEDALSHLAEIGTKTTLRYAVQLLTPGSLLGRVQGKETVEREQVEEINELFYDAKSSAKILQDQQHKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Medaka
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:101172354])

HSP 1 Score: 361.688 bits (927), Expect = 7.066e-121
Identity = 199/458 (43.45%), Postives = 291/458 (63.54%), Query Frame = 1
Query:   31 KIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEA--DEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            K+ EV+  T+  RI +HSH++GLGLD +      V+ G+VGQ  +R AAG+I EMIK   +AGRAVL+AG PGTGKTAIA+ IAQ LG   PF  + GSE++S E+ KTE L + FR+AIG+RIKE  E+ EGEV EI   Q D P++  G  +    + LKT +      +   + E+L KEKV+ GDVI I+ ++G + + GRS   + +YD      ++V  P+G+  K+KEVV  V+LH++DV N+  QG          L      EI  ++R  I+  V ++ ++G AE++PGVLFIDEVHMLD+ECF++L+RALE  ++P++I ATNRG+  ++GT + +S HGIP DLLDR+LII T  Y +    +ILKIR + E+V++S EA   L  I  +T+LRYA+QL++ A  + +      V +E +     LFL+  RS+Q +   ++ ++ 
Sbjct:    5 KVPEVRDITRIERIGAHSHIRGLGLD-DALEPRQVSQGMVGQLASRRAAGIILEMIKDGHIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEI---QIDRPATGTGAKVGK--LTLKTTEMETIYDLGNKMIESLSKEKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQG-------FLALFSGDTGEIKSEVREQINAKVCEWREEGKAEIIPGVLFIDEVHMLDMECFSFLNRALESDLSPVLIMATNRGITRIRGT-NYQSPHGIPIDLLDRLLIIATSPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGMETSLRYAIQLISTAGLVCRKRKGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFLF 448          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000031725.1 (SMESG000031725.1)

HSP 1 Score: 929.087 bits (2400), Expect = 0.000e+0
Identity = 457/457 (100.00%), Postives = 457/457 (100.00%), Query Frame = 1
Query:   28 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 1398
            MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML
Sbjct:    1 MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYML 457          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000033997.1 (SMESG000033997.1)

HSP 1 Score: 364.385 bits (934), Expect = 6.770e-122
Identity = 200/457 (43.76%), Postives = 290/457 (63.46%), Query Frame = 1
Query:   34 IEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDL--EADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 1395
            I   +  T+  RI +HSH++GLGL ++    P ++S G+VGQ +AR AAG+I EMIK   +AGR +L+AG PGTGKTAIA+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV E+   Q D P++  G     V+  LKT +      +   + E++ KEK++ GD+I I+  SG V R GRS   + +YD      ++V  P+G+  K KEVV  V LH++DV N+  QG       +  L      EI  ++R  ID  V ++ ++G AELVPGVLFIDEVHMLD+ECF++L+RA+E  +AP+++ ATNRGV  ++GT+  +S HGIP DLLDR+LII T  Y KD   +ILKIR + E+V+ S +A   L SI  +T+LRY++QL+T A+ + +    + V +  + +   LF++ KRS   LN  + +++
Sbjct:    8 ITAAREITRMERIGAHSHIRGLGLSDDLE--PRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 449          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000018207.1 (SMESG000018207.1)

HSP 1 Score: 358.992 bits (920), Expect = 1.069e-119
Identity = 204/474 (43.04%), Postives = 293/474 (61.81%), Query Frame = 1
Query:   34 IEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDL--EADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEH------VLEAEE-----------LFLNAKRSAQILNSEKEKYM 1395
            I   +  T+  RI +HSH++GLGL ++    P ++S G+VGQ +AR AAG+I EMIK   +AGR +L+AG PGTGKTAIA+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV E+   Q D P++  G     V+  LKT +      +   + E++ KEK++ GD+I I+  SG V R GRS   + +YD      ++V  P+G+  K KEVV  V LH++DV N+  QG       +  L      EI  ++R  ID  V ++ ++G AELVPGVLFIDEVHMLD+ECF++L+RA+E  +AP+++ ATNRGV  ++GT+  +S HGIP DLLDR+LII T  Y KD   +ILKIR + E+V+ S +A   L SI  +T+LRY++QL+T A   + +C K  V I        +++ +E           LF++ KRS   LN  + +++
Sbjct:    8 ITAAREITRMERIGAHSHIRGLGLSDDLE--PRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTA---NLVCRKRKVVIWKYFIDLALIQGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 463          
The following BLAST results are available for this feature:
BLAST of RuvB-like helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RUVBL10.000e+074.34RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL10.000e+074.34RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL10.000e+081.37RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL10.000e+081.37RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL21.599e-12242.92RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ruvb-10.000e+057.17RuvB-like 1 [Source:UniProtKB/Swiss-Prot;Acc:O176... [more]
ruvb-28.146e-11042.29RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZ... [more]
ruvb-28.146e-11042.29RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZ... [more]
vps-49.713e-624.39Related to yeast Vacuolar Protein Sorting factor ... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pont0.000e+069.15gene:FBgn0040078 transcript:FBtr0082226[more]
rept5.828e-12243.96gene:FBgn0040075 transcript:FBtr0331852[more]
rept5.828e-12243.96gene:FBgn0040075 transcript:FBtr0074988[more]
rept5.828e-12243.96gene:FBgn0040075 transcript:FBtr0344993[more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ruvbl10.000e+074.12RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:31767... [more]
ruvbl23.294e-12143.01RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:31767... [more]
ruvbl22.897e-12042.89RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:31767... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
med210.000e+074.34mediator complex subunit 21 [Source:Xenbase;Acc:XB... [more]
med210.000e+070.07mediator complex subunit 21 [Source:Xenbase;Acc:XB... [more]
ruvbl26.909e-12743.89RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl21.534e-12643.89RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl25.468e-12243.85RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ruvbl10.000e+074.34RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:192... [more]
Ruvbl21.040e-12242.92RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Ruvbl21.040e-12242.92RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Ruvbl14.679e-7684.33RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:192... [more]
Ruvbl21.710e-5741.34RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DE26|RUVB1_XENLA0.000e+074.34RuvB-like 1 OS=Xenopus laevis OX=8355 GN=ruvbl1 PE... [more]
sp|P60123|RUVB1_RAT0.000e+074.34RuvB-like 1 OS=Rattus norvegicus OX=10116 GN=Ruvbl... [more]
sp|P60122|RUVB1_MOUSE0.000e+074.34RuvB-like 1 OS=Mus musculus OX=10090 GN=Ruvbl1 PE=... [more]
sp|Q9Y265|RUVB1_HUMAN0.000e+074.34RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1... [more]
sp|Q8AWW7|RUVB1_DANRE0.000e+073.90RuvB-like 1 OS=Danio rerio OX=7955 GN=ruvbl1 PE=2 ... [more]
back to top
BLAST of RuvB-like helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JD950.000e+075.22RuvB-like helicase OS=Biomphalaria glabrata OX=652... [more]
A0A0B7B8P40.000e+075.22RuvB-like helicase OS=Arion vulgaris OX=1028688 GN... [more]
A0A293MX400.000e+073.90RuvB-like helicase (Fragment) OS=Ornithodoros erra... [more]
A0A2R5LHA10.000e+073.90RuvB-like helicase (Fragment) OS=Ornithodoros turi... [more]
A0A1Z5LAI60.000e+073.68RuvB-like helicase (Fragment) OS=Ornithodoros moub... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ruvbl10.000e+072.81RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:10304... [more]
ruvbl21.795e-12643.67RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ruvbl12.889e-15880.22RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:31767... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RVB10.000e+064.30ATP-dependent DNA helicase, also known as pontin; ... [more]
RVB21.711e-11643.92ATP-dependent DNA helicase, also known as reptin; ... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO404770.000e+070.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398421.395e-4444.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260411.945e-2856.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ruvbl10.000e+073.90RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:10117... [more]
ruvbl27.066e-12143.45RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of RuvB-like helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000031725.10.000e+0100.00SMESG000031725.1[more]
SMESG000033997.16.770e-12243.76SMESG000033997.1[more]
SMESG000018207.11.069e-11943.04SMESG000018207.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033919 ID=SMED30033919|Name=RuvB-like helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=1414bp
CTTAATTAATTATTTGCATAATTTTAGATGAAGATTGAAGAAGTAAAAAG
CACTACTAAAACACATAGAATCGCATCTCATAGCCACGTGAAAGGATTGG
GTTTAGATGAAAACGGAAATTCTATACCTGGCGTTGCTTCTGGTTTAGTT
GGTCAATATGAAGCTAGAGAAGCTGCAGGTGTTATAACAGAAATGATTAA
AGCTAAAAAACTTGCTGGTCGTGCGGTTTTACTAGCTGGCCCTCCTGGAA
CTGGGAAGACTGCTATAGCATTAGCTATTGCCCAAGAACTTGGCAGTAAA
GTTCCTTTTTGCCCAATGGTAGGTAGTGAAGTTTATTCATCAGAAATTAA
AAAAACTGAAGTTCTCATGGAAAATTTTCGGCGAGCTATAGGTTTGAGAA
TAAAAGAAGTTAAAGAAGTTTATGAAGGAGAGGTAACTGAGATTACACCG
GTCCAGGCAGATAATCCATCGAGCAGTTACGGGAAAACAATTAGTCACGT
CATGATTTGTTTGAAAACTGCTAAAGGAACTAAATCATTAAAAATGGATC
CGTTAATTTATGAAAATTTACAAAAAGAAAAAGTTGAAGTTGGCGATGTT
ATATATATAGAAGTGTCATCTGGAGCAGTAAAGCGTCAAGGTAGATCAGA
TGTATATTCAAATGAATACGACTTAGAAGCCGACGAATATGTTCCATTAC
CCAAAGGGGATGCACATAAGAAAAAAGAAGTGGTTCAGGATGTAACTTTG
CATGACTTAGATGTAGCTAATGCATATCCTCAAGGAGGTCAAGATATTGC
TTCTATGATGGGACAGCTTATGAAGCAAAAAAAAACTGAAATAACTGATA
AGTTACGGCGTGATATCGATAAAATTGTAAATAAATATATTGATCAAGGA
ACTGCCGAATTGGTTCCTGGAGTTTTGTTTATAGATGAAGTTCATATGCT
AGACTTAGAGTGTTTTACATATCTCTCTAGAGCTTTAGAGTACAGTATTG
CGCCAATTGTTATATTTGCAACTAATAGGGGTGTTTGTTCTGTTAAAGGA
ACTGAAGATATAAAATCATCTCATGGTATTCCTCAAGATCTTTTGGACAG
AATTTTGATTATCAAAACCAAAACTTATGATAAGGATGCATGTTTGGAGA
TATTGAAAATTCGAGCACAATTAGAAAATGTTAAAATTTCACATGAAGCT
TCAATTAAATTGGCATCTATTGCTGATCAAACAACACTTAGATATGCGTT
GCAATTACTTACACCAGCATCTAAAATATCTAAAATTTGTAGCAAGGAGA
CTGTTACTATTGAGCATGTTTTGGAAGCGGAGGAATTATTTTTAAATGCC
AAAAGGTCTGCTCAAATTCTTAATAGCGAAAAAGAAAAATATATGTTATA
AATAATAAACCTGT
back to top

protein sequence of SMED30033919-orf-1

>SMED30033919-orf-1 ID=SMED30033919-orf-1|Name=SMED30033919-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MKIEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVASGLVGQYEAREAA
GVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGS
EVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSS
YGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGA
VKRQGRSDVYSNEYDLEADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAY
PQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVL
FIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHG
IPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIAD
QTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNS
EKEKYML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0035267NuA4 histone acetyltransferase complex
GO:0097255R2TP complex
GO:0005634nucleus
GO:0031011Ino80 complex
Vocabulary: molecular function
TermDefinition
GO:00431395'-3' DNA helicase activity
GO:0003678DNA helicase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003713transcription coactivator activity
GO:0004386helicase activity
GO:0016787hydrolase activity
GO:0043141ATP-dependent 5'-3' DNA helicase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041048RuvB-like_C
IPR037938RUVBL1
IPR027238RuvB-like
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR010339TIP49_P-loop
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0016569covalent chromatin modification
GO:0030111regulation of Wnt signaling pathway
GO:0032508DNA duplex unwinding
GO:0042127regulation of cell proliferation
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 63..366
e-value: 1.2E-10
score: 51.3
IPR010339TIP49, P-loop domainPFAMPF06068TIP49coord: 14..369
e-value: 6.6E-165
score: 548.5
IPR041048RuvB-like, AAA-lid domainPFAMPF17856TIP49_Ccoord: 375..439
e-value: 7.2E-19
score: 67.7
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 367..457
e-value: 1.1E-26
score: 94.5
NoneNo IPR availableCDDcd00009AAAcoord: 48..124
e-value: 4.89663E-8
score: 50.2223
IPR037938RuvB-like helicase 1PANTHERPTHR11093:SF6RUVB-LIKE 1coord: 1..456
IPR027238RuvB-likePANTHERPTHR11093RUVB-RELATED REPTIN AND PONTINcoord: 1..456
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 38..438